3AZLB

Crystal structure of human nucleosome core particle containing h4k77q mutation
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
78
structure length
78
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAQRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3azlB00
3B0DB 1KX5D 3B6GC 1P3FA 5B1LA 3UTAD 2AROC 2F8NA 1WWSA 3AZFD 4UUZB 3LELD 3UTBA 5B0YB 5BO0A 5B32B 3AZKA 3VH6W 5BNVA 5JA4A 2NQBD 5BS7C 3UTAA 1M18C 3AZFA 4KGCC 3KXBD 1P3LD 3X1VC 1H3OB 5AY8A 2NQBA 5GXQD 5B0YC 3MVDD 1F66D 1P3ID 5GSUA 1P34B 3RELA 5CPKD 3KXBA 1ID3C 3REHD 1P3LA 3WKJC 3MGSB 2BYMB 1Q9CA 3A6NB 1P3AD 4NE5A 1P3IA 5B0ZC 2F8NG 3NQJB 3B0BA 3AZMB 5B32A 4X23D 3AZHB 3AV2D 4QLCB 5B24D 2IO5B 1F1EA 5E5AC 3O62D 4X23A 5CPIB 1ZLAB 4CAYA 3KUYB 1TZYB 2CV5C 5B31C 4LD9B 3AV1B 1P34A 3O62A 2IO5C 3LJAB 4JJNB 5F99D 5CP6D 1S32B 2BYMA 5B1MC 3A6NA 4DRAA 5B2JB 4NFTA 5DNMC 5AVCB 3REKD 3UT9C 5B32G 4JJNC 4HGAC 3W99D 3REJB 3LZ0B 3AZGB 3AZHA 4QLCA 3KWQB 5AVBB 3MGRA 5CPJB 1A7WA 4ZBJC 3R45B 3X1UD 3B6FD 3AYWD 4WU9C 4NE6A 1AOIB 3WA9C 2HIOB 3MGPC 5GT0B 3W97B 3C1CB 5JRGD 4KHAA 3W99A 1M1AD 5AV9B 2CWEA 1TZYA 4Z5TC 1P3BD 4LD9A 3W98C 1HQ3B 5AVBC 5KDMB 3TU4C 3AFAD 3LJAA 1KX3B 4YS3A 5B40C 1S32A 2FJ7D 4G91C 1P3GB 1P3BA 1EQZC 3AZEB 3AFAA 1N1JB 4WV4B 5GT3B 3AZNC 4J8VC 1U35C 1HTAA 2LY8A 3MNNB 4H9PB 3REJA 4EO5B 3LZ0A 1KX4C 2NZDB 5CPJA 3AZJC 1P3PC 1P3KD 3R45A 2PYOB 3C1BC 3LZ1B 5GT0A 3W97A 5B33B 1P3OD 4KUDC 1BH8A 1ULYA 1P3FB 5AV9A 5DNNB 2HUEB 5B1LB 4WU8D 3AZIB 2F8NB 4Z2MG 5BT1D 4XZQC 5FUGB 4H9NB 4J8XD 4YM6D 1P3OA 3W96C 5JA4B 1KX5B 3UTAB 3AZFB 1P3FC 3AZEA 4J8XA 3AN2D 1TAFA 4J8UD 3UTBC 4J8WA 1P3MA 2NQBB 3AZKC 1BFMA 3MNNA 2NZDA 3X1SC 2BYKB 4ZUXA 5AV6A 3KXBB 1P3LB 5AV5C 3V9RA 3MVDB 5B33A 4Z66D 1F66B 1P3IB 3AZLD 5DNNA 5AY8C 4R8PC 3AZIA 3REIA 3MGQD 1BH9A 5CPKB 5GSUC 5AV8D 3RELC 5FUGA 4H9NA 1P3AB 5C3IC 4Z66A 1KX5A 3X1TD 3B0DC 3VH5A 5AV8A 3LELA 3WTPD 4XUJD 4X23B 4CAYB 3AV2B 2RVQC 3WAAD 5B32C 3X1TA 1M19D 5B2ID 3X1SD 3O62B 2BYKA 3WTPA 5GXQA 3MVDA 1M19A 1F66A 3B6GD 4H9SA 2AROD 4H9RA 5CPKA 1P34C 5F99B 3REHA 1JFIA 4AWLB 1P3AA 3MGRB 3B6GA 3MGSC 3A6NC 3REKB 1M18D 4KGCD 3W99B 4KHAB 3B0CW 3AV2A 3X1VD 5B24A 5B0YD 3AZMC 3AZHC 1KU5A 4QLCC 3B6FB 3AYWB 3MGRC 1R4VA 4YS3B 1WWIA 1ID3D 1M1AB 3WKJD 1P3BB 5CPIC 1ZLAC 3KUYC 5B0ZD 1TZYC 3AFAB 4LD9C 3AV1C 5F99A 5CP6A 3LJAC 4YS3C 2FJ7B 3WKJA 2F8NH 1S32C 5E5AD 3REKA 5B2JC 5BNXA 5AVCC 1BH8B 2YFVB 2CV5D 5B31D 3REJC 3X1UA 3LZ0C 3AZGC 3B6FA 3KWQC 3AYWA 5CPJC 1P3OB 5JRGA 1M1AA 1AOIC 2HIOC 5GT0C 5B1MD 4WU8B 3W97C 3C1CC 1ZLAD 5DNMD 5AV9C 4J8XB 1TAFB 5G49B 4YM6B 3UT9D 3AV1D 1HQ3C 4J8WB 1P3MB 4JJND 1KX3C 2FJ7A 3VH6T 4ZUXB 5AV6B 3AN2B 1P3GC 4WU9D 3WA9D 3V9RB 3MGPD 4J8UB 3AZEC 2YFVA 5GT3C 4CSRA 4J8WC 4Z5TD 3REIB 4WZSB 3MNNC 2NZDC 1BH9B 1P3KA 4EO5C 3W98D 5AVBD 4WU9A 3TU4D 3MGPA 2PYOC 4Z66B 3LZ1C 5B40D 4WU8A 5B33C 2YFWA 5AV8B 1EQZD 3W98A 5DNNC 3LELB 2HUEC 5B1LC 3AZIC 2JSSA 3AZND 5G49A 4YM6A 1HQ3D 4J8VD 5B40A 1U35D 3X1TB 1KX4D 3WTPE 3AZJD 3VH5W 1KX5C 1EQZA 4M6BA 1P3PD 3WTPB 4XUJB 3C1BD 3AN2A 3UTAC 3AZNA 3WAAB 3AZFC 3LELC 4J8UA 5GXQB 1U35A 1M19B 4KUDD 1KX4A 5B2IB 3B0CT 3AZJA 2NQBC 4H9RB 3REHB 4XZQD 1JFIB 3KXBC 4Z2MH 1P3LC 3B6GB 3W96D 3AZLA 5GXQC 3MVDC 2AROB 3MGQA 1F66C 1P3IC 1P3FD 4H9SC 4E44A 2F8ND 5CPKC 5B24B 3UTBD 3AZKD 4H9QA 1P3AC 1M18B 4H9OA 4KGCB 4XUJA 3X1VB 3WAAA 5AV5D 4X23C 3AV2C 3X1SA 5B2IA 5B24C 5AY8D 4R8PD 5GSUD 3O62C 3RELD 1ID3B 5CP6B 3WKJB 5AV5A 3NQUA 5B0ZB 4E45A 4R8PA 2AROA 5BNXB 4NE3A 2RVQD 4G92B 5F99C 5B32D 5CP6C 3VH6A 3X1UB 5E5AB 4AWLC 5BS7A 4DRBA 1M18A 4KGCA 3REHC 3REKC 5JRGB 3X1VA 4UUZA 2CV5B 5B31B 5B0YA 3W99C 4G92C 3X1UC 4WNNB 1P34D 3AYWC 1ID3A 3B6FC 1B6WA 1B67A 5B1MB 5JRGC 1M1AC 5DNMB 5B0ZA 3MGSD 1H3OA 3A6ND 1P3BC 3UT9B 4HGAB 3AFAC 4CSRB 3AZMD 4ZBJB 3MGSA 3AZHD 1P3KB 2FJ7C 5E5AA 4QLCD 3MGRD 4WU9B 3WA9B 3VH5T 3MGPB 3NQJA 4Z5TB 5B31A 3AZMA 2CV5A 5CPID 2YFWB 3KUYD 2F8NK 3W98B 1TZYD 3TU4B 4LD9D 1P3KC 4WNNA 5B40B 3LJAD 4YS3D 4G91B 5B1MA 1P3OC 5CPIA 1ZLAA 3KUYA 1EQZB 5DNMA 1S32D 4WU8C 5B2JD 3AZNB 5BT1C 3UT9A 5AVCD 3AV1A 4J8VB 4J8XC 4JJNA 1U35B 1KX4B 4YM6C 3KSYA 3AZJB 1P3MC 5CHLB 1P3PB 3REJD 3LZ0D 3AZGD 3C1BB 5CPJD 3KWQD 5B2JA 4ZUXC 3WA9A 5AVCA 5AV6C 3AN2C 4KUDB 3AZLB 1AOID 2HIOD 5B31G 4J8UC 5GT0D 3W97D 4Z5TA 3C1CD 3MGQB 3AZGA 5AV9D 3KWQA 4XZQB 5AVBA 3TU4A 3REIC 3W96B 1KX3D 1AOIA 2HIOA 4H9QB 4Z66C 3C1CA 3AZLC 4H9OB 1P3GD 3MGQC 5AV8C 3AZED 1HQ3A 5KDMA 5BO0B 4J8VA 3UTBB 3AZKB 1KX3A 5GT3D 3X1SB 5BNVB 4J8WD 1P3MD 3MNND 3X1TC 1P3PA 2NZDD 3C1BA 1P3GA 4ZUXD 5AV5B 5AV6D 3WTPC 4XUJC 2PYOD 3NQUB 3LZ1D 1N1JA 4KUDA 5GT3A 3WAAC 2L5AA 5AY8B 4R8PB 5B33D 1M19C 4H9PA 5GSUB 5B2IC 5DNND 3RELB 4XZQA 5B1LD 3AZID 3REID 5C3IB 2PYOA 3LZ1A 3W96A
chains in the Genus database with same CATH superfamily
3B0DB 1KX5D 3B6GC 1P3FA 5B1LA 3UTAD 2AROC 2F8NA 1WWSA 3AZFD 4UUZB 3LELD 3UTBA 5B0YB 5BO0A 5B32B 3AZKA 3VH6W 5BNVA 2Y2OA 5JA4A 2NQBD 5BS7C 3UTAA 1M18C 3AZFA 4KGCC 3KXBD 1P3LD 2UWXA 3X1VC 1H3OB 5AY8A 2NQBA 5GXQD 5B0YC 3MVDD 1F66D 1P3ID 5GSUA 1P34B 3RELA 5CPKD 3KXBA 1ID3C 3REHD 1P3LA 2Y2HA 3WKJC 3MGSB 2BYMB 1Q9CA 3A6NB 1P3AD 4NE5A 1P3IA 5B0ZC 2F8NG 3NQJB 3B0BA 3AZMB 5B32A 4X23D 3AZHB 3AV2D 4QLCB 5B24D 2IO5B 1F1EA 5E5AC 3O62D 2ZY3A 4X23A 5CPIB 1ZLAB 4CAYA 3KUYB 2Y2LA 1TZYB 2CV5C 5B31C 4LD9B 3AV1B 2JE5A 1P34A 3O62A 2IO5C 3LJAB 4JJNB 5F99D 5CP6D 1S32B 2BYMA 5B1MC 3A6NA 4DRAA 5B2JB 2ZM5A 4NFTA 5DNMC 5AVCB 3REKD 3UT9C 5B32G 4JJNC 4HGAC 3W99D 3REJB 3LZ0B 3AZGB 3AZHA 4QLCA 3KWQB 5AVBB 3MGRA 5CPJB 1A7WA 4ZBJC 3R45B 3X1UD 3B6FD 3AYWD 4WU9C 4NE6A 1AOIB 3WA9C 2HIOB 3MGPC 5GT0B 3W97B 3C1CB 5JRGD 4KHAA 3W99A 1M1AD 3H0LC 5AV9B 2CWEA 1TZYA 4Z5TC 1P3BD 4LD9A 3W98C 1HQ3B 5AVBC 5KDMB 3TU4C 3AFAD 3LJAA 1KX3B 4YS3A 2XD5A 5B40C 1S32A 2JCHA 4G91C 2FJ7D 1P3GB 1P3BA 1EQZC 3AZEB 3AFAA 1N1JB 4WV4B 5GT3B 3AZNC 2XD1A 4J8VC 1U35C 1HTAA 2LY8A 3MNNB 4H9PB 3REJA 4EO5B 3LZ0A 1KX4C 2NZDB 5CPJA 3AZJC 1P3PC 1P3KD 4UPKA 3R45A 2PYOB 3C1BC 3LZ1B 5GT0A 3W97A 5B33B 1P3OD 4KUDC 1BH8A 1ULYA 1P3FB 5AV9A 5DNNB 2HUEB 5B1LB 4DQYB 3AZIB 4WU8D 2F8NB 4Z2MG 5BT1D 4XZQC 5FUGB 4H9NB 4J8XD 4YM6D 1P3OA 3W96C 5JA4B 1KX5B 3UTAB 3AZFB 1P3FC 3EG5B 3AZEA 1Z2CB 4J8XA 3AN2D 1TAFA 4J8UD 3UTBC 4J8WA 1P3MA 2NQBB 3AZKC 1BFMA 3MNNA 2NZDA 3X1SC 2BYKB 4ZUXA 5AV6A 2G5IC 3KXBB 1P3LB 5AV5C 3V9RA 3MVDB 5B33A 4Z66D 1F66B 1P3IB 3AZLD 5DNNA 5AY8C 4R8PC 3AZIA 3REIA 3MGQD 1BH9A 5CPKB 5GSUC 5AV8D 3RELC 5FUGA 4H9NA 1P3AB 5C3IC 4Z66A 1KX5A 3X1TD 3B0DC 3VH5A 5AV8A 3LELA 3WTPD 4XUJD 4X23B 4CAYB 3AV2B 2RVQC 3WAAD 5B32C 3X1TA 1M19D 5B2ID 3X1SD 3O62B 2BYKA 1T3UA 3WTPA 2DF4C 2Y2GA 5GXQA 3MVDA 1M19A 1F66A 3B6GD 4H9SA 4WJ3C 2AROD 2W8SA 4H9RA 5CPKA 1P34C 5F99B 3REHA 1JFIA 4AWLB 1P3AA 3MGRB 3B6GA 3MGSC 3A6NC 3REKB 2BG1A 1M18D 4KGCD 3W99B 4KHAB 3B0CW 3AV2A 3X1VD 5B24A 5B0YD 3AZMC 3AZHC 1KU5A 4QLCC 3B6FB 3AYWB 3MGRC 1R4VA 4YS3B 1WWIA 1ID3D 1M1AB 3WKJD 1P3BB 5CPIC 1ZLAC 3KUYC 5B0ZD 1TZYC 3AFAB 4LD9C 3AV1C 5F99A 5CP6A 3LJAC 4YS3C 2FJ7B 3WKJA 2Y2JA 2F8NH 1S32C 5E5AD 3REKA 5B2JC 5BNXA 5AVCC 3A1IA 1BH8B 2YFVB 2CV5D 5B31D 2Y2MA 3AL0C 3REJC 3X1UA 3LZ0C 3AZGC 3B6FA 3KWQC 3AYWA 5CPJC 1P3OB 5JRGA 1M1AA 1AOIC 2HIOC 5GT0C 5B1MD 4WU8B 3W97C 3C1CC 2J8PA 1ZLAD 5DNMD 5AV9C 4J8XB 1TAFB 5G49B 4YM6B 3UT9D 3AV1D 1HQ3C 4J8WB 1P3MB 4JJND 2VQRA 1KX3C 2FJ7A 3VH6T 4ZUXB 5AV6B 3AN2B 1P3GC 2F2AC 4WU9D 3WA9D 3V9RB 3MGPD 4J8UB 3AZEC 2YFVA 5GT3C 4CSRA 4J8WC 4Z5TD 3REIB 4WZSB 3MNNC 2NZDC 1BH9B 1P3KA 4EO5C 3W98D 3H0RC 5AVBD 4WU9A 3TU4D 3MGPA 2PYOC 4Z66B 3LZ1C 1PZRA 5B40D 4WU8A 5B33C 2YFWA 5AV8B 1EQZD 3W98A 5DNNC 3LELB 2HUEC 5B1LC 3AZIC 2JSSA 3AZND 5G49A 4YM6A 1HQ3D 4J8VD 5B40A 1U35D 3X1TB 1KX4D 3P5JB 3WTPE 3AZJD 3VH5W 1KX5C 1EQZA 4M6BA 1P3PD 2ZY2A 3WTPB 3F6TA 4XUJB 3C1BD 3AN2A 3UTAC 3AZNA 3WAAB 3AZFC 3LELC 4J8UA 5GXQB 1U35A 1M19B 4KUDD 1KX4A 5B2IB 3B0CT 3AZJA 2NQBC 4H9RB 3REHB 2RIQA 4XZQD 1JFIB 3KXBC 4Z2MH 1P3LC 3B6GB 3W96D 3AZLA 5GXQC 3MVDC 2AROB 3MGQA 1F66C 1P3IC 1P3FD 4H9SC 4E44A 2F8ND 5CPKC 5B24B 2ZY5A 3UTBD 3AZKD 4H9QA 1P3AC 1M18B 4H9OA 4KGCB 4XUJA 1W2EA 3X1VB 3WAAA 3A1KA 5AV5D 4X23C 3AV2C 3X1SA 5B2IA 5B24C 5AY8D 4R8PD 2DQNC 5GSUD 3O62C 3RELD 1ID3B 5CP6B 3WKJB 5AV5A 3NQUA 5B0ZB 4E45A 4R8PA 2AROA 5BNXB 4NE3A 2RVQD 4G92B 5F99C 2FFFB 5B32D 5CP6C 3EPLA 3VH6A 3X1UB 5E5AB 4AWLC 5BS7A 4DRBA 1M18A 4KGCA 3REHC 3REKC 5JRGB 3EPJA 3X1VA 4UUZA 2CV5B 5B31B 5B0YA 3W99C 4G92C 2Y2IA 3X1UC 4WNNB 1P34D 3AYWC 1ID3A 3B6FC 3IP4C 1B6WA 2Y2KA 1B67A 5B1MB 2Y2QA 5JRGC 1M1AC 5DNMB 5B0ZA 3MGSD 1H3OA 3A6ND 1P3BC 3UT9B 4HGAB 3AFAC 4CSRB 3AZMD 2ZY4A 4ZBJB 3MGSA 3AZHD 1P3KB 2FJ7C 5E5AA 4QLCD 3MGRD 4WU9B 3WA9B 3VH5T 3MGPB 3NQJA 4Z5TB 5B31A 3AZMA 2CV5A 5CPID 2YFWB 3KUYD 2F8NK 3W98B 2G5HC 1TZYD 3TU4B 4LD9D 1P3KC 4WNNA 5B40B 3LJAD 4YS3D 4G91B 5B1MA 1P3OC 5CPIA 1ZLAA 3KUYA 1EQZB 5DNMA 1S32D 3KFUG 4WU8C 5B2JD 3AZNB 5BT1C 3UT9A 5AVCD 3AV1A 4J8VB 4J8XC 3EPKA 4JJNA 1U35B 1KX4B 4YM6C 3KSYA 3AZJB 1P3MC 5CHLB 1P3PB 3REJD 3LZ0D 3AZGD 3C1BB 5CPJD 3KWQD 5B2JA 4ZUXC 3WA9A 5AVCA 5AV6C 3AN2C 4KUDB 3AZLB 1AOID 2HIOD 5B31G 4J8UC 5GT0D 3W97D 4Z5TA 2Y2NA 3MGQB 3C1CD 3AZGA 5AV9D 3KWQA 4XZQB 5AVBA 3TU4A 3REIC 3W96B 1KX3D 1AOIA 2HIOA 4H9QB 4Z66C 3C1CA 3AZLC 2Y2PA 3FDDA 4H9OB 1P3GD 3MGQC 5AV8C 3AZED 1HQ3A 5KDMA 5BO0B 4J8VA 3UTBB 3AZKB 1KX3A 3EPHA 5GT3D 3X1SB 5BNVB 4J8WD 1P3MD 3MNND 3X1TC 1P3PA 2NZDD 3C1BA 1P3GA 4ZUXD 5AV5B 5AV6D 3H0MC 3WTPC 4XUJC 2PYOD 3NQUB 3LZ1D 1N1JA 4KUDA 5GT3A 3WAAC 2L5AA 5AY8B 4R8PB 5B33D 1M19C 4H9PA 5GSUB 5B2IC 5DNND 3RELB 4XZQA 5B1LD 3AZID 3REID 5C3IB 2PYOA 3LZ1A 3W96A
chains in the Genus database with same CATH topology
3B0DB 1KX5D 3B6GC 1P3FA 5B1LA 3UTAD 2AROC 2F8NA 1WWSA 3AZFD 4UUZB 3LELD 3UTBA 5B0YB 5BO0A 5B32B 3AZKA 3VH6W 5BNVA 2Y2OA 5JA4A 2NQBD 5BS7C 3UTAA 1M18C 3AZFA 4KGCC 3KXBD 1P3LD 2UWXA 3X1VC 1H3OB 5AY8A 2NQBA 5GXQD 5B0YC 3MVDD 1F66D 1P3ID 5GSUA 1P34B 3RELA 5CPKD 3KXBA 1ID3C 3REHD 1P3LA 2Y2HA 3WKJC 3MGSB 2BYMB 1Q9CA 3A6NB 1P3AD 4NE5A 1P3IA 5B0ZC 2F8NG 3NQJB 3B0BA 3AZMB 5B32A 4X23D 3AZHB 3AV2D 4QLCB 5B24D 2IO5B 1F1EA 5E5AC 3O62D 2ZY3A 4X23A 5CPIB 1ZLAB 4CAYA 3KUYB 2Y2LA 1TZYB 2CV5C 5B31C 4LD9B 3AV1B 2JE5A 1P34A 3O62A 2IO5C 3LJAB 4JJNB 5F99D 5CP6D 1S32B 2BYMA 5B1MC 3A6NA 4DRAA 5B2JB 2ZM5A 4NFTA 5DNMC 5AVCB 3REKD 3UT9C 5B32G 4JJNC 4HGAC 3W99D 3REJB 3LZ0B 3AZGB 3AZHA 4QLCA 3KWQB 5AVBB 3MGRA 5CPJB 1A7WA 4ZBJC 3R45B 3X1UD 3B6FD 3AYWD 4WU9C 4NE6A 1AOIB 3WA9C 2HIOB 3MGPC 5GT0B 3W97B 3C1CB 5JRGD 4KHAA 3W99A 1M1AD 3H0LC 5AV9B 2CWEA 1TZYA 4Z5TC 1P3BD 4LD9A 3W98C 1HQ3B 5AVBC 5KDMB 3TU4C 3AFAD 3LJAA 1KX3B 4YS3A 2XD5A 5B40C 1S32A 2JCHA 4G91C 2FJ7D 1P3GB 1P3BA 1EQZC 3AZEB 3AFAA 1N1JB 4WV4B 5GT3B 3AZNC 2XD1A 4J8VC 1U35C 1HTAA 2LY8A 3MNNB 4H9PB 3REJA 4EO5B 3LZ0A 1KX4C 2NZDB 5CPJA 3AZJC 1P3PC 1P3KD 4UPKA 3R45A 2PYOB 3C1BC 3LZ1B 5GT0A 3W97A 5B33B 1P3OD 4KUDC 1BH8A 1ULYA 1P3FB 5AV9A 5DNNB 2HUEB 5B1LB 4DQYB 3AZIB 4WU8D 2F8NB 4Z2MG 5BT1D 4XZQC 5FUGB 4H9NB 4J8XD 4YM6D 1P3OA 3W96C 5JA4B 1KX5B 3UTAB 3AZFB 1P3FC 3EG5B 3AZEA 1Z2CB 4J8XA 3AN2D 1TAFA 4J8UD 3UTBC 4J8WA 1P3MA 2NQBB 3AZKC 1BFMA 3MNNA 2NZDA 3X1SC 2BYKB 4ZUXA 5AV6A 2G5IC 3KXBB 1P3LB 5AV5C 3V9RA 3MVDB 5B33A 4Z66D 1F66B 1P3IB 3AZLD 5DNNA 5AY8C 4R8PC 3AZIA 3REIA 3MGQD 1BH9A 5CPKB 5GSUC 5AV8D 3RELC 5FUGA 4H9NA 1P3AB 5C3IC 4Z66A 1KX5A 3X1TD 3B0DC 3VH5A 5AV8A 3LELA 3WTPD 4XUJD 4X23B 4CAYB 3AV2B 2RVQC 3WAAD 5B32C 3X1TA 1M19D 5B2ID 3X1SD 3O62B 2BYKA 1T3UA 3WTPA 2DF4C 2Y2GA 5GXQA 3MVDA 1M19A 1F66A 3B6GD 4H9SA 4WJ3C 2AROD 2W8SA 4H9RA 5CPKA 1P34C 5F99B 3REHA 1JFIA 4AWLB 1P3AA 3MGRB 3B6GA 3MGSC 3A6NC 3REKB 2BG1A 1M18D 4KGCD 3W99B 4KHAB 3B0CW 3AV2A 3X1VD 5B24A 5B0YD 3AZMC 3AZHC 1KU5A 4QLCC 3B6FB 3AYWB 3MGRC 1R4VA 4YS3B 1WWIA 1ID3D 1M1AB 3WKJD 1P3BB 5CPIC 1ZLAC 3KUYC 5B0ZD 1TZYC 3AFAB 4LD9C 3AV1C 5F99A 5CP6A 3LJAC 4YS3C 2FJ7B 3WKJA 2Y2JA 2F8NH 1S32C 5E5AD 3REKA 5B2JC 5BNXA 5AVCC 3A1IA 1BH8B 2YFVB 2CV5D 5B31D 2Y2MA 3AL0C 3REJC 3X1UA 3LZ0C 3AZGC 3B6FA 3KWQC 3AYWA 5CPJC 1P3OB 5JRGA 1M1AA 1AOIC 2HIOC 5GT0C 5B1MD 4WU8B 3W97C 3C1CC 2J8PA 1ZLAD 5DNMD 5AV9C 4J8XB 1TAFB 5G49B 4YM6B 3UT9D 3AV1D 1HQ3C 4J8WB 1P3MB 4JJND 2VQRA 1KX3C 2FJ7A 3VH6T 4ZUXB 5AV6B 3AN2B 1P3GC 2F2AC 4WU9D 3WA9D 3V9RB 3MGPD 4J8UB 3AZEC 2YFVA 5GT3C 4CSRA 4J8WC 4Z5TD 3REIB 4WZSB 3MNNC 2NZDC 1BH9B 1P3KA 4EO5C 3W98D 3H0RC 5AVBD 4WU9A 3TU4D 3MGPA 2PYOC 4Z66B 3LZ1C 1PZRA 5B40D 4WU8A 5B33C 2YFWA 5AV8B 1EQZD 3W98A 5DNNC 3LELB 2HUEC 5B1LC 3AZIC 2JSSA 3AZND 5G49A 4YM6A 1HQ3D 4J8VD 5B40A 1U35D 3X1TB 1KX4D 3P5JB 3WTPE 3AZJD 3VH5W 1KX5C 1EQZA 4M6BA 1P3PD 2ZY2A 3WTPB 3F6TA 4XUJB 3C1BD 3AN2A 3UTAC 3AZNA 3WAAB 3AZFC 3LELC 4J8UA 5GXQB 1U35A 1M19B 4KUDD 1KX4A 5B2IB 3B0CT 3AZJA 2NQBC 4H9RB 3REHB 2RIQA 4XZQD 1JFIB 3KXBC 4Z2MH 1P3LC 3B6GB 3W96D 3AZLA 5GXQC 3MVDC 2AROB 3MGQA 1F66C 1P3IC 1P3FD 4H9SC 4E44A 2F8ND 5CPKC 5B24B 2ZY5A 3UTBD 3AZKD 4H9QA 1P3AC 1M18B 4H9OA 4KGCB 4XUJA 1W2EA 3X1VB 3WAAA 3A1KA 5AV5D 4X23C 3AV2C 3X1SA 5B2IA 5B24C 5AY8D 4R8PD 2DQNC 5GSUD 3O62C 3RELD 1ID3B 5CP6B 3WKJB 5AV5A 3NQUA 5B0ZB 4E45A 4R8PA 2AROA 5BNXB 4NE3A 2RVQD 4G92B 5F99C 2FFFB 5B32D 5CP6C 3EPLA 3VH6A 3X1UB 5E5AB 4AWLC 5BS7A 4DRBA 1M18A 4KGCA 3REHC 3REKC 5JRGB 3EPJA 3X1VA 4UUZA 2CV5B 5B31B 5B0YA 3W99C 4G92C 2Y2IA 3X1UC 4WNNB 1P34D 3AYWC 1ID3A 3B6FC 3IP4C 1B6WA 2Y2KA 1B67A 5B1MB 2Y2QA 5JRGC 1M1AC 5DNMB 5B0ZA 3MGSD 1H3OA 3A6ND 1P3BC 3UT9B 4HGAB 3AFAC 4CSRB 3AZMD 2ZY4A 4ZBJB 3MGSA 3AZHD 1P3KB 2FJ7C 5E5AA 4QLCD 3MGRD 4WU9B 3WA9B 3VH5T 3MGPB 3NQJA 4Z5TB 5B31A 3AZMA 2CV5A 5CPID 2YFWB 3KUYD 2F8NK 3W98B 2G5HC 1TZYD 3TU4B 4LD9D 1P3KC 4WNNA 5B40B 3LJAD 4YS3D 4G91B 5B1MA 1P3OC 5CPIA 1ZLAA 3KUYA 1EQZB 5DNMA 1S32D 3KFUG 4WU8C 5B2JD 3AZNB 5BT1C 3UT9A 5AVCD 3AV1A 4J8VB 4J8XC 3EPKA 4JJNA 1U35B 1KX4B 4YM6C 3KSYA 3AZJB 1P3MC 5CHLB 1P3PB 3REJD 3LZ0D 3AZGD 3C1BB 5CPJD 3KWQD 5B2JA 4ZUXC 3WA9A 5AVCA 5AV6C 3AN2C 4KUDB 3AZLB 1AOID 2HIOD 5B31G 4J8UC 5GT0D 3W97D 4Z5TA 2Y2NA 3MGQB 3C1CD 3AZGA 5AV9D 3KWQA 4XZQB 5AVBA 3TU4A 3REIC 3W96B 1KX3D 1AOIA 2HIOA 4H9QB 4Z66C 3C1CA 3AZLC 2Y2PA 3FDDA 4H9OB 1P3GD 3MGQC 5AV8C 3AZED 1HQ3A 5KDMA 5BO0B 4J8VA 3UTBB 3AZKB 1KX3A 3EPHA 5GT3D 3X1SB 5BNVB 4J8WD 1P3MD 3MNND 3X1TC 1P3PA 2NZDD 3C1BA 1P3GA 4ZUXD 5AV5B 5AV6D 3H0MC 3WTPC 4XUJC 2PYOD 3NQUB 3LZ1D 1N1JA 4KUDA 5GT3A 3WAAC 2L5AA 5AY8B 4R8PB 5B33D 1M19C 4H9PA 5GSUB 5B2IC 5DNND 3RELB 4XZQA 5B1LD 3AZID 3REID 5C3IB 2PYOA 3LZ1A 3W96A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B0D B;  1KX5 D;  3B6G C;  1P3F A;  5B1L A;  3UTA D;  2ARO C;  2F8N A;  1WWS A;  3AZF D;  4UUZ B;  3LEL D;  3UTB A;  5B0Y B;  5BO0 A;  5B32 B;  3AZK A;  3VH6 W;  5BNV A;  5JA4 A;  2NQB D;  5BS7 C;  3UTA A;  1M18 C;  3AZF A;  4KGC C;  3KXB D;  1P3L D;  3X1V C;  1H3O B;  5AY8 A;  2NQB A;  5GXQ D;  5B0Y C;  3MVD D;  1F66 D;  1P3I D;  5GSU A;  1P34 B;  3REL A;  5CPK D;  3KXB A;  1ID3 C;  3REH D;  1P3L A;  3WKJ C;  3MGS B;  2BYM B;  1Q9C A;  3A6N B;  1P3A D;  4NE5 A;  1P3I A;  5B0Z C;  2F8N G;  3NQJ B;  3B0B A;  3AZM B;  5B32 A;  4X23 D;  3AZH B;  3AV2 D;  4QLC B;  5B24 D;  2IO5 B;  1F1E A;  5E5A C;  3O62 D;  4X23 A;  5CPI B;  1ZLA B;  4CAY A;  3KUY B;  1TZY B;  2CV5 C;  5B31 C;  4LD9 B;  3AV1 B;  1P34 A;  3O62 A;  2IO5 C;  3LJA B;  4JJN B;  5F99 D;  5CP6 D;  1S32 B;  2BYM A;  5B1M C;  3A6N A;  4DRA A;  5B2J B;  4NFT A;  5DNM C;  5AVC B;  3REK D;  3UT9 C;  5B32 G;  4JJN C;  4HGA C;  3W99 D;  3REJ B;  3LZ0 B;  3AZG B;  3AZH A;  4QLC A;  3KWQ B;  5AVB B;  3MGR A;  5CPJ B;  1A7W A;  4ZBJ C;  3R45 B;  3X1U D;  3B6F D;  3AYW D;  4WU9 C;  4NE6 A;  1AOI B;  3WA9 C;  2HIO B;  3MGP C;  5GT0 B;  3W97 B;  3C1C B;  5JRG D;  4KHA A;  3W99 A;  1M1A D;  5AV9 B;  2CWE A;  1TZY A;  4Z5T C;  1P3B D;  4LD9 A;  3W98 C;  1HQ3 B;  5AVB C;  5KDM B;  3TU4 C;  3AFA D;  3LJA A;  1KX3 B;  4YS3 A;  5B40 C;  1S32 A;  2FJ7 D;  4G91 C;  1P3G B;  1P3B A;  1EQZ C;  3AZE B;  3AFA A;  1N1J B;  4WV4 B;  5GT3 B;  3AZN C;  4J8V C;  1U35 C;  1HTA A;  2LY8 A;  3MNN B;  4H9P B;  3REJ A;  4EO5 B;  3LZ0 A;  1KX4 C;  2NZD B;  5CPJ A;  3AZJ C;  1P3P C;  1P3K D;  3R45 A;  2PYO B;  3C1B C;  3LZ1 B;  5GT0 A;  3W97 A;  5B33 B;  1P3O D;  4KUD C;  1BH8 A;  1ULY A;  1P3F B;  5AV9 A;  5DNN B;  2HUE B;  5B1L B;  4WU8 D;  3AZI B;  2F8N B;  4Z2M G;  5BT1 D;  4XZQ C;  5FUG B;  4H9N B;  4J8X D;  4YM6 D;  1P3O A;  3W96 C;  5JA4 B;  1KX5 B;  3UTA B;  3AZF B;  1P3F C;  3AZE A;  4J8X A;  3AN2 D;  1TAF A;  4J8U D;  3UTB C;  4J8W A;  1P3M A;  2NQB B;  3AZK C;  1BFM A;  3MNN A;  2NZD A;  3X1S C;  2BYK B;  4ZUX A;  5AV6 A;  3KXB B;  1P3L B;  5AV5 C;  3V9R A;  3MVD B;  5B33 A;  4Z66 D;  1F66 B;  1P3I B;  3AZL D;  5DNN A;  5AY8 C;  4R8P C;  3AZI A;  3REI A;  3MGQ D;  1BH9 A;  5CPK B;  5GSU C;  5AV8 D;  3REL C;  5FUG A;  4H9N A;  1P3A B;  5C3I C;  4Z66 A;  1KX5 A;  3X1T D;  3B0D C;  3VH5 A;  5AV8 A;  3LEL A;  3WTP D;  4XUJ D;  4X23 B;  4CAY B;  3AV2 B;  2RVQ C;  3WAA D;  5B32 C;  3X1T A;  1M19 D;  5B2I D;  3X1S D;  3O62 B;  2BYK A;  3WTP A;  5GXQ A;  3MVD A;  1M19 A;  1F66 A;  3B6G D;  4H9S A;  2ARO D;  4H9R A;  5CPK A;  1P34 C;  5F99 B;  3REH A;  1JFI A;  4AWL B;  1P3A A;  3MGR B;  3B6G A;  3MGS C;  3A6N C;  3REK B;  1M18 D;  4KGC D;  3W99 B;  4KHA B;  3B0C W;  3AV2 A;  3X1V D;  5B24 A;  5B0Y D;  3AZM C;  3AZH C;  1KU5 A;  4QLC C;  3B6F B;  3AYW B;  3MGR C;  1R4V A;  4YS3 B;  1WWI A;  1ID3 D;  1M1A B;  3WKJ D;  1P3B B;  5CPI C;  1ZLA C;  3KUY C;  5B0Z D;  1TZY C;  3AFA B;  4LD9 C;  3AV1 C;  5F99 A;  5CP6 A;  3LJA C;  4YS3 C;  2FJ7 B;  3WKJ A;  2F8N H;  1S32 C;  5E5A D;  3REK A;  5B2J C;  5BNX A;  5AVC C;  1BH8 B;  2YFV B;  2CV5 D;  5B31 D;  3REJ C;  3X1U A;  3LZ0 C;  3AZG C;  3B6F A;  3KWQ C;  3AYW A;  5CPJ C;  1P3O B;  5JRG A;  1M1A A;  1AOI C;  2HIO C;  5GT0 C;  5B1M D;  4WU8 B;  3W97 C;  3C1C C;  1ZLA D;  5DNM D;  5AV9 C;  4J8X B;  1TAF B;  5G49 B;  4YM6 B;  3UT9 D;  3AV1 D;  1HQ3 C;  4J8W B;  1P3M B;  4JJN D;  1KX3 C;  2FJ7 A;  3VH6 T;  4ZUX B;  5AV6 B;  3AN2 B;  1P3G C;  4WU9 D;  3WA9 D;  3V9R B;  3MGP D;  4J8U B;  3AZE C;  2YFV A;  5GT3 C;  4CSR A;  4J8W C;  4Z5T D;  3REI B;  4WZS B;  3MNN C;  2NZD C;  1BH9 B;  1P3K A;  4EO5 C;  3W98 D;  5AVB D;  4WU9 A;  3TU4 D;  3MGP A;  2PYO C;  4Z66 B;  3LZ1 C;  5B40 D;  4WU8 A;  5B33 C;  2YFW A;  5AV8 B;  1EQZ D;  3W98 A;  5DNN C;  3LEL B;  2HUE C;  5B1L C;  3AZI C;  2JSS A;  3AZN D;  5G49 A;  4YM6 A;  1HQ3 D;  4J8V D;  5B40 A;  1U35 D;  3X1T B;  1KX4 D;  3WTP E;  3AZJ D;  3VH5 W;  1KX5 C;  1EQZ A;  4M6B A;  1P3P D;  3WTP B;  4XUJ B;  3C1B D;  3AN2 A;  3UTA C;  3AZN A;  3WAA B;  3AZF C;  3LEL C;  4J8U A;  5GXQ B;  1U35 A;  1M19 B;  4KUD D;  1KX4 A;  5B2I B;  3B0C T;  3AZJ A;  2NQB C;  4H9R B;  3REH B;  4XZQ D;  1JFI B;  3KXB C;  4Z2M H;  1P3L C;  3B6G B;  3W96 D;  3AZL A;  5GXQ C;  3MVD C;  2ARO B;  3MGQ A;  1F66 C;  1P3I C;  1P3F D;  4H9S C;  4E44 A;  2F8N D;  5CPK C;  5B24 B;  3UTB D;  3AZK D;  4H9Q A;  1P3A C;  1M18 B;  4H9O A;  4KGC B;  4XUJ A;  3X1V B;  3WAA A;  5AV5 D;  4X23 C;  3AV2 C;  3X1S A;  5B2I A;  5B24 C;  5AY8 D;  4R8P D;  5GSU D;  3O62 C;  3REL D;  1ID3 B;  5CP6 B;  3WKJ B;  5AV5 A;  3NQU A;  5B0Z B;  4E45 A;  4R8P A;  2ARO A;  5BNX B;  4NE3 A;  2RVQ D;  4G92 B;  5F99 C;  5B32 D;  5CP6 C;  3VH6 A;  3X1U B;  5E5A B;  4AWL C;  5BS7 A;  4DRB A;  1M18 A;  4KGC A;  3REH C;  3REK C;  5JRG B;  3X1V A;  4UUZ A;  2CV5 B;  5B31 B;  5B0Y A;  3W99 C;  4G92 C;  3X1U C;  4WNN B;  1P34 D;  3AYW C;  1ID3 A;  3B6F C;  1B6W A;  1B67 A;  5B1M B;  5JRG C;  1M1A C;  5DNM B;  5B0Z A;  3MGS D;  1H3O A;  3A6N D;  1P3B C;  3UT9 B;  4HGA B;  3AFA C;  4CSR B;  3AZM D;  4ZBJ B;  3MGS A;  3AZH D;  1P3K B;  2FJ7 C;  5E5A A;  4QLC D;  3MGR D;  4WU9 B;  3WA9 B;  3VH5 T;  3MGP B;  3NQJ A;  4Z5T B;  5B31 A;  3AZM A;  2CV5 A;  5CPI D;  2YFW B;  3KUY D;  2F8N K;  3W98 B;  1TZY D;  3TU4 B;  4LD9 D;  1P3K C;  4WNN A;  5B40 B;  3LJA D;  4YS3 D;  4G91 B;  5B1M A;  1P3O C;  5CPI A;  1ZLA A;  3KUY A;  1EQZ B;  5DNM A;  1S32 D;  4WU8 C;  5B2J D;  3AZN B;  5BT1 C;  3UT9 A;  5AVC D;  3AV1 A;  4J8V B;  4J8X C;  4JJN A;  1U35 B;  1KX4 B;  4YM6 C;  3KSY A;  3AZJ B;  1P3M C;  5CHL B;  1P3P B;  3REJ D;  3LZ0 D;  3AZG D;  3C1B B;  5CPJ D;  3KWQ D;  5B2J A;  4ZUX C;  3WA9 A;  5AVC A;  5AV6 C;  3AN2 C;  4KUD B;  3AZL B;  1AOI D;  2HIO D;  5B31 G;  4J8U C;  5GT0 D;  3W97 D;  4Z5T A;  3C1C D;  3MGQ B;  3AZG A;  5AV9 D;  3KWQ A;  4XZQ B;  5AVB A;  3TU4 A;  3REI C;  3W96 B;  1KX3 D;  1AOI A;  2HIO A;  4H9Q B;  4Z66 C;  3C1C A;  3AZL C;  4H9O B;  1P3G D;  3MGQ C;  5AV8 C;  3AZE D;  1HQ3 A;  5KDM A;  5BO0 B;  4J8V A;  3UTB B;  3AZK B;  1KX3 A;  5GT3 D;  3X1S B;  5BNV B;  4J8W D;  1P3M D;  3MNN D;  3X1T C;  1P3P A;  2NZD D;  3C1B A;  1P3G A;  4ZUX D;  5AV5 B;  5AV6 D;  3WTP C;  4XUJ C;  2PYO D;  3NQU B;  3LZ1 D;  1N1J A;  4KUD A;  5GT3 A;  3WAA C;  2L5A A;  5AY8 B;  4R8P B;  5B33 D;  1M19 C;  4H9P A;  5GSU B;  5B2I C;  5DNN D;  3REL B;  4XZQ A;  5B1L D;  3AZI D;  3REI D;  5C3I B;  2PYO A;  3LZ1 A;  3W96 A; 
#chains in the Genus database with same CATH topology
 3B0D B;  1KX5 D;  3B6G C;  1P3F A;  5B1L A;  3UTA D;  2ARO C;  2F8N A;  1WWS A;  3AZF D;  4UUZ B;  3LEL D;  3UTB A;  5B0Y B;  5BO0 A;  5B32 B;  3AZK A;  3VH6 W;  5BNV A;  2Y2O A;  5JA4 A;  2NQB D;  5BS7 C;  3UTA A;  1M18 C;  3AZF A;  4KGC C;  3KXB D;  1P3L D;  2UWX A;  3X1V C;  1H3O B;  5AY8 A;  2NQB A;  5GXQ D;  5B0Y C;  3MVD D;  1F66 D;  1P3I D;  5GSU A;  1P34 B;  3REL A;  5CPK D;  3KXB A;  1ID3 C;  3REH D;  1P3L A;  2Y2H A;  3WKJ C;  3MGS B;  2BYM B;  1Q9C A;  3A6N B;  1P3A D;  4NE5 A;  1P3I A;  5B0Z C;  2F8N G;  3NQJ B;  3B0B A;  3AZM B;  5B32 A;  4X23 D;  3AZH B;  3AV2 D;  4QLC B;  5B24 D;  2IO5 B;  1F1E A;  5E5A C;  3O62 D;  2ZY3 A;  4X23 A;  5CPI B;  1ZLA B;  4CAY A;  3KUY B;  2Y2L A;  1TZY B;  2CV5 C;  5B31 C;  4LD9 B;  3AV1 B;  2JE5 A;  1P34 A;  3O62 A;  2IO5 C;  3LJA B;  4JJN B;  5F99 D;  5CP6 D;  1S32 B;  2BYM A;  5B1M C;  3A6N A;  4DRA A;  5B2J B;  2ZM5 A;  4NFT A;  5DNM C;  5AVC B;  3REK D;  3UT9 C;  5B32 G;  4JJN C;  4HGA C;  3W99 D;  3REJ B;  3LZ0 B;  3AZG B;  3AZH A;  4QLC A;  3KWQ B;  5AVB B;  3MGR A;  5CPJ B;  1A7W A;  4ZBJ C;  3R45 B;  3X1U D;  3B6F D;  3AYW D;  4WU9 C;  4NE6 A;  1AOI B;  3WA9 C;  2HIO B;  3MGP C;  5GT0 B;  3W97 B;  3C1C B;  5JRG D;  4KHA A;  3W99 A;  1M1A D;  3H0L C;  5AV9 B;  2CWE A;  1TZY A;  4Z5T C;  1P3B D;  4LD9 A;  3W98 C;  1HQ3 B;  5AVB C;  5KDM B;  3TU4 C;  3AFA D;  3LJA A;  1KX3 B;  4YS3 A;  2XD5 A;  5B40 C;  1S32 A;  2JCH A;  4G91 C;  2FJ7 D;  1P3G B;  1P3B A;  1EQZ C;  3AZE B;  3AFA A;  1N1J B;  4WV4 B;  5GT3 B;  3AZN C;  2XD1 A;  4J8V C;  1U35 C;  1HTA A;  2LY8 A;  3MNN B;  4H9P B;  3REJ A;  4EO5 B;  3LZ0 A;  1KX4 C;  2NZD B;  5CPJ A;  3AZJ C;  1P3P C;  1P3K D;  4UPK A;  3R45 A;  2PYO B;  3C1B C;  3LZ1 B;  5GT0 A;  3W97 A;  5B33 B;  1P3O D;  4KUD C;  1BH8 A;  1ULY A;  1P3F B;  5AV9 A;  5DNN B;  2HUE B;  5B1L B;  4DQY B;  3AZI B;  4WU8 D;  2F8N B;  4Z2M G;  5BT1 D;  4XZQ C;  5FUG B;  4H9N B;  4J8X D;  4YM6 D;  1P3O A;  3W96 C;  5JA4 B;  1KX5 B;  3UTA B;  3AZF B;  1P3F C;  3EG5 B;  3AZE A;  1Z2C B;  4J8X A;  3AN2 D;  1TAF A;  4J8U D;  3UTB C;  4J8W A;  1P3M A;  2NQB B;  3AZK C;  1BFM A;  3MNN A;  2NZD A;  3X1S C;  2BYK B;  4ZUX A;  5AV6 A;  2G5I C;  3KXB B;  1P3L B;  5AV5 C;  3V9R A;  3MVD B;  5B33 A;  4Z66 D;  1F66 B;  1P3I B;  3AZL D;  5DNN A;  5AY8 C;  4R8P C;  3AZI A;  3REI A;  3MGQ D;  1BH9 A;  5CPK B;  5GSU C;  5AV8 D;  3REL C;  5FUG A;  4H9N A;  1P3A B;  5C3I C;  4Z66 A;  1KX5 A;  3X1T D;  3B0D C;  3VH5 A;  5AV8 A;  3LEL A;  3WTP D;  4XUJ D;  4X23 B;  4CAY B;  3AV2 B;  2RVQ C;  3WAA D;  5B32 C;  3X1T A;  1M19 D;  5B2I D;  3X1S D;  3O62 B;  2BYK A;  1T3U A;  3WTP A;  2DF4 C;  2Y2G A;  5GXQ A;  3MVD A;  1M19 A;  1F66 A;  3B6G D;  4H9S A;  4WJ3 C;  2ARO D;  2W8S A;  4H9R A;  5CPK A;  1P34 C;  5F99 B;  3REH A;  1JFI A;  4AWL B;  1P3A A;  3MGR B;  3B6G A;  3MGS C;  3A6N C;  3REK B;  2BG1 A;  1M18 D;  4KGC D;  3W99 B;  4KHA B;  3B0C W;  3AV2 A;  3X1V D;  5B24 A;  5B0Y D;  3AZM C;  3AZH C;  1KU5 A;  4QLC C;  3B6F B;  3AYW B;  3MGR C;  1R4V A;  4YS3 B;  1WWI A;  1ID3 D;  1M1A B;  3WKJ D;  1P3B B;  5CPI C;  1ZLA C;  3KUY C;  5B0Z D;  1TZY C;  3AFA B;  4LD9 C;  3AV1 C;  5F99 A;  5CP6 A;  3LJA C;  4YS3 C;  2FJ7 B;  3WKJ A;  2Y2J A;  2F8N H;  1S32 C;  5E5A D;  3REK A;  5B2J C;  5BNX A;  5AVC C;  3A1I A;  1BH8 B;  2YFV B;  2CV5 D;  5B31 D;  2Y2M A;  3AL0 C;  3REJ C;  3X1U A;  3LZ0 C;  3AZG C;  3B6F A;  3KWQ C;  3AYW A;  5CPJ C;  1P3O B;  5JRG A;  1M1A A;  1AOI C;  2HIO C;  5GT0 C;  5B1M D;  4WU8 B;  3W97 C;  3C1C C;  2J8P A;  1ZLA D;  5DNM D;  5AV9 C;  4J8X B;  1TAF B;  5G49 B;  4YM6 B;  3UT9 D;  3AV1 D;  1HQ3 C;  4J8W B;  1P3M B;  4JJN D;  2VQR A;  1KX3 C;  2FJ7 A;  3VH6 T;  4ZUX B;  5AV6 B;  3AN2 B;  1P3G C;  2F2A C;  4WU9 D;  3WA9 D;  3V9R B;  3MGP D;  4J8U B;  3AZE C;  2YFV A;  5GT3 C;  4CSR A;  4J8W C;  4Z5T D;  3REI B;  4WZS B;  3MNN C;  2NZD C;  1BH9 B;  1P3K A;  4EO5 C;  3W98 D;  3H0R C;  5AVB D;  4WU9 A;  3TU4 D;  3MGP A;  2PYO C;  4Z66 B;  3LZ1 C;  1PZR A;  5B40 D;  4WU8 A;  5B33 C;  2YFW A;  5AV8 B;  1EQZ D;  3W98 A;  5DNN C;  3LEL B;  2HUE C;  5B1L C;  3AZI C;  2JSS A;  3AZN D;  5G49 A;  4YM6 A;  1HQ3 D;  4J8V D;  5B40 A;  1U35 D;  3X1T B;  1KX4 D;  3P5J B;  3WTP E;  3AZJ D;  3VH5 W;  1KX5 C;  1EQZ A;  4M6B A;  1P3P D;  2ZY2 A;  3WTP B;  3F6T A;  4XUJ B;  3C1B D;  3AN2 A;  3UTA C;  3AZN A;  3WAA B;  3AZF C;  3LEL C;  4J8U A;  5GXQ B;  1U35 A;  1M19 B;  4KUD D;  1KX4 A;  5B2I B;  3B0C T;  3AZJ A;  2NQB C;  4H9R B;  3REH B;  2RIQ A;  4XZQ D;  1JFI B;  3KXB C;  4Z2M H;  1P3L C;  3B6G B;  3W96 D;  3AZL A;  5GXQ C;  3MVD C;  2ARO B;  3MGQ A;  1F66 C;  1P3I C;  1P3F D;  4H9S C;  4E44 A;  2F8N D;  5CPK C;  5B24 B;  2ZY5 A;  3UTB D;  3AZK D;  4H9Q A;  1P3A C;  1M18 B;  4H9O A;  4KGC B;  4XUJ A;  1W2E A;  3X1V B;  3WAA A;  3A1K A;  5AV5 D;  4X23 C;  3AV2 C;  3X1S A;  5B2I A;  5B24 C;  5AY8 D;  4R8P D;  2DQN C;  5GSU D;  3O62 C;  3REL D;  1ID3 B;  5CP6 B;  3WKJ B;  5AV5 A;  3NQU A;  5B0Z B;  4E45 A;  4R8P A;  2ARO A;  5BNX B;  4NE3 A;  2RVQ D;  4G92 B;  5F99 C;  2FFF B;  5B32 D;  5CP6 C;  3EPL A;  3VH6 A;  3X1U B;  5E5A B;  4AWL C;  5BS7 A;  4DRB A;  1M18 A;  4KGC A;  3REH C;  3REK C;  5JRG B;  3EPJ A;  3X1V A;  4UUZ A;  2CV5 B;  5B31 B;  5B0Y A;  3W99 C;  4G92 C;  2Y2I A;  3X1U C;  4WNN B;  1P34 D;  3AYW C;  1ID3 A;  3B6F C;  3IP4 C;  1B6W A;  2Y2K A;  1B67 A;  5B1M B;  2Y2Q A;  5JRG C;  1M1A C;  5DNM B;  5B0Z A;  3MGS D;  1H3O A;  3A6N D;  1P3B C;  3UT9 B;  4HGA B;  3AFA C;  4CSR B;  3AZM D;  2ZY4 A;  4ZBJ B;  3MGS A;  3AZH D;  1P3K B;  2FJ7 C;  5E5A A;  4QLC D;  3MGR D;  4WU9 B;  3WA9 B;  3VH5 T;  3MGP B;  3NQJ A;  4Z5T B;  5B31 A;  3AZM A;  2CV5 A;  5CPI D;  2YFW B;  3KUY D;  2F8N K;  3W98 B;  2G5H C;  1TZY D;  3TU4 B;  4LD9 D;  1P3K C;  4WNN A;  5B40 B;  3LJA D;  4YS3 D;  4G91 B;  5B1M A;  1P3O C;  5CPI A;  1ZLA A;  3KUY A;  1EQZ B;  5DNM A;  1S32 D;  3KFU G;  4WU8 C;  5B2J D;  3AZN B;  5BT1 C;  3UT9 A;  5AVC D;  3AV1 A;  4J8V B;  4J8X C;  3EPK A;  4JJN A;  1U35 B;  1KX4 B;  4YM6 C;  3KSY A;  3AZJ B;  1P3M C;  5CHL B;  1P3P B;  3REJ D;  3LZ0 D;  3AZG D;  3C1B B;  5CPJ D;  3KWQ D;  5B2J A;  4ZUX C;  3WA9 A;  5AVC A;  5AV6 C;  3AN2 C;  4KUD B;  3AZL B;  1AOI D;  2HIO D;  5B31 G;  4J8U C;  5GT0 D;  3W97 D;  4Z5T A;  2Y2N A;  3MGQ B;  3C1C D;  3AZG A;  5AV9 D;  3KWQ A;  4XZQ B;  5AVB A;  3TU4 A;  3REI C;  3W96 B;  1KX3 D;  1AOI A;  2HIO A;  4H9Q B;  4Z66 C;  3C1C A;  3AZL C;  2Y2P A;  3FDD A;  4H9O B;  1P3G D;  3MGQ C;  5AV8 C;  3AZE D;  1HQ3 A;  5KDM A;  5BO0 B;  4J8V A;  3UTB B;  3AZK B;  1KX3 A;  3EPH A;  5GT3 D;  3X1S B;  5BNV B;  4J8W D;  1P3M D;  3MNN D;  3X1T C;  1P3P A;  2NZD D;  3C1B A;  1P3G A;  4ZUX D;  5AV5 B;  5AV6 D;  3H0M C;  3WTP C;  4XUJ C;  2PYO D;  3NQU B;  3LZ1 D;  1N1J A;  4KUD A;  5GT3 A;  3WAA C;  2L5A A;  5AY8 B;  4R8P B;  5B33 D;  1M19 C;  4H9P A;  5GSU B;  5B2I C;  5DNN D;  3REL B;  4XZQ A;  5B1L D;  3AZI D;  3REI D;  5C3I B;  2PYO A;  3LZ1 A;  3W96 A; 
#chains in the Genus database with same CATH homology
 3B0D B;  1KX5 D;  3B6G C;  1P3F A;  5B1L A;  3UTA D;  2ARO C;  2F8N A;  1WWS A;  3AZF D;  4UUZ B;  3LEL D;  3UTB A;  5B0Y B;  5BO0 A;  5B32 B;  3AZK A;  3VH6 W;  5BNV A;  2Y2O A;  5JA4 A;  2NQB D;  5BS7 C;  3UTA A;  1M18 C;  3AZF A;  4KGC C;  3KXB D;  1P3L D;  2UWX A;  3X1V C;  1H3O B;  5AY8 A;  2NQB A;  5GXQ D;  5B0Y C;  3MVD D;  1F66 D;  1P3I D;  5GSU A;  1P34 B;  3REL A;  5CPK D;  3KXB A;  1ID3 C;  3REH D;  1P3L A;  2Y2H A;  3WKJ C;  3MGS B;  2BYM B;  1Q9C A;  3A6N B;  1P3A D;  4NE5 A;  1P3I A;  5B0Z C;  2F8N G;  3NQJ B;  3B0B A;  3AZM B;  5B32 A;  4X23 D;  3AZH B;  3AV2 D;  4QLC B;  5B24 D;  2IO5 B;  1F1E A;  5E5A C;  3O62 D;  2ZY3 A;  4X23 A;  5CPI B;  1ZLA B;  4CAY A;  3KUY B;  2Y2L A;  1TZY B;  2CV5 C;  5B31 C;  4LD9 B;  3AV1 B;  2JE5 A;  1P34 A;  3O62 A;  2IO5 C;  3LJA B;  4JJN B;  5F99 D;  5CP6 D;  1S32 B;  2BYM A;  5B1M C;  3A6N A;  4DRA A;  5B2J B;  2ZM5 A;  4NFT A;  5DNM C;  5AVC B;  3REK D;  3UT9 C;  5B32 G;  4JJN C;  4HGA C;  3W99 D;  3REJ B;  3LZ0 B;  3AZG B;  3AZH A;  4QLC A;  3KWQ B;  5AVB B;  3MGR A;  5CPJ B;  1A7W A;  4ZBJ C;  3R45 B;  3X1U D;  3B6F D;  3AYW D;  4WU9 C;  4NE6 A;  1AOI B;  3WA9 C;  2HIO B;  3MGP C;  5GT0 B;  3W97 B;  3C1C B;  5JRG D;  4KHA A;  3W99 A;  1M1A D;  3H0L C;  5AV9 B;  2CWE A;  1TZY A;  4Z5T C;  1P3B D;  4LD9 A;  3W98 C;  1HQ3 B;  5AVB C;  5KDM B;  3TU4 C;  3AFA D;  3LJA A;  1KX3 B;  4YS3 A;  2XD5 A;  5B40 C;  1S32 A;  2JCH A;  4G91 C;  2FJ7 D;  1P3G B;  1P3B A;  1EQZ C;  3AZE B;  3AFA A;  1N1J B;  4WV4 B;  5GT3 B;  3AZN C;  2XD1 A;  4J8V C;  1U35 C;  1HTA A;  2LY8 A;  3MNN B;  4H9P B;  3REJ A;  4EO5 B;  3LZ0 A;  1KX4 C;  2NZD B;  5CPJ A;  3AZJ C;  1P3P C;  1P3K D;  4UPK A;  3R45 A;  2PYO B;  3C1B C;  3LZ1 B;  5GT0 A;  3W97 A;  5B33 B;  1P3O D;  4KUD C;  1BH8 A;  1ULY A;  1P3F B;  5AV9 A;  5DNN B;  2HUE B;  5B1L B;  4DQY B;  3AZI B;  4WU8 D;  2F8N B;  4Z2M G;  5BT1 D;  4XZQ C;  5FUG B;  4H9N B;  4J8X D;  4YM6 D;  1P3O A;  3W96 C;  5JA4 B;  1KX5 B;  3UTA B;  3AZF B;  1P3F C;  3EG5 B;  3AZE A;  1Z2C B;  4J8X A;  3AN2 D;  1TAF A;  4J8U D;  3UTB C;  4J8W A;  1P3M A;  2NQB B;  3AZK C;  1BFM A;  3MNN A;  2NZD A;  3X1S C;  2BYK B;  4ZUX A;  5AV6 A;  2G5I C;  3KXB B;  1P3L B;  5AV5 C;  3V9R A;  3MVD B;  5B33 A;  4Z66 D;  1F66 B;  1P3I B;  3AZL D;  5DNN A;  5AY8 C;  4R8P C;  3AZI A;  3REI A;  3MGQ D;  1BH9 A;  5CPK B;  5GSU C;  5AV8 D;  3REL C;  5FUG A;  4H9N A;  1P3A B;  5C3I C;  4Z66 A;  1KX5 A;  3X1T D;  3B0D C;  3VH5 A;  5AV8 A;  3LEL A;  3WTP D;  4XUJ D;  4X23 B;  4CAY B;  3AV2 B;  2RVQ C;  3WAA D;  5B32 C;  3X1T A;  1M19 D;  5B2I D;  3X1S D;  3O62 B;  2BYK A;  1T3U A;  3WTP A;  2DF4 C;  2Y2G A;  5GXQ A;  3MVD A;  1M19 A;  1F66 A;  3B6G D;  4H9S A;  4WJ3 C;  2ARO D;  2W8S A;  4H9R A;  5CPK A;  1P34 C;  5F99 B;  3REH A;  1JFI A;  4AWL B;  1P3A A;  3MGR B;  3B6G A;  3MGS C;  3A6N C;  3REK B;  2BG1 A;  1M18 D;  4KGC D;  3W99 B;  4KHA B;  3B0C W;  3AV2 A;  3X1V D;  5B24 A;  5B0Y D;  3AZM C;  3AZH C;  1KU5 A;  4QLC C;  3B6F B;  3AYW B;  3MGR C;  1R4V A;  4YS3 B;  1WWI A;  1ID3 D;  1M1A B;  3WKJ D;  1P3B B;  5CPI C;  1ZLA C;  3KUY C;  5B0Z D;  1TZY C;  3AFA B;  4LD9 C;  3AV1 C;  5F99 A;  5CP6 A;  3LJA C;  4YS3 C;  2FJ7 B;  3WKJ A;  2Y2J A;  2F8N H;  1S32 C;  5E5A D;  3REK A;  5B2J C;  5BNX A;  5AVC C;  3A1I A;  1BH8 B;  2YFV B;  2CV5 D;  5B31 D;  2Y2M A;  3AL0 C;  3REJ C;  3X1U A;  3LZ0 C;  3AZG C;  3B6F A;  3KWQ C;  3AYW A;  5CPJ C;  1P3O B;  5JRG A;  1M1A A;  1AOI C;  2HIO C;  5GT0 C;  5B1M D;  4WU8 B;  3W97 C;  3C1C C;  2J8P A;  1ZLA D;  5DNM D;  5AV9 C;  4J8X B;  1TAF B;  5G49 B;  4YM6 B;  3UT9 D;  3AV1 D;  1HQ3 C;  4J8W B;  1P3M B;  4JJN D;  2VQR A;  1KX3 C;  2FJ7 A;  3VH6 T;  4ZUX B;  5AV6 B;  3AN2 B;  1P3G C;  2F2A C;  4WU9 D;  3WA9 D;  3V9R B;  3MGP D;  4J8U B;  3AZE C;  2YFV A;  5GT3 C;  4CSR A;  4J8W C;  4Z5T D;  3REI B;  4WZS B;  3MNN C;  2NZD C;  1BH9 B;  1P3K A;  4EO5 C;  3W98 D;  3H0R C;  5AVB D;  4WU9 A;  3TU4 D;  3MGP A;  2PYO C;  4Z66 B;  3LZ1 C;  1PZR A;  5B40 D;  4WU8 A;  5B33 C;  2YFW A;  5AV8 B;  1EQZ D;  3W98 A;  5DNN C;  3LEL B;  2HUE C;  5B1L C;  3AZI C;  2JSS A;  3AZN D;  5G49 A;  4YM6 A;  1HQ3 D;  4J8V D;  5B40 A;  1U35 D;  3X1T B;  1KX4 D;  3P5J B;  3WTP E;  3AZJ D;  3VH5 W;  1KX5 C;  1EQZ A;  4M6B A;  1P3P D;  2ZY2 A;  3WTP B;  3F6T A;  4XUJ B;  3C1B D;  3AN2 A;  3UTA C;  3AZN A;  3WAA B;  3AZF C;  3LEL C;  4J8U A;  5GXQ B;  1U35 A;  1M19 B;  4KUD D;  1KX4 A;  5B2I B;  3B0C T;  3AZJ A;  2NQB C;  4H9R B;  3REH B;  2RIQ A;  4XZQ D;  1JFI B;  3KXB C;  4Z2M H;  1P3L C;  3B6G B;  3W96 D;  3AZL A;  5GXQ C;  3MVD C;  2ARO B;  3MGQ A;  1F66 C;  1P3I C;  1P3F D;  4H9S C;  4E44 A;  2F8N D;  5CPK C;  5B24 B;  2ZY5 A;  3UTB D;  3AZK D;  4H9Q A;  1P3A C;  1M18 B;  4H9O A;  4KGC B;  4XUJ A;  1W2E A;  3X1V B;  3WAA A;  3A1K A;  5AV5 D;  4X23 C;  3AV2 C;  3X1S A;  5B2I A;  5B24 C;  5AY8 D;  4R8P D;  2DQN C;  5GSU D;  3O62 C;  3REL D;  1ID3 B;  5CP6 B;  3WKJ B;  5AV5 A;  3NQU A;  5B0Z B;  4E45 A;  4R8P A;  2ARO A;  5BNX B;  4NE3 A;  2RVQ D;  4G92 B;  5F99 C;  2FFF B;  5B32 D;  5CP6 C;  3EPL A;  3VH6 A;  3X1U B;  5E5A B;  4AWL C;  5BS7 A;  4DRB A;  1M18 A;  4KGC A;  3REH C;  3REK C;  5JRG B;  3EPJ A;  3X1V A;  4UUZ A;  2CV5 B;  5B31 B;  5B0Y A;  3W99 C;  4G92 C;  2Y2I A;  3X1U C;  4WNN B;  1P34 D;  3AYW C;  1ID3 A;  3B6F C;  3IP4 C;  1B6W A;  2Y2K A;  1B67 A;  5B1M B;  2Y2Q A;  5JRG C;  1M1A C;  5DNM B;  5B0Z A;  3MGS D;  1H3O A;  3A6N D;  1P3B C;  3UT9 B;  4HGA B;  3AFA C;  4CSR B;  3AZM D;  2ZY4 A;  4ZBJ B;  3MGS A;  3AZH D;  1P3K B;  2FJ7 C;  5E5A A;  4QLC D;  3MGR D;  4WU9 B;  3WA9 B;  3VH5 T;  3MGP B;  3NQJ A;  4Z5T B;  5B31 A;  3AZM A;  2CV5 A;  5CPI D;  2YFW B;  3KUY D;  2F8N K;  3W98 B;  2G5H C;  1TZY D;  3TU4 B;  4LD9 D;  1P3K C;  4WNN A;  5B40 B;  3LJA D;  4YS3 D;  4G91 B;  5B1M A;  1P3O C;  5CPI A;  1ZLA A;  3KUY A;  1EQZ B;  5DNM A;  1S32 D;  3KFU G;  4WU8 C;  5B2J D;  3AZN B;  5BT1 C;  3UT9 A;  5AVC D;  3AV1 A;  4J8V B;  4J8X C;  3EPK A;  4JJN A;  1U35 B;  1KX4 B;  4YM6 C;  3KSY A;  3AZJ B;  1P3M C;  5CHL B;  1P3P B;  3REJ D;  3LZ0 D;  3AZG D;  3C1B B;  5CPJ D;  3KWQ D;  5B2J A;  4ZUX C;  3WA9 A;  5AVC A;  5AV6 C;  3AN2 C;  4KUD B;  3AZL B;  1AOI D;  2HIO D;  5B31 G;  4J8U C;  5GT0 D;  3W97 D;  4Z5T A;  2Y2N A;  3MGQ B;  3C1C D;  3AZG A;  5AV9 D;  3KWQ A;  4XZQ B;  5AVB A;  3TU4 A;  3REI C;  3W96 B;  1KX3 D;  1AOI A;  2HIO A;  4H9Q B;  4Z66 C;  3C1C A;  3AZL C;  2Y2P A;  3FDD A;  4H9O B;  1P3G D;  3MGQ C;  5AV8 C;  3AZE D;  1HQ3 A;  5KDM A;  5BO0 B;  4J8V A;  3UTB B;  3AZK B;  1KX3 A;  3EPH A;  5GT3 D;  3X1S B;  5BNV B;  4J8W D;  1P3M D;  3MNN D;  3X1T C;  1P3P A;  2NZD D;  3C1B A;  1P3G A;  4ZUX D;  5AV5 B;  5AV6 D;  3H0M C;  3WTP C;  4XUJ C;  2PYO D;  3NQU B;  3LZ1 D;  1N1J A;  4KUD A;  5GT3 A;  3WAA C;  2L5A A;  5AY8 B;  4R8P B;  5B33 D;  1M19 C;  4H9P A;  5GSU B;  5B2I C;  5DNN D;  3REL B;  4XZQ A;  5B1L D;  3AZI D;  3REI D;  5C3I B;  2PYO A;  3LZ1 A;  3W96 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...