3AZLB

Crystal structure of human nucleosome core particle containing h4k77q mutation
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
78
structure length
78
Chain Sequence
b'NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAQRKTVTAMDVVYALKRQGRTLYGFGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 25
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3azlB00
3MGPB 2YFWA 4XZQA 3W99C 4Z66D 3X1UC 3AN2C 2NZDC 5GT0C 3AZIA 3LZ1B 5B2ID 3X1TA 5F99B 3UT9D 4ZUXD 1KU5A 4DRBA 5B24C 1BH9B 3AZLB 3WKJA 5CPIC 3B0DC 3MGRC 3AZJB 2NQBD 4H9SC 2CV5C 1P3IB 5B2JC 3AV1A 4YS3C 3WTPA 3NQUB 1KX4D 2F8NA 1TAFA 1P3GA 1P3OB 5B1MD 4J8VB 5BS7C 1U35C 1S32C 5JA4B 1KX3D 1EQZC 4XUJB 5B0YB 3B6FB 3MNNC 4J8XD 2BYKB 1WWIA 5DNMD 3AZNC 5CPJA 3MGPC 3KUYC 5B40A 3AZEA 2AROA 4M6BA 4H9QA 3REJD 3TU4A 5BO0B 4XZQB 1P3AD 4R8PC 3X1VC 2RVQC 4WU9D 5B0ZA 5BNVA 3LZ1C 1P3FD 3A6NA 3AZIB 3AZHD 4H9OA 1TZYD 3AZLC 3MVDC 1M18A 3REIA 3AYWD 3WKJB 5B31G 3KWQC 5B33C 3AZMA 3LJAD 4YM6A 3AV1B 3WTPB 5AVBD 5B32A 1P3OC 4QLCD 2F8NB 1P3GB 3B6FC 3LZ0D 1BFMA 1P3MD 4JJND 1HTAA 3AV2D 1P34D 5CPJB 3X1UA 3LELD 2NZDA 3AZEB 5GT0A 5B40B 4KUDA 2AROB 4H9QB 4XZQC 5CPKC 1P3PC 1BH8A 5B24A 5B0ZB 5BNVB 3AZIC 3X1TC 3A6NB 5B2JA 4KGCC 4H9OB 5AV8A 3UTBB 2HUEB 5BS7A 3UTAA 4EO5C 4AWLC 3REIB 1M18B 1EQZA 1P3LD 5B1LD 3REHD 3AZNA 5AV5D 3AZMB 3AV1C 3C1BD 4YM6B 3KUYA 1P3GC 3AFAA 3UT9A 5B32B 4ZUXA 2PYOA 3W98C 4LD9D 4R8PA 3X1VA 3AZEC 5B40C 3X1UB 2NZDB 1P3BD 5GT0B 5AV9A 2F8NK 4KUDB 3VH5W 3TU4C 5B31D 1M1AC 5DNMA 1BH8B 5B0ZC 3MVDA 4J8UC 5B24B 4H9PA 4CSRA 3B0DB 3A6NC 3KWQA 5B33A 5B2JB 5CP6D 3KXBD 2L5AA 2HUEC 3C1CC 5DNND 3REJA 3B6GC 5AV8B 3RELD 1P3AA 5E5AC 3REIC 1M18C 3UTAB 4WU9A 1EQZB 3MNNB 3X1SD 3AZMC 3AZNB 5B32C 3KUYB 3AFAB 3UT9B 4ZUXB 4NE5A 2PYOB 5CPKA 3W99D 1P3PA 4WU8C 1P3KC 3AZGC 1A7WA 4R8PB 3X1VB 3AN2D 3WA9D 5AVCA 3B0BA 4X23D 3WAAD 4KUDC 4WNNA 3AZFD 5AV9B 1AOID 4KGCA 3MGQA 5GT3D 4E44A 1ZLAC 3O62D 5DNMB 5AY8C 3MVDB 1M19D 5CPID 1P34A 3AZHC 2CV5D 4H9PB 4CSRB 3MGSD 3KWQB 5B33B 4YS3D 5AV8C 4Z66C 3REJB 3UTAC 4G91C 1S32D 3B0CW 1P3AB 3W98A 3AZKD 3VH6A 5B2IC 3MGPD 3W96A 3AFAC 3UT9C 2YFWB 4ZUXC 2PYOC 2F8NG 4NFTA 5CPKB 2NQBC 3REKA 1P3PB 1P3LA 1M1AA 5JRGA 4J8UA 3LZ1D 5AVCB 3C1BA 5AV9C 5GXQA 5F99D 1N1JA 5B1MC 3X1TB 1H3OA 1KX3C 4KGCB 2F8NH 3C1CA 3B6GA 3MGQB 5DNMC 3AZLD 2LY8A 5E5AA 3AZJD 2YFVA 1P3ID 4EO5B 4AWLB 1P34B 4HGAC 1P3BA 5GSUD 3REJC 4J8VD 1TAFB 1P3AC 3B6FD 4XUJD 5B0YD 3W97A 4WU9C 3W98B 4Z5TA 4WU8A 5G49A 1P3KA 1P3FC 3AZGA 1HQ3D 3V9RA 3W96B 3RELA 4XZQD 5B32G 3TU4B 5BT1C 3AYWC 1ZLAA 3REKB 3X1SA 1P3LB 1M1AB 5AVCC 5JRGB 3LJAC 5AY8A 4NE6A 4J8UB 3AZID 3AZHA 1F66A 4QLCC 5GXQB 1N1JB 3MGQC 3WTPE 3C1CB 4Z66A 4JJNC 3AV2C 3B6GB 3WKJD 5E5AB 1P34C 1KX5D 2YFVB 3WA9A 4WZSB 4J8WD 3AV1D 3WAAA 5B2IA 3WTPD 3VH6T 3W97B 2NQBA 4Z5TB 5CPJD 4WU8B 5G49B 1P3KB 3AZED 3MGSA 3AZGB 3W96C 3V9RB 1KX4A 2AROD 5B1MA 3RELB 1KX3A 3REKC 1P3LC 1WWSA 4J8XA 5FUGA 5JRGC 1ZLAB 3X1SB 5AV5C 3C1BC 5AY8B 2HIOD 5GXQC 3A6ND 3AZHB 4KHAA 1F66B 3UTBD 4CAYA 1ID3D 4Z66B 4G91B 4G92C 2IO5B 5AV6D 3WA9B 1P3BC 4YM6D 1P3FA 2FJ7D 5F99A 5B2IB 5B32D 4UUZA 1F1EA 5B31C 3W97C 1TZYA 4Z5TC 3AYWA 2NQBB 4WV4B 3X1UD 3LJAA 2NZDD 5GT0D 3MGSB 5CP6C 5GSUA 3VH5A 5DNNC 5AVBA 4QLCA 4J8VA 1KX4B 3RELC 3LZ0A 5B1MB 1P3MA 1KX3B 4JJNA 3AV2A 3X1SC 4J8XB 5FUGB 5B24D 3MGRD 1HQ3A 1F66C 3LELA 4HGAB 4KHAB 5B2JD 5BO0A 5AV8D 4CAYB 3NQJA 3UTAD 1U35D 1EQZD 2IO5C 3MNND 3WA9C 4WU9B 3WAAC 4X23C 3AZND 4DRAA 3AZFC 3KUYD 1P3FB 1AOIC 3AFAD 5GT3C 4UUZB 2PYOD 4ZBJB 1TZYB 3O62C 1M19C 4R8PD 1KX5A 3X1VD 5B1LA 2RVQD 3REHA 3AYWB 3MGSC 4J8WA 5AV5A 4H9NA 3LJAB 1KX4C 5AV9D 5GSUB 2CWEA 5AVBB 4WNNB 4QLCB 1B67A 2JSSA 3LZ0B 1P3MB 4J8XC 3AZKC 3MVDD 4JJNB 5KDMA 3AV2B 4LD9A 1HQ3B 3KWQD 5B33D 3LELB 1P3OD 3NQJB 5B31A 2HIOA 5F99C 3KXBA 5CP6A 4H9RA 3UTBA 1ID3A 5DNNA 4ZBJC 1TZYC 3R45A 3AZJC 5CPKD 1P3PD 5BT1D 1P3IC 3VH5T 1KX5B 5AV6A 5B1LB 3REHB 5AVCD 5C3IB 2FJ7A 4J8WB 5AV5B 5GSUC 4H9NB 5AVBC 3C1BB 3X1TD 4J8VC 4NE3A 3LZ0C 4XUJC 5B0YC 4KGCD 1H3OB 1P3MC 3MGQD 3W99A 1JFIA 5BNXA 2BYMA 4LD9B 5KDMB 1HQ3C 3LELC 3AN2A 4G92B 4X23A 4Z2MG 1P3BB 2F8ND 3AZFA 1P3GD 1AOIA 5GT3A 5CHLB 3W98D 5B31B 3O62A 1M19A 3MGRA 5CPIA 4H9SA 2CV5A 2HIOB 5B40D 4Z2MH 3W96D 4YS3A 3KXBB 5CP6B 4H9RB 1ID3B 5DNNB 1ULYA 3TU4D 1U35A 1S32A 3R45B 3WKJC 1KX5C 3MNNA 5B1LC 3REKD 3REHC 1M1AD 5C3IC 5JRGD 3AZKA 5AV6B 5B0ZD 4J8WC 4J8UD 3WTPC 3MGPA 2FJ7B 5GXQD 1Q9CA 3C1CD 3B6GD 3W99B 5E5AD 3REID 1M18D 5CPJC 4LD9C 1JFIB 3KSYA 2BYMB 5BNXB 3AN2B 3B0CT 3LZ1A 3AZMD 2AROC 4X23B 3WAAB 4E45A 3AZFB 1AOIB 5GT3B 3W97D 1BH9A 3AZLA 3AZJA 4Z5TD 3O62B 4WU8D 1P3KD 2HIOC 1P3IA 3MGRB 3AZGD 5CPIB 1R4VA 1M19B 2CV5B 3NQUA 1B6WA 3KXBC 3UTBC 4YS3B 1ID3C 4KUDD 1P3OA 5JA4A 3B6FA 4XUJA 5B0YA 1U35B 1S32B 2BYKA 5AV6C 1ZLAD 4YM6C 5AY8D 3AZKB 2FJ7C 3VH6W 1F66D
chains in the Genus database with same CATH superfamily
3MGPB 2YFWA 4XZQA 3W99C 4Z66D 3X1UC 3AN2C 2NZDC 5GT0C 3AZIA 3LZ1B 5B2ID 3X1TA 5F99B 3UT9D 4ZUXD 1KU5A 4DRBA 3EPHA 5B24C 1BH9B 3AZLB 2DF4C 3WKJA 5CPIC 3B0DC 3MGRC 3AZJB 2NQBD 4H9SC 2CV5C 1P3IB 5B2JC 3AV1A 4YS3C 3WTPA 3NQUB 1KX4D 2F8NA 1TAFA 1P3GA 1P3OB 5B1MD 4J8VB 5BS7C 1U35C 1S32C 5JA4B 1KX3D 1EQZC 4XUJB 5B0YB 3B6FB 3MNNC 4J8XD 2BYKB 1WWIA 5DNMD 3AZNC 5CPJA 3MGPC 3KUYC 5B40A 3AZEA 2Y2MA 2AROA 4M6BA 4H9QA 3KFUG 3REJD 3TU4A 5BO0B 3IP4C 4XZQB 1P3AD 4R8PC 3X1VC 2RVQC 4WU9D 5B0ZA 5BNVA 3LZ1C 1P3FD 2F2AC 3A6NA 3AZIB 3AZHD 4H9OA 1TZYD 3AZLC 3MVDC 2ZY3A 3REIA 1M18A 3AYWD 3WKJB 5B31G 3KWQC 5B33C 3AZMA 3LJAD 4YM6A 3AV1B 3WTPB 5AVBD 5B32A 1P3OC 4QLCD 2F8NB 1P3GB 3B6FC 3LZ0D 1BFMA 1P3MD 4JJND 1HTAA 3AV2D 1P34D 5CPJB 3X1UA 3LELD 2NZDA 3AZEB 5GT0A 5B40B 2VQRA 4KUDA 2AROB 4H9QB 4XZQC 5CPKC 1P3PC 1BH8A 1PZRA 5B24A 5B0ZB 5BNVB 3AZIC 3X1TC 3A6NB 5B2JA 4KGCC 4H9OB 5AV8A 3UTBB 2HUEB 5BS7A 3UTAA 4EO5C 4AWLC 3REIB 1M18B 1EQZA 1P3LD 5B1LD 3REHD 3AZNA 5AV5D 3AZMB 3AV1C 3C1BD 4YM6B 3KUYA 1P3GC 3AFAA 3UT9A 5B32B 4ZUXA 2PYOA 3W98C 3EPJA 2BG1A 4LD9D 4R8PA 3X1VA 3AZEC 5B40C 3X1UB 2ZM5A 2NZDB 1P3BD 5GT0B 5AV9A 2F8NK 4KUDB 3VH5W 3TU4C 5B31D 1M1AC 5DNMA 1BH8B 5B0ZC 3MVDA 4J8UC 5B24B 4H9PA 4CSRA 3B0DB 3A6NC 4DQYB 3KWQA 5B33A 5B2JB 5CP6D 3KXBD 2L5AA 2HUEC 3C1CC 2Y2LA 5DNND 3REJA 3B6GC 5AV8B 3RELD 1P3AA 5E5AC 3REIC 1M18C 3UTAB 4WU9A 1EQZB 3MNNB 3X1SD 3AZMC 2Y2KA 3AZNB 5B32C 3KUYB 3AFAB 3UT9B 4ZUXB 4NE5A 2PYOB 5CPKA 4UPKA 3W99D 1P3PA 4WU8C 1P3KC 3AZGC 2Y2PA 1A7WA 4R8PB 3X1VB 3AN2D 3WA9D 5AVCA 3B0BA 4X23D 3WAAD 4KUDC 4WNNA 3AZFD 5AV9B 1AOID 4KGCA 1W2EA 3MGQA 5GT3D 4E44A 1ZLAC 3O62D 5DNMB 5AY8C 2XD1A 3MVDB 5CPID 1P34A 3AZHC 1M19D 2CV5D 4H9PB 4CSRB 3MGSD 3KWQB 5B33B 4YS3D 2ZY5A 5AV8C 4Z66C 3REJB 3UTAC 4G91C 1S32D 3B0CW 1P3AB 3W98A 3AZKD 3VH6A 5B2IC 3MGPD 3W96A 3AFAC 3UT9C 2YFWB 4ZUXC 2PYOC 2F8NG 4NFTA 5CPKB 2NQBC 3REKA 1P3PB 2Y2OA 1P3LA 1M1AA 5JRGA 3A1KA 4J8UA 3LZ1D 5AVCB 3C1BA 5AV9C 5GXQA 5F99D 1N1JA 5B1MC 3X1TB 1H3OA 1KX3C 4KGCB 2F8NH 3C1CA 3B6GA 3MGQB 5DNMC 3AZLD 2LY8A 5E5AA 3AZJD 2YFVA 1P3ID 4EO5B 4AWLB 1P34B 4HGAC 1P3BA 3H0MC 5GSUD 3REJC 2ZY2A 4J8VD 1TAFB 1P3AC 3B6FD 4XUJD 5B0YD 3W97A 4WU9C 3W98B 4Z5TA 2FFFB 4WU8A 5G49A 1P3KA 1P3FC 3AZGA 1HQ3D 3V9RA 3W96B 2G5HC 3RELA 4XZQD 5B32G 3TU4B 5BT1C 3AYWC 2Y2NA 1ZLAA 3REKB 3X1SA 1P3LB 1M1AB 5AVCC 5JRGB 3LJAC 5AY8A 4NE6A 4J8UB 3AZID 3AZHA 1F66A 4QLCC 5GXQB 1N1JB 3MGQC 3WTPE 3C1CB 4Z66A 4JJNC 3AV2C 3B6GB 3WKJD 5E5AB 1P34C 1KX5D 2YFVB 3WA9A 4WZSB 4J8WD 3AV1D 3WAAA 2JE5A 5B2IA 3WTPD 3VH6T 3W97B 2NQBA 4Z5TB 5CPJD 2W8SA 4WU8B 5G49B 1P3KB 3AZED 3MGSA 3AZGB 3W96C 3V9RB 1KX4A 2AROD 5B1MA 3RELB 1KX3A 2RIQA 3REKC 1P3LC 1WWSA 4J8XA 5FUGA 5JRGC 1ZLAB 3X1SB 5AV5C 3C1BC 5AY8B 2HIOD 5GXQC 3A6ND 3AZHB 4KHAA 1F66B 3UTBD 4CAYA 1ID3D 2Y2GA 4Z66B 4G91B 4G92C 2IO5B 5AV6D 3WA9B 1P3BC 4YM6D 2Y2QA 3EPLA 1P3FA 2FJ7D 5F99A 5B2IB 5B32D 4UUZA 1F1EA 5B31C 3W97C 1TZYA 4Z5TC 3AYWA 2NQBB 4WV4B 3X1UD 2JCHA 3LJAA 2NZDD 5GT0D 3MGSB 5CP6C 5GSUA 3VH5A 5DNNC 5AVBA 4QLCA 4J8VA 1KX4B 3RELC 2G5IC 5B1MB 3LZ0A 1P3MA 1KX3B 4JJNA 3AV2A 3X1SC 4J8XB 2Y2HA 5FUGB 5B24D 2Y2IA 3MGRD 1HQ3A 1F66C 3LELA 4HGAB 4KHAB 5B2JD 5BO0A 5AV8D 2Y2JA 4CAYB 3NQJA 3UTAD 1U35D 3H0LC 1EQZD 2IO5C 3MNND 3WA9C 4WU9B 2J8PA 3WAAC 4X23C 3AZND 4DRAA 3AZFC 3KUYD 1P3FB 1AOIC 3AFAD 5GT3C 4UUZB 2PYOD 4ZBJB 1TZYB 3O62C 1M19C 4R8PD 1KX5A 3X1VD 5B1LA 2RVQD 3REHA 3AYWB 3MGSC 4J8WA 5AV5A 4H9NA 3LJAB 1KX4C 5AV9D 5GSUB 2CWEA 5AVBB 4WNNB 4QLCB 1B67A 2JSSA 3LZ0B 1P3MB 4J8XC 3AZKC 3MVDD 4JJNB 5KDMA 3AV2B 4LD9A 1HQ3B 3KWQD 5B33D 3LELB 1P3OD 3NQJB 5B31A 3FDDA 2HIOA 5F99C 3KXBA 5CP6A 4H9RA 3UTBA 1ID3A 5DNNA 4ZBJC 1TZYC 3H0RC 3EPKA 3R45A 3AZJC 5CPKD 1P3PD 5BT1D 1P3IC 3VH5T 2DQNC 1KX5B 5AV6A 5B1LB 3REHB 5AVCD 5C3IB 2FJ7A 4J8WB 5AV5B 5GSUC 4H9NB 5AVBC 3C1BB 3X1TD 4J8VC 4NE3A 3LZ0C 3P5JB 4XUJC 5B0YC 1H3OB 1P3MC 3MGQD 4KGCD 3W99A 1JFIA 5BNXA 2BYMA 4LD9B 5KDMB 1HQ3C 3LELC 3AN2A 4G92B 4X23A 3A1IA 4Z2MG 1P3BB 2F8ND 3AZFA 1P3GD 1AOIA 2ZY4A 5GT3A 5CHLB 3W98D 1T3UA 5B31B 3O62A 1M19A 3MGRA 5CPIA 4H9SA 2CV5A 2HIOB 5B40D 4Z2MH 3W96D 4YS3A 3KXBB 5CP6B 4H9RB 3AL0C 1ID3B 5DNNB 1ULYA 3TU4D 1U35A 1S32A 3R45B 3WKJC 2UWXA 1KX5C 3MNNA 5B1LC 3REKD 3EG5B 3REHC 1M1AD 5C3IC 5JRGD 3AZKA 5AV6B 5B0ZD 4J8WC 4J8UD 3WTPC 3MGPA 2FJ7B 5GXQD 1Q9CA 3C1CD 3B6GD 3W99B 5E5AD 3REID 1M18D 5CPJC 4LD9C 1JFIB 3KSYA 2BYMB 5BNXB 3AN2B 3B0CT 3LZ1A 3AZMD 2AROC 3F6TA 4X23B 3WAAB 4E45A 3AZFB 1AOIB 5GT3B 1Z2CB 3W97D 1BH9A 3AZLA 3AZJA 2XD5A 4Z5TD 3O62B 4WU8D 1P3KD 2HIOC 1P3IA 3MGRB 3AZGD 5CPIB 1R4VA 1M19B 2CV5B 4WJ3C 3NQUA 1B6WA 3KXBC 3UTBC 4YS3B 1ID3C 4KUDD 1P3OA 5JA4A 3B6FA 4XUJA 5B0YA 1U35B 1S32B 2BYKA 5AV6C 1ZLAD 4YM6C 5AY8D 3AZKB 2FJ7C 3VH6W 1F66D
chains in the Genus database with same CATH topology
3MGPB 2YFWA 4XZQA 3W99C 4Z66D 3X1UC 3AN2C 2NZDC 5GT0C 3AZIA 3LZ1B 5B2ID 3X1TA 5F99B 3UT9D 4ZUXD 1KU5A 4DRBA 3EPHA 5B24C 1BH9B 3AZLB 2DF4C 3WKJA 5CPIC 3B0DC 3MGRC 3AZJB 2NQBD 4H9SC 2CV5C 1P3IB 5B2JC 3AV1A 4YS3C 3WTPA 3NQUB 1KX4D 2F8NA 1TAFA 1P3GA 1P3OB 5B1MD 4J8VB 5BS7C 1U35C 1S32C 5JA4B 1KX3D 1EQZC 4XUJB 5B0YB 3B6FB 3MNNC 4J8XD 2BYKB 1WWIA 5DNMD 3AZNC 5CPJA 3MGPC 3KUYC 5B40A 3AZEA 2Y2MA 2AROA 4M6BA 4H9QA 3KFUG 3REJD 3TU4A 5BO0B 3IP4C 4XZQB 1P3AD 4R8PC 3X1VC 2RVQC 4WU9D 5B0ZA 5BNVA 3LZ1C 1P3FD 2F2AC 3A6NA 3AZIB 3AZHD 4H9OA 1TZYD 3AZLC 3MVDC 2ZY3A 3REIA 1M18A 3AYWD 3WKJB 5B31G 3KWQC 5B33C 3AZMA 3LJAD 4YM6A 3AV1B 3WTPB 5AVBD 5B32A 1P3OC 4QLCD 2F8NB 1P3GB 3B6FC 3LZ0D 1BFMA 1P3MD 4JJND 1HTAA 3AV2D 1P34D 5CPJB 3X1UA 3LELD 2NZDA 3AZEB 5GT0A 5B40B 2VQRA 4KUDA 2AROB 4H9QB 4XZQC 5CPKC 1P3PC 1BH8A 1PZRA 5B24A 5B0ZB 5BNVB 3AZIC 3X1TC 3A6NB 5B2JA 4KGCC 4H9OB 5AV8A 3UTBB 2HUEB 5BS7A 3UTAA 4EO5C 4AWLC 3REIB 1M18B 1EQZA 1P3LD 5B1LD 3REHD 3AZNA 5AV5D 3AZMB 3AV1C 3C1BD 4YM6B 3KUYA 1P3GC 3AFAA 3UT9A 5B32B 4ZUXA 2PYOA 3W98C 3EPJA 2BG1A 4LD9D 4R8PA 3X1VA 3AZEC 5B40C 3X1UB 2ZM5A 2NZDB 1P3BD 5GT0B 5AV9A 2F8NK 4KUDB 3VH5W 3TU4C 5B31D 1M1AC 5DNMA 1BH8B 5B0ZC 3MVDA 4J8UC 5B24B 4H9PA 4CSRA 3B0DB 3A6NC 4DQYB 3KWQA 5B33A 5B2JB 5CP6D 3KXBD 2L5AA 2HUEC 3C1CC 2Y2LA 5DNND 3REJA 3B6GC 5AV8B 3RELD 1P3AA 5E5AC 3REIC 1M18C 3UTAB 4WU9A 1EQZB 3MNNB 3X1SD 3AZMC 2Y2KA 3AZNB 5B32C 3KUYB 3AFAB 3UT9B 4ZUXB 4NE5A 2PYOB 5CPKA 4UPKA 3W99D 1P3PA 4WU8C 1P3KC 3AZGC 2Y2PA 1A7WA 4R8PB 3X1VB 3AN2D 3WA9D 5AVCA 3B0BA 4X23D 3WAAD 4KUDC 4WNNA 3AZFD 5AV9B 1AOID 4KGCA 1W2EA 3MGQA 5GT3D 4E44A 1ZLAC 3O62D 5DNMB 5AY8C 2XD1A 3MVDB 5CPID 1P34A 3AZHC 1M19D 2CV5D 4H9PB 4CSRB 3MGSD 3KWQB 5B33B 4YS3D 2ZY5A 5AV8C 4Z66C 3REJB 3UTAC 4G91C 1S32D 3B0CW 1P3AB 3W98A 3AZKD 3VH6A 5B2IC 3MGPD 3W96A 3AFAC 3UT9C 2YFWB 4ZUXC 2PYOC 2F8NG 4NFTA 5CPKB 2NQBC 3REKA 1P3PB 2Y2OA 1P3LA 1M1AA 5JRGA 3A1KA 4J8UA 3LZ1D 5AVCB 3C1BA 5AV9C 5GXQA 5F99D 1N1JA 5B1MC 3X1TB 1H3OA 1KX3C 4KGCB 2F8NH 3C1CA 3B6GA 3MGQB 5DNMC 3AZLD 2LY8A 5E5AA 3AZJD 2YFVA 1P3ID 4EO5B 4AWLB 1P34B 4HGAC 1P3BA 3H0MC 5GSUD 3REJC 2ZY2A 4J8VD 1TAFB 1P3AC 3B6FD 4XUJD 5B0YD 3W97A 4WU9C 3W98B 4Z5TA 2FFFB 4WU8A 5G49A 1P3KA 1P3FC 3AZGA 1HQ3D 3V9RA 3W96B 2G5HC 3RELA 4XZQD 5B32G 3TU4B 5BT1C 3AYWC 2Y2NA 1ZLAA 3REKB 3X1SA 1P3LB 1M1AB 5AVCC 5JRGB 3LJAC 5AY8A 4NE6A 4J8UB 3AZID 3AZHA 1F66A 4QLCC 5GXQB 1N1JB 3MGQC 3WTPE 3C1CB 4Z66A 4JJNC 3AV2C 3B6GB 3WKJD 5E5AB 1P34C 1KX5D 2YFVB 3WA9A 4WZSB 4J8WD 3AV1D 3WAAA 2JE5A 5B2IA 3WTPD 3VH6T 3W97B 2NQBA 4Z5TB 5CPJD 2W8SA 4WU8B 5G49B 1P3KB 3AZED 3MGSA 3AZGB 3W96C 3V9RB 1KX4A 2AROD 5B1MA 3RELB 1KX3A 2RIQA 3REKC 1P3LC 1WWSA 4J8XA 5FUGA 5JRGC 1ZLAB 3X1SB 5AV5C 3C1BC 5AY8B 2HIOD 5GXQC 3A6ND 3AZHB 4KHAA 1F66B 3UTBD 4CAYA 1ID3D 2Y2GA 4Z66B 4G91B 4G92C 2IO5B 5AV6D 3WA9B 1P3BC 4YM6D 2Y2QA 3EPLA 1P3FA 2FJ7D 5F99A 5B2IB 5B32D 4UUZA 1F1EA 5B31C 3W97C 1TZYA 4Z5TC 3AYWA 2NQBB 4WV4B 3X1UD 2JCHA 3LJAA 2NZDD 5GT0D 3MGSB 5CP6C 5GSUA 3VH5A 5DNNC 5AVBA 4QLCA 4J8VA 1KX4B 3RELC 2G5IC 5B1MB 3LZ0A 1P3MA 1KX3B 4JJNA 3AV2A 3X1SC 4J8XB 2Y2HA 5FUGB 5B24D 2Y2IA 3MGRD 1HQ3A 1F66C 3LELA 4HGAB 4KHAB 5B2JD 5BO0A 5AV8D 2Y2JA 4CAYB 3NQJA 3UTAD 1U35D 3H0LC 1EQZD 2IO5C 3MNND 3WA9C 4WU9B 2J8PA 3WAAC 4X23C 3AZND 4DRAA 3AZFC 3KUYD 1P3FB 1AOIC 3AFAD 5GT3C 4UUZB 2PYOD 4ZBJB 1TZYB 3O62C 1M19C 4R8PD 1KX5A 3X1VD 5B1LA 2RVQD 3REHA 3AYWB 3MGSC 4J8WA 5AV5A 4H9NA 3LJAB 1KX4C 5AV9D 5GSUB 2CWEA 5AVBB 4WNNB 4QLCB 1B67A 2JSSA 3LZ0B 1P3MB 4J8XC 3AZKC 3MVDD 4JJNB 5KDMA 3AV2B 4LD9A 1HQ3B 3KWQD 5B33D 3LELB 1P3OD 3NQJB 5B31A 3FDDA 2HIOA 5F99C 3KXBA 5CP6A 4H9RA 3UTBA 1ID3A 5DNNA 4ZBJC 1TZYC 3H0RC 3EPKA 3R45A 3AZJC 5CPKD 1P3PD 5BT1D 1P3IC 3VH5T 2DQNC 1KX5B 5AV6A 5B1LB 3REHB 5AVCD 5C3IB 2FJ7A 4J8WB 5AV5B 5GSUC 4H9NB 5AVBC 3C1BB 3X1TD 4J8VC 4NE3A 3LZ0C 3P5JB 4XUJC 5B0YC 1H3OB 1P3MC 3MGQD 4KGCD 3W99A 1JFIA 5BNXA 2BYMA 4LD9B 5KDMB 1HQ3C 3LELC 3AN2A 4G92B 4X23A 3A1IA 4Z2MG 1P3BB 2F8ND 3AZFA 1P3GD 1AOIA 2ZY4A 5GT3A 5CHLB 3W98D 1T3UA 5B31B 3O62A 1M19A 3MGRA 5CPIA 4H9SA 2CV5A 2HIOB 5B40D 4Z2MH 3W96D 4YS3A 3KXBB 5CP6B 4H9RB 3AL0C 1ID3B 5DNNB 1ULYA 3TU4D 1U35A 1S32A 3R45B 3WKJC 2UWXA 1KX5C 3MNNA 5B1LC 3REKD 3EG5B 3REHC 1M1AD 5C3IC 5JRGD 3AZKA 5AV6B 5B0ZD 4J8WC 4J8UD 3WTPC 3MGPA 2FJ7B 5GXQD 1Q9CA 3C1CD 3B6GD 3W99B 5E5AD 3REID 1M18D 5CPJC 4LD9C 1JFIB 3KSYA 2BYMB 5BNXB 3AN2B 3B0CT 3LZ1A 3AZMD 2AROC 3F6TA 4X23B 3WAAB 4E45A 3AZFB 1AOIB 5GT3B 1Z2CB 3W97D 1BH9A 3AZLA 3AZJA 2XD5A 4Z5TD 3O62B 4WU8D 1P3KD 2HIOC 1P3IA 3MGRB 3AZGD 5CPIB 1R4VA 1M19B 2CV5B 4WJ3C 3NQUA 1B6WA 3KXBC 3UTBC 4YS3B 1ID3C 4KUDD 1P3OA 5JA4A 3B6FA 4XUJA 5B0YA 1U35B 1S32B 2BYKA 5AV6C 1ZLAD 4YM6C 5AY8D 3AZKB 2FJ7C 3VH6W 1F66D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MGP B;  2YFW A;  4XZQ A;  3W99 C;  4Z66 D;  3X1U C;  3AN2 C;  2NZD C;  5GT0 C;  3AZI A;  3LZ1 B;  5B2I D;  3X1T A;  5F99 B;  3UT9 D;  4ZUX D;  1KU5 A;  4DRB A;  5B24 C;  1BH9 B;  3AZL B;  3WKJ A;  5CPI C;  3B0D C;  3MGR C;  3AZJ B;  2NQB D;  4H9S C;  2CV5 C;  1P3I B;  5B2J C;  3AV1 A;  4YS3 C;  3WTP A;  3NQU B;  1KX4 D;  2F8N A;  1TAF A;  1P3G A;  1P3O B;  5B1M D;  4J8V B;  5BS7 C;  1U35 C;  1S32 C;  5JA4 B;  1KX3 D;  1EQZ C;  4XUJ B;  5B0Y B;  3B6F B;  3MNN C;  4J8X D;  2BYK B;  1WWI A;  5DNM D;  3AZN C;  5CPJ A;  3MGP C;  3KUY C;  5B40 A;  3AZE A;  2ARO A;  4M6B A;  4H9Q A;  3REJ D;  3TU4 A;  5BO0 B;  4XZQ B;  1P3A D;  4R8P C;  3X1V C;  2RVQ C;  4WU9 D;  5B0Z A;  5BNV A;  3LZ1 C;  1P3F D;  3A6N A;  3AZI B;  3AZH D;  4H9O A;  1TZY D;  3AZL C;  3MVD C;  1M18 A;  3REI A;  3AYW D;  3WKJ B;  5B31 G;  3KWQ C;  5B33 C;  3AZM A;  3LJA D;  4YM6 A;  3AV1 B;  3WTP B;  5AVB D;  5B32 A;  1P3O C;  4QLC D;  2F8N B;  1P3G B;  3B6F C;  3LZ0 D;  1BFM A;  1P3M D;  4JJN D;  1HTA A;  3AV2 D;  1P34 D;  5CPJ B;  3X1U A;  3LEL D;  2NZD A;  3AZE B;  5GT0 A;  5B40 B;  4KUD A;  2ARO B;  4H9Q B;  4XZQ C;  5CPK C;  1P3P C;  1BH8 A;  5B24 A;  5B0Z B;  5BNV B;  3AZI C;  3X1T C;  3A6N B;  5B2J A;  4KGC C;  4H9O B;  5AV8 A;  3UTB B;  2HUE B;  5BS7 A;  3UTA A;  4EO5 C;  4AWL C;  3REI B;  1M18 B;  1EQZ A;  1P3L D;  5B1L D;  3REH D;  3AZN A;  5AV5 D;  3AZM B;  3AV1 C;  3C1B D;  4YM6 B;  3KUY A;  1P3G C;  3AFA A;  3UT9 A;  5B32 B;  4ZUX A;  2PYO A;  3W98 C;  4LD9 D;  4R8P A;  3X1V A;  3AZE C;  5B40 C;  3X1U B;  2NZD B;  1P3B D;  5GT0 B;  5AV9 A;  2F8N K;  4KUD B;  3VH5 W;  3TU4 C;  5B31 D;  1M1A C;  5DNM A;  1BH8 B;  5B0Z C;  3MVD A;  4J8U C;  5B24 B;  4H9P A;  4CSR A;  3B0D B;  3A6N C;  3KWQ A;  5B33 A;  5B2J B;  5CP6 D;  3KXB D;  2L5A A;  2HUE C;  3C1C C;  5DNN D;  3REJ A;  3B6G C;  5AV8 B;  3REL D;  1P3A A;  5E5A C;  3REI C;  1M18 C;  3UTA B;  4WU9 A;  1EQZ B;  3MNN B;  3X1S D;  3AZM C;  3AZN B;  5B32 C;  3KUY B;  3AFA B;  3UT9 B;  4ZUX B;  4NE5 A;  2PYO B;  5CPK A;  3W99 D;  1P3P A;  4WU8 C;  1P3K C;  3AZG C;  1A7W A;  4R8P B;  3X1V B;  3AN2 D;  3WA9 D;  5AVC A;  3B0B A;  4X23 D;  3WAA D;  4KUD C;  4WNN A;  3AZF D;  5AV9 B;  1AOI D;  4KGC A;  3MGQ A;  5GT3 D;  4E44 A;  1ZLA C;  3O62 D;  5DNM B;  5AY8 C;  3MVD B;  1M19 D;  5CPI D;  1P34 A;  3AZH C;  2CV5 D;  4H9P B;  4CSR B;  3MGS D;  3KWQ B;  5B33 B;  4YS3 D;  5AV8 C;  4Z66 C;  3REJ B;  3UTA C;  4G91 C;  1S32 D;  3B0C W;  1P3A B;  3W98 A;  3AZK D;  3VH6 A;  5B2I C;  3MGP D;  3W96 A;  3AFA C;  3UT9 C;  2YFW B;  4ZUX C;  2PYO C;  2F8N G;  4NFT A;  5CPK B;  2NQB C;  3REK A;  1P3P B;  1P3L A;  1M1A A;  5JRG A;  4J8U A;  3LZ1 D;  5AVC B;  3C1B A;  5AV9 C;  5GXQ A;  5F99 D;  1N1J A;  5B1M C;  3X1T B;  1H3O A;  1KX3 C;  4KGC B;  2F8N H;  3C1C A;  3B6G A;  3MGQ B;  5DNM C;  3AZL D;  2LY8 A;  5E5A A;  3AZJ D;  2YFV A;  1P3I D;  4EO5 B;  4AWL B;  1P34 B;  4HGA C;  1P3B A;  5GSU D;  3REJ C;  4J8V D;  1TAF B;  1P3A C;  3B6F D;  4XUJ D;  5B0Y D;  3W97 A;  4WU9 C;  3W98 B;  4Z5T A;  4WU8 A;  5G49 A;  1P3K A;  1P3F C;  3AZG A;  1HQ3 D;  3V9R A;  3W96 B;  3REL A;  4XZQ D;  5B32 G;  3TU4 B;  5BT1 C;  3AYW C;  1ZLA A;  3REK B;  3X1S A;  1P3L B;  1M1A B;  5AVC C;  5JRG B;  3LJA C;  5AY8 A;  4NE6 A;  4J8U B;  3AZI D;  3AZH A;  1F66 A;  4QLC C;  5GXQ B;  1N1J B;  3MGQ C;  3WTP E;  3C1C B;  4Z66 A;  4JJN C;  3AV2 C;  3B6G B;  3WKJ D;  5E5A B;  1P34 C;  1KX5 D;  2YFV B;  3WA9 A;  4WZS B;  4J8W D;  3AV1 D;  3WAA A;  5B2I A;  3WTP D;  3VH6 T;  3W97 B;  2NQB A;  4Z5T B;  5CPJ D;  4WU8 B;  5G49 B;  1P3K B;  3AZE D;  3MGS A;  3AZG B;  3W96 C;  3V9R B;  1KX4 A;  2ARO D;  5B1M A;  3REL B;  1KX3 A;  3REK C;  1P3L C;  1WWS A;  4J8X A;  5FUG A;  5JRG C;  1ZLA B;  3X1S B;  5AV5 C;  3C1B C;  5AY8 B;  2HIO D;  5GXQ C;  3A6N D;  3AZH B;  4KHA A;  1F66 B;  3UTB D;  4CAY A;  1ID3 D;  4Z66 B;  4G91 B;  4G92 C;  2IO5 B;  5AV6 D;  3WA9 B;  1P3B C;  4YM6 D;  1P3F A;  2FJ7 D;  5F99 A;  5B2I B;  5B32 D;  4UUZ A;  1F1E A;  5B31 C;  3W97 C;  1TZY A;  4Z5T C;  3AYW A;  2NQB B;  4WV4 B;  3X1U D;  3LJA A;  2NZD D;  5GT0 D;  3MGS B;  5CP6 C;  5GSU A;  3VH5 A;  5DNN C;  5AVB A;  4QLC A;  4J8V A;  1KX4 B;  3REL C;  3LZ0 A;  5B1M B;  1P3M A;  1KX3 B;  4JJN A;  3AV2 A;  3X1S C;  4J8X B;  5FUG B;  5B24 D;  3MGR D;  1HQ3 A;  1F66 C;  3LEL A;  4HGA B;  4KHA B;  5B2J D;  5BO0 A;  5AV8 D;  4CAY B;  3NQJ A;  3UTA D;  1U35 D;  1EQZ D;  2IO5 C;  3MNN D;  3WA9 C;  4WU9 B;  3WAA C;  4X23 C;  3AZN D;  4DRA A;  3AZF C;  3KUY D;  1P3F B;  1AOI C;  3AFA D;  5GT3 C;  4UUZ B;  2PYO D;  4ZBJ B;  1TZY B;  3O62 C;  1M19 C;  4R8P D;  1KX5 A;  3X1V D;  5B1L A;  2RVQ D;  3REH A;  3AYW B;  3MGS C;  4J8W A;  5AV5 A;  4H9N A;  3LJA B;  1KX4 C;  5AV9 D;  5GSU B;  2CWE A;  5AVB B;  4WNN B;  4QLC B;  1B67 A;  2JSS A;  3LZ0 B;  1P3M B;  4J8X C;  3AZK C;  3MVD D;  4JJN B;  5KDM A;  3AV2 B;  4LD9 A;  1HQ3 B;  3KWQ D;  5B33 D;  3LEL B;  1P3O D;  3NQJ B;  5B31 A;  2HIO A;  5F99 C;  3KXB A;  5CP6 A;  4H9R A;  3UTB A;  1ID3 A;  5DNN A;  4ZBJ C;  1TZY C;  3R45 A;  3AZJ C;  5CPK D;  1P3P D;  5BT1 D;  1P3I C;  3VH5 T;  1KX5 B;  5AV6 A;  5B1L B;  3REH B;  5AVC D;  5C3I B;  2FJ7 A;  4J8W B;  5AV5 B;  5GSU C;  4H9N B;  5AVB C;  3C1B B;  3X1T D;  4J8V C;  4NE3 A;  3LZ0 C;  4XUJ C;  5B0Y C;  4KGC D;  1H3O B;  1P3M C;  3MGQ D;  3W99 A;  1JFI A;  5BNX A;  2BYM A;  4LD9 B;  5KDM B;  1HQ3 C;  3LEL C;  3AN2 A;  4G92 B;  4X23 A;  4Z2M G;  1P3B B;  2F8N D;  3AZF A;  1P3G D;  1AOI A;  5GT3 A;  5CHL B;  3W98 D;  5B31 B;  3O62 A;  1M19 A;  3MGR A;  5CPI A;  4H9S A;  2CV5 A;  2HIO B;  5B40 D;  4Z2M H;  3W96 D;  4YS3 A;  3KXB B;  5CP6 B;  4H9R B;  1ID3 B;  5DNN B;  1ULY A;  3TU4 D;  1U35 A;  1S32 A;  3R45 B;  3WKJ C;  1KX5 C;  3MNN A;  5B1L C;  3REK D;  3REH C;  1M1A D;  5C3I C;  5JRG D;  3AZK A;  5AV6 B;  5B0Z D;  4J8W C;  4J8U D;  3WTP C;  3MGP A;  2FJ7 B;  5GXQ D;  1Q9C A;  3C1C D;  3B6G D;  3W99 B;  5E5A D;  3REI D;  1M18 D;  5CPJ C;  4LD9 C;  1JFI B;  3KSY A;  2BYM B;  5BNX B;  3AN2 B;  3B0C T;  3LZ1 A;  3AZM D;  2ARO C;  4X23 B;  3WAA B;  4E45 A;  3AZF B;  1AOI B;  5GT3 B;  3W97 D;  1BH9 A;  3AZL A;  3AZJ A;  4Z5T D;  3O62 B;  4WU8 D;  1P3K D;  2HIO C;  1P3I A;  3MGR B;  3AZG D;  5CPI B;  1R4V A;  1M19 B;  2CV5 B;  3NQU A;  1B6W A;  3KXB C;  3UTB C;  4YS3 B;  1ID3 C;  4KUD D;  1P3O A;  5JA4 A;  3B6F A;  4XUJ A;  5B0Y A;  1U35 B;  1S32 B;  2BYK A;  5AV6 C;  1ZLA D;  4YM6 C;  5AY8 D;  3AZK B;  2FJ7 C;  3VH6 W;  1F66 D; 
#chains in the Genus database with same CATH topology
 3MGP B;  2YFW A;  4XZQ A;  3W99 C;  4Z66 D;  3X1U C;  3AN2 C;  2NZD C;  5GT0 C;  3AZI A;  3LZ1 B;  5B2I D;  3X1T A;  5F99 B;  3UT9 D;  4ZUX D;  1KU5 A;  4DRB A;  3EPH A;  5B24 C;  1BH9 B;  3AZL B;  2DF4 C;  3WKJ A;  5CPI C;  3B0D C;  3MGR C;  3AZJ B;  2NQB D;  4H9S C;  2CV5 C;  1P3I B;  5B2J C;  3AV1 A;  4YS3 C;  3WTP A;  3NQU B;  1KX4 D;  2F8N A;  1TAF A;  1P3G A;  1P3O B;  5B1M D;  4J8V B;  5BS7 C;  1U35 C;  1S32 C;  5JA4 B;  1KX3 D;  1EQZ C;  4XUJ B;  5B0Y B;  3B6F B;  3MNN C;  4J8X D;  2BYK B;  1WWI A;  5DNM D;  3AZN C;  5CPJ A;  3MGP C;  3KUY C;  5B40 A;  3AZE A;  2Y2M A;  2ARO A;  4M6B A;  4H9Q A;  3KFU G;  3REJ D;  3TU4 A;  5BO0 B;  3IP4 C;  4XZQ B;  1P3A D;  4R8P C;  3X1V C;  2RVQ C;  4WU9 D;  5B0Z A;  5BNV A;  3LZ1 C;  1P3F D;  2F2A C;  3A6N A;  3AZI B;  3AZH D;  4H9O A;  1TZY D;  3AZL C;  3MVD C;  2ZY3 A;  3REI A;  1M18 A;  3AYW D;  3WKJ B;  5B31 G;  3KWQ C;  5B33 C;  3AZM A;  3LJA D;  4YM6 A;  3AV1 B;  3WTP B;  5AVB D;  5B32 A;  1P3O C;  4QLC D;  2F8N B;  1P3G B;  3B6F C;  3LZ0 D;  1BFM A;  1P3M D;  4JJN D;  1HTA A;  3AV2 D;  1P34 D;  5CPJ B;  3X1U A;  3LEL D;  2NZD A;  3AZE B;  5GT0 A;  5B40 B;  2VQR A;  4KUD A;  2ARO B;  4H9Q B;  4XZQ C;  5CPK C;  1P3P C;  1BH8 A;  1PZR A;  5B24 A;  5B0Z B;  5BNV B;  3AZI C;  3X1T C;  3A6N B;  5B2J A;  4KGC C;  4H9O B;  5AV8 A;  3UTB B;  2HUE B;  5BS7 A;  3UTA A;  4EO5 C;  4AWL C;  3REI B;  1M18 B;  1EQZ A;  1P3L D;  5B1L D;  3REH D;  3AZN A;  5AV5 D;  3AZM B;  3AV1 C;  3C1B D;  4YM6 B;  3KUY A;  1P3G C;  3AFA A;  3UT9 A;  5B32 B;  4ZUX A;  2PYO A;  3W98 C;  3EPJ A;  2BG1 A;  4LD9 D;  4R8P A;  3X1V A;  3AZE C;  5B40 C;  3X1U B;  2ZM5 A;  2NZD B;  1P3B D;  5GT0 B;  5AV9 A;  2F8N K;  4KUD B;  3VH5 W;  3TU4 C;  5B31 D;  1M1A C;  5DNM A;  1BH8 B;  5B0Z C;  3MVD A;  4J8U C;  5B24 B;  4H9P A;  4CSR A;  3B0D B;  3A6N C;  4DQY B;  3KWQ A;  5B33 A;  5B2J B;  5CP6 D;  3KXB D;  2L5A A;  2HUE C;  3C1C C;  2Y2L A;  5DNN D;  3REJ A;  3B6G C;  5AV8 B;  3REL D;  1P3A A;  5E5A C;  3REI C;  1M18 C;  3UTA B;  4WU9 A;  1EQZ B;  3MNN B;  3X1S D;  3AZM C;  2Y2K A;  3AZN B;  5B32 C;  3KUY B;  3AFA B;  3UT9 B;  4ZUX B;  4NE5 A;  2PYO B;  5CPK A;  4UPK A;  3W99 D;  1P3P A;  4WU8 C;  1P3K C;  3AZG C;  2Y2P A;  1A7W A;  4R8P B;  3X1V B;  3AN2 D;  3WA9 D;  5AVC A;  3B0B A;  4X23 D;  3WAA D;  4KUD C;  4WNN A;  3AZF D;  5AV9 B;  1AOI D;  4KGC A;  1W2E A;  3MGQ A;  5GT3 D;  4E44 A;  1ZLA C;  3O62 D;  5DNM B;  5AY8 C;  2XD1 A;  3MVD B;  5CPI D;  1P34 A;  3AZH C;  1M19 D;  2CV5 D;  4H9P B;  4CSR B;  3MGS D;  3KWQ B;  5B33 B;  4YS3 D;  2ZY5 A;  5AV8 C;  4Z66 C;  3REJ B;  3UTA C;  4G91 C;  1S32 D;  3B0C W;  1P3A B;  3W98 A;  3AZK D;  3VH6 A;  5B2I C;  3MGP D;  3W96 A;  3AFA C;  3UT9 C;  2YFW B;  4ZUX C;  2PYO C;  2F8N G;  4NFT A;  5CPK B;  2NQB C;  3REK A;  1P3P B;  2Y2O A;  1P3L A;  1M1A A;  5JRG A;  3A1K A;  4J8U A;  3LZ1 D;  5AVC B;  3C1B A;  5AV9 C;  5GXQ A;  5F99 D;  1N1J A;  5B1M C;  3X1T B;  1H3O A;  1KX3 C;  4KGC B;  2F8N H;  3C1C A;  3B6G A;  3MGQ B;  5DNM C;  3AZL D;  2LY8 A;  5E5A A;  3AZJ D;  2YFV A;  1P3I D;  4EO5 B;  4AWL B;  1P34 B;  4HGA C;  1P3B A;  3H0M C;  5GSU D;  3REJ C;  2ZY2 A;  4J8V D;  1TAF B;  1P3A C;  3B6F D;  4XUJ D;  5B0Y D;  3W97 A;  4WU9 C;  3W98 B;  4Z5T A;  2FFF B;  4WU8 A;  5G49 A;  1P3K A;  1P3F C;  3AZG A;  1HQ3 D;  3V9R A;  3W96 B;  2G5H C;  3REL A;  4XZQ D;  5B32 G;  3TU4 B;  5BT1 C;  3AYW C;  2Y2N A;  1ZLA A;  3REK B;  3X1S A;  1P3L B;  1M1A B;  5AVC C;  5JRG B;  3LJA C;  5AY8 A;  4NE6 A;  4J8U B;  3AZI D;  3AZH A;  1F66 A;  4QLC C;  5GXQ B;  1N1J B;  3MGQ C;  3WTP E;  3C1C B;  4Z66 A;  4JJN C;  3AV2 C;  3B6G B;  3WKJ D;  5E5A B;  1P34 C;  1KX5 D;  2YFV B;  3WA9 A;  4WZS B;  4J8W D;  3AV1 D;  3WAA A;  2JE5 A;  5B2I A;  3WTP D;  3VH6 T;  3W97 B;  2NQB A;  4Z5T B;  5CPJ D;  2W8S A;  4WU8 B;  5G49 B;  1P3K B;  3AZE D;  3MGS A;  3AZG B;  3W96 C;  3V9R B;  1KX4 A;  2ARO D;  5B1M A;  3REL B;  1KX3 A;  2RIQ A;  3REK C;  1P3L C;  1WWS A;  4J8X A;  5FUG A;  5JRG C;  1ZLA B;  3X1S B;  5AV5 C;  3C1B C;  5AY8 B;  2HIO D;  5GXQ C;  3A6N D;  3AZH B;  4KHA A;  1F66 B;  3UTB D;  4CAY A;  1ID3 D;  2Y2G A;  4Z66 B;  4G91 B;  4G92 C;  2IO5 B;  5AV6 D;  3WA9 B;  1P3B C;  4YM6 D;  2Y2Q A;  3EPL A;  1P3F A;  2FJ7 D;  5F99 A;  5B2I B;  5B32 D;  4UUZ A;  1F1E A;  5B31 C;  3W97 C;  1TZY A;  4Z5T C;  3AYW A;  2NQB B;  4WV4 B;  3X1U D;  2JCH A;  3LJA A;  2NZD D;  5GT0 D;  3MGS B;  5CP6 C;  5GSU A;  3VH5 A;  5DNN C;  5AVB A;  4QLC A;  4J8V A;  1KX4 B;  3REL C;  2G5I C;  5B1M B;  3LZ0 A;  1P3M A;  1KX3 B;  4JJN A;  3AV2 A;  3X1S C;  4J8X B;  2Y2H A;  5FUG B;  5B24 D;  2Y2I A;  3MGR D;  1HQ3 A;  1F66 C;  3LEL A;  4HGA B;  4KHA B;  5B2J D;  5BO0 A;  5AV8 D;  2Y2J A;  4CAY B;  3NQJ A;  3UTA D;  1U35 D;  3H0L C;  1EQZ D;  2IO5 C;  3MNN D;  3WA9 C;  4WU9 B;  2J8P A;  3WAA C;  4X23 C;  3AZN D;  4DRA A;  3AZF C;  3KUY D;  1P3F B;  1AOI C;  3AFA D;  5GT3 C;  4UUZ B;  2PYO D;  4ZBJ B;  1TZY B;  3O62 C;  1M19 C;  4R8P D;  1KX5 A;  3X1V D;  5B1L A;  2RVQ D;  3REH A;  3AYW B;  3MGS C;  4J8W A;  5AV5 A;  4H9N A;  3LJA B;  1KX4 C;  5AV9 D;  5GSU B;  2CWE A;  5AVB B;  4WNN B;  4QLC B;  1B67 A;  2JSS A;  3LZ0 B;  1P3M B;  4J8X C;  3AZK C;  3MVD D;  4JJN B;  5KDM A;  3AV2 B;  4LD9 A;  1HQ3 B;  3KWQ D;  5B33 D;  3LEL B;  1P3O D;  3NQJ B;  5B31 A;  3FDD A;  2HIO A;  5F99 C;  3KXB A;  5CP6 A;  4H9R A;  3UTB A;  1ID3 A;  5DNN A;  4ZBJ C;  1TZY C;  3H0R C;  3EPK A;  3R45 A;  3AZJ C;  5CPK D;  1P3P D;  5BT1 D;  1P3I C;  3VH5 T;  2DQN C;  1KX5 B;  5AV6 A;  5B1L B;  3REH B;  5AVC D;  5C3I B;  2FJ7 A;  4J8W B;  5AV5 B;  5GSU C;  4H9N B;  5AVB C;  3C1B B;  3X1T D;  4J8V C;  4NE3 A;  3LZ0 C;  3P5J B;  4XUJ C;  5B0Y C;  1H3O B;  1P3M C;  3MGQ D;  4KGC D;  3W99 A;  1JFI A;  5BNX A;  2BYM A;  4LD9 B;  5KDM B;  1HQ3 C;  3LEL C;  3AN2 A;  4G92 B;  4X23 A;  3A1I A;  4Z2M G;  1P3B B;  2F8N D;  3AZF A;  1P3G D;  1AOI A;  2ZY4 A;  5GT3 A;  5CHL B;  3W98 D;  1T3U A;  5B31 B;  3O62 A;  1M19 A;  3MGR A;  5CPI A;  4H9S A;  2CV5 A;  2HIO B;  5B40 D;  4Z2M H;  3W96 D;  4YS3 A;  3KXB B;  5CP6 B;  4H9R B;  3AL0 C;  1ID3 B;  5DNN B;  1ULY A;  3TU4 D;  1U35 A;  1S32 A;  3R45 B;  3WKJ C;  2UWX A;  1KX5 C;  3MNN A;  5B1L C;  3REK D;  3EG5 B;  3REH C;  1M1A D;  5C3I C;  5JRG D;  3AZK A;  5AV6 B;  5B0Z D;  4J8W C;  4J8U D;  3WTP C;  3MGP A;  2FJ7 B;  5GXQ D;  1Q9C A;  3C1C D;  3B6G D;  3W99 B;  5E5A D;  3REI D;  1M18 D;  5CPJ C;  4LD9 C;  1JFI B;  3KSY A;  2BYM B;  5BNX B;  3AN2 B;  3B0C T;  3LZ1 A;  3AZM D;  2ARO C;  3F6T A;  4X23 B;  3WAA B;  4E45 A;  3AZF B;  1AOI B;  5GT3 B;  1Z2C B;  3W97 D;  1BH9 A;  3AZL A;  3AZJ A;  2XD5 A;  4Z5T D;  3O62 B;  4WU8 D;  1P3K D;  2HIO C;  1P3I A;  3MGR B;  3AZG D;  5CPI B;  1R4V A;  1M19 B;  2CV5 B;  4WJ3 C;  3NQU A;  1B6W A;  3KXB C;  3UTB C;  4YS3 B;  1ID3 C;  4KUD D;  1P3O A;  5JA4 A;  3B6F A;  4XUJ A;  5B0Y A;  1U35 B;  1S32 B;  2BYK A;  5AV6 C;  1ZLA D;  4YM6 C;  5AY8 D;  3AZK B;  2FJ7 C;  3VH6 W;  1F66 D; 
#chains in the Genus database with same CATH homology
 3MGP B;  2YFW A;  4XZQ A;  3W99 C;  4Z66 D;  3X1U C;  3AN2 C;  2NZD C;  5GT0 C;  3AZI A;  3LZ1 B;  5B2I D;  3X1T A;  5F99 B;  3UT9 D;  4ZUX D;  1KU5 A;  4DRB A;  3EPH A;  5B24 C;  1BH9 B;  3AZL B;  2DF4 C;  3WKJ A;  5CPI C;  3B0D C;  3MGR C;  3AZJ B;  2NQB D;  4H9S C;  2CV5 C;  1P3I B;  5B2J C;  3AV1 A;  4YS3 C;  3WTP A;  3NQU B;  1KX4 D;  2F8N A;  1TAF A;  1P3G A;  1P3O B;  5B1M D;  4J8V B;  5BS7 C;  1U35 C;  1S32 C;  5JA4 B;  1KX3 D;  1EQZ C;  4XUJ B;  5B0Y B;  3B6F B;  3MNN C;  4J8X D;  2BYK B;  1WWI A;  5DNM D;  3AZN C;  5CPJ A;  3MGP C;  3KUY C;  5B40 A;  3AZE A;  2Y2M A;  2ARO A;  4M6B A;  4H9Q A;  3KFU G;  3REJ D;  3TU4 A;  5BO0 B;  3IP4 C;  4XZQ B;  1P3A D;  4R8P C;  3X1V C;  2RVQ C;  4WU9 D;  5B0Z A;  5BNV A;  3LZ1 C;  1P3F D;  2F2A C;  3A6N A;  3AZI B;  3AZH D;  4H9O A;  1TZY D;  3AZL C;  3MVD C;  2ZY3 A;  3REI A;  1M18 A;  3AYW D;  3WKJ B;  5B31 G;  3KWQ C;  5B33 C;  3AZM A;  3LJA D;  4YM6 A;  3AV1 B;  3WTP B;  5AVB D;  5B32 A;  1P3O C;  4QLC D;  2F8N B;  1P3G B;  3B6F C;  3LZ0 D;  1BFM A;  1P3M D;  4JJN D;  1HTA A;  3AV2 D;  1P34 D;  5CPJ B;  3X1U A;  3LEL D;  2NZD A;  3AZE B;  5GT0 A;  5B40 B;  2VQR A;  4KUD A;  2ARO B;  4H9Q B;  4XZQ C;  5CPK C;  1P3P C;  1BH8 A;  1PZR A;  5B24 A;  5B0Z B;  5BNV B;  3AZI C;  3X1T C;  3A6N B;  5B2J A;  4KGC C;  4H9O B;  5AV8 A;  3UTB B;  2HUE B;  5BS7 A;  3UTA A;  4EO5 C;  4AWL C;  3REI B;  1M18 B;  1EQZ A;  1P3L D;  5B1L D;  3REH D;  3AZN A;  5AV5 D;  3AZM B;  3AV1 C;  3C1B D;  4YM6 B;  3KUY A;  1P3G C;  3AFA A;  3UT9 A;  5B32 B;  4ZUX A;  2PYO A;  3W98 C;  3EPJ A;  2BG1 A;  4LD9 D;  4R8P A;  3X1V A;  3AZE C;  5B40 C;  3X1U B;  2ZM5 A;  2NZD B;  1P3B D;  5GT0 B;  5AV9 A;  2F8N K;  4KUD B;  3VH5 W;  3TU4 C;  5B31 D;  1M1A C;  5DNM A;  1BH8 B;  5B0Z C;  3MVD A;  4J8U C;  5B24 B;  4H9P A;  4CSR A;  3B0D B;  3A6N C;  4DQY B;  3KWQ A;  5B33 A;  5B2J B;  5CP6 D;  3KXB D;  2L5A A;  2HUE C;  3C1C C;  2Y2L A;  5DNN D;  3REJ A;  3B6G C;  5AV8 B;  3REL D;  1P3A A;  5E5A C;  3REI C;  1M18 C;  3UTA B;  4WU9 A;  1EQZ B;  3MNN B;  3X1S D;  3AZM C;  2Y2K A;  3AZN B;  5B32 C;  3KUY B;  3AFA B;  3UT9 B;  4ZUX B;  4NE5 A;  2PYO B;  5CPK A;  4UPK A;  3W99 D;  1P3P A;  4WU8 C;  1P3K C;  3AZG C;  2Y2P A;  1A7W A;  4R8P B;  3X1V B;  3AN2 D;  3WA9 D;  5AVC A;  3B0B A;  4X23 D;  3WAA D;  4KUD C;  4WNN A;  3AZF D;  5AV9 B;  1AOI D;  4KGC A;  1W2E A;  3MGQ A;  5GT3 D;  4E44 A;  1ZLA C;  3O62 D;  5DNM B;  5AY8 C;  2XD1 A;  3MVD B;  5CPI D;  1P34 A;  3AZH C;  1M19 D;  2CV5 D;  4H9P B;  4CSR B;  3MGS D;  3KWQ B;  5B33 B;  4YS3 D;  2ZY5 A;  5AV8 C;  4Z66 C;  3REJ B;  3UTA C;  4G91 C;  1S32 D;  3B0C W;  1P3A B;  3W98 A;  3AZK D;  3VH6 A;  5B2I C;  3MGP D;  3W96 A;  3AFA C;  3UT9 C;  2YFW B;  4ZUX C;  2PYO C;  2F8N G;  4NFT A;  5CPK B;  2NQB C;  3REK A;  1P3P B;  2Y2O A;  1P3L A;  1M1A A;  5JRG A;  3A1K A;  4J8U A;  3LZ1 D;  5AVC B;  3C1B A;  5AV9 C;  5GXQ A;  5F99 D;  1N1J A;  5B1M C;  3X1T B;  1H3O A;  1KX3 C;  4KGC B;  2F8N H;  3C1C A;  3B6G A;  3MGQ B;  5DNM C;  3AZL D;  2LY8 A;  5E5A A;  3AZJ D;  2YFV A;  1P3I D;  4EO5 B;  4AWL B;  1P34 B;  4HGA C;  1P3B A;  3H0M C;  5GSU D;  3REJ C;  2ZY2 A;  4J8V D;  1TAF B;  1P3A C;  3B6F D;  4XUJ D;  5B0Y D;  3W97 A;  4WU9 C;  3W98 B;  4Z5T A;  2FFF B;  4WU8 A;  5G49 A;  1P3K A;  1P3F C;  3AZG A;  1HQ3 D;  3V9R A;  3W96 B;  2G5H C;  3REL A;  4XZQ D;  5B32 G;  3TU4 B;  5BT1 C;  3AYW C;  2Y2N A;  1ZLA A;  3REK B;  3X1S A;  1P3L B;  1M1A B;  5AVC C;  5JRG B;  3LJA C;  5AY8 A;  4NE6 A;  4J8U B;  3AZI D;  3AZH A;  1F66 A;  4QLC C;  5GXQ B;  1N1J B;  3MGQ C;  3WTP E;  3C1C B;  4Z66 A;  4JJN C;  3AV2 C;  3B6G B;  3WKJ D;  5E5A B;  1P34 C;  1KX5 D;  2YFV B;  3WA9 A;  4WZS B;  4J8W D;  3AV1 D;  3WAA A;  2JE5 A;  5B2I A;  3WTP D;  3VH6 T;  3W97 B;  2NQB A;  4Z5T B;  5CPJ D;  2W8S A;  4WU8 B;  5G49 B;  1P3K B;  3AZE D;  3MGS A;  3AZG B;  3W96 C;  3V9R B;  1KX4 A;  2ARO D;  5B1M A;  3REL B;  1KX3 A;  2RIQ A;  3REK C;  1P3L C;  1WWS A;  4J8X A;  5FUG A;  5JRG C;  1ZLA B;  3X1S B;  5AV5 C;  3C1B C;  5AY8 B;  2HIO D;  5GXQ C;  3A6N D;  3AZH B;  4KHA A;  1F66 B;  3UTB D;  4CAY A;  1ID3 D;  2Y2G A;  4Z66 B;  4G91 B;  4G92 C;  2IO5 B;  5AV6 D;  3WA9 B;  1P3B C;  4YM6 D;  2Y2Q A;  3EPL A;  1P3F A;  2FJ7 D;  5F99 A;  5B2I B;  5B32 D;  4UUZ A;  1F1E A;  5B31 C;  3W97 C;  1TZY A;  4Z5T C;  3AYW A;  2NQB B;  4WV4 B;  3X1U D;  2JCH A;  3LJA A;  2NZD D;  5GT0 D;  3MGS B;  5CP6 C;  5GSU A;  3VH5 A;  5DNN C;  5AVB A;  4QLC A;  4J8V A;  1KX4 B;  3REL C;  2G5I C;  5B1M B;  3LZ0 A;  1P3M A;  1KX3 B;  4JJN A;  3AV2 A;  3X1S C;  4J8X B;  2Y2H A;  5FUG B;  5B24 D;  2Y2I A;  3MGR D;  1HQ3 A;  1F66 C;  3LEL A;  4HGA B;  4KHA B;  5B2J D;  5BO0 A;  5AV8 D;  2Y2J A;  4CAY B;  3NQJ A;  3UTA D;  1U35 D;  3H0L C;  1EQZ D;  2IO5 C;  3MNN D;  3WA9 C;  4WU9 B;  2J8P A;  3WAA C;  4X23 C;  3AZN D;  4DRA A;  3AZF C;  3KUY D;  1P3F B;  1AOI C;  3AFA D;  5GT3 C;  4UUZ B;  2PYO D;  4ZBJ B;  1TZY B;  3O62 C;  1M19 C;  4R8P D;  1KX5 A;  3X1V D;  5B1L A;  2RVQ D;  3REH A;  3AYW B;  3MGS C;  4J8W A;  5AV5 A;  4H9N A;  3LJA B;  1KX4 C;  5AV9 D;  5GSU B;  2CWE A;  5AVB B;  4WNN B;  4QLC B;  1B67 A;  2JSS A;  3LZ0 B;  1P3M B;  4J8X C;  3AZK C;  3MVD D;  4JJN B;  5KDM A;  3AV2 B;  4LD9 A;  1HQ3 B;  3KWQ D;  5B33 D;  3LEL B;  1P3O D;  3NQJ B;  5B31 A;  3FDD A;  2HIO A;  5F99 C;  3KXB A;  5CP6 A;  4H9R A;  3UTB A;  1ID3 A;  5DNN A;  4ZBJ C;  1TZY C;  3H0R C;  3EPK A;  3R45 A;  3AZJ C;  5CPK D;  1P3P D;  5BT1 D;  1P3I C;  3VH5 T;  2DQN C;  1KX5 B;  5AV6 A;  5B1L B;  3REH B;  5AVC D;  5C3I B;  2FJ7 A;  4J8W B;  5AV5 B;  5GSU C;  4H9N B;  5AVB C;  3C1B B;  3X1T D;  4J8V C;  4NE3 A;  3LZ0 C;  3P5J B;  4XUJ C;  5B0Y C;  1H3O B;  1P3M C;  3MGQ D;  4KGC D;  3W99 A;  1JFI A;  5BNX A;  2BYM A;  4LD9 B;  5KDM B;  1HQ3 C;  3LEL C;  3AN2 A;  4G92 B;  4X23 A;  3A1I A;  4Z2M G;  1P3B B;  2F8N D;  3AZF A;  1P3G D;  1AOI A;  2ZY4 A;  5GT3 A;  5CHL B;  3W98 D;  1T3U A;  5B31 B;  3O62 A;  1M19 A;  3MGR A;  5CPI A;  4H9S A;  2CV5 A;  2HIO B;  5B40 D;  4Z2M H;  3W96 D;  4YS3 A;  3KXB B;  5CP6 B;  4H9R B;  3AL0 C;  1ID3 B;  5DNN B;  1ULY A;  3TU4 D;  1U35 A;  1S32 A;  3R45 B;  3WKJ C;  2UWX A;  1KX5 C;  3MNN A;  5B1L C;  3REK D;  3EG5 B;  3REH C;  1M1A D;  5C3I C;  5JRG D;  3AZK A;  5AV6 B;  5B0Z D;  4J8W C;  4J8U D;  3WTP C;  3MGP A;  2FJ7 B;  5GXQ D;  1Q9C A;  3C1C D;  3B6G D;  3W99 B;  5E5A D;  3REI D;  1M18 D;  5CPJ C;  4LD9 C;  1JFI B;  3KSY A;  2BYM B;  5BNX B;  3AN2 B;  3B0C T;  3LZ1 A;  3AZM D;  2ARO C;  3F6T A;  4X23 B;  3WAA B;  4E45 A;  3AZF B;  1AOI B;  5GT3 B;  1Z2C B;  3W97 D;  1BH9 A;  3AZL A;  3AZJ A;  2XD5 A;  4Z5T D;  3O62 B;  4WU8 D;  1P3K D;  2HIO C;  1P3I A;  3MGR B;  3AZG D;  5CPI B;  1R4V A;  1M19 B;  2CV5 B;  4WJ3 C;  3NQU A;  1B6W A;  3KXB C;  3UTB C;  4YS3 B;  1ID3 C;  4KUD D;  1P3O A;  5JA4 A;  3B6F A;  4XUJ A;  5B0Y A;  1U35 B;  1S32 B;  2BYK A;  5AV6 C;  1ZLA D;  4YM6 C;  5AY8 D;  3AZK B;  2FJ7 C;  3VH6 W;  1F66 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...