5B31C

The crystal structure of the heterotypic h2az/h2a nucleosome with h3.1.
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
107
structure length
107
Chain Sequence
KAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Histone H3.1
publication title Crystal structures of heterotypic nucleosomes containing histones H2A.Z and H2A.
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2016-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b31C00
1P3GA 4J8WD 5AV5A 5GT0C 3REID 2BYMB 1AOID 3AN2B 5B0YC 3RELD 5B31B 3LELA 1ZLAD 4Z5TB 3KWQC 5FUGB 1P3PC 2NQBB 3B0CW 3KUYB 4Z66A 3VH5T 3AZLC 3V9RB 4QLCB 1KX5A 3AZFC 3UTBC 3AZID 2AROC 4XZQA 5BO0B 5DNMD 3C1CC 4KUDA 5B32A 5CPKA 4XUJA 3X1TD 3LZ1C 1P3MA 3X1UD 4H9PA 5JA4B 1P3LC 1P3IB 5G49B 4WU8A 1P3KB 3REKD 3AZGD 5B0ZB 4LD9D 5B1LC 5B2IB 1TZYC 3C1BD 4JJNB 3AZNA 3AFAA 1M19B 3W97A 1M18D 5AV9A 4J8UA 1P3FB 4R8PB 3WTPA 5GSUC 5CPJD 4M6BA 5CPIC 4H9RA 5GT0B 1F66D 5AV6D 1WWSA 3A6ND 2L5AA 5DNNC 4KGCC 4E45A 3W96D 5B0YB 3O62A 1HQ3A 1M1AD 3B6GA 4KHAB 5B40C 3KWQB 1P3PB 1B6WA 1ID3D 4H9NA 4WZSB 4WNNB 3UT9D 4J8VC 3AZIA 1P34A 1KX4D 3AZFB 2NQBD 3MGQD 1F1EA 4X23D 3B6FD 3UTBB 5B33D 3LZ0D 2AROB 4AWLB 1P3OD 5BNXA 3X1UA 3AZMD 3C1CB 3MGRD 3WKJC 1HTAA 3WA9D 1P3BC 4G92C 3REHC 3LZ1B 5GXQD 4ZUXD 1P3LB 2YFWB 3MVDD 3UTAC 3AV1D 1BH8B 4H9SC 5B1LB 2PYOD 1TZYB 3TU4D 1KX3D 5CP6A 4YM6D 4YS3C 4WU9D 5B2JA 5GSUB 3KXBD 1WWIA 5CPIB 3MGSD 5JRGD 1P3FD 2IO5C 2BYMA 4CAYB 5DNNB 2FJ7C 4KGCB 3AN2A 1EQZC 5AV8C 1P3AC 3MNNA 1S32D 5B31A 5B40B 4NE6A 5B0YD 3R45B 3W99C 4Z5TA 5FUGA 1ULYA 3KUYA 3X1VC 5BS7A 4J8VB 1U35D 3MNND 3REJD 1P3GD 3V9RA 4QLCA 5AV5D 1HQ3B 4H9OB 5BO0A 4NE5A 3WKJB 1P3BB 4G92B 4CSRB 3REHB 3VH6W 3UTAB 5JA4A 1P3IA 5G49A 1P3KA 5B0ZA 2CV5C 5B2IA 1KU5A 4JJNA 1KX5D 1M19A 4YS3B 3X1SC 4R8PA 4XZQD 4KUDD 5B32D 5GT0A 2IO5B 4ZBJC 5CPKD 4XUJD 1P3MD 2FJ7B 1EQZB 4EO5B 3AZKC 4WU8D 5AV8B 5B0YA 2RVQD 3NQUB 4KHAA 5BT1D 3AZND 3W99B 3KWQA 1P3PA 3AFAD 2F8NB 3AZEC 3W97D 3X1VB 5AV9D 4J8UD 3AZLA 4WNNA 3WTPD 3AZFA 3UTBA 2AROA 3O62D 1HQ3D 3C1CA 1BH9B 3B6GD 3LZ1A 3LJAC 1P3LA 2YFWA 5AVBC 5B24C 3REHD 2CV5B 1BH8A 4HGAC 3AZJC 5F99C 5B1LA 1P34D 1TZYA 1Q9CA 3X1SB 5GSUA 5CPIA 4ZBJB 4CAYA 5DNNA 4KGCA 3AZKB 3W98C 5AY8C 5B40A 3WAAC 3R45A 3AYWC 3AZEB 5CP6D 3AZHC 5KDMB 3AV2C 2NZDC 4J8VA 3MGPC 5B2JD 5AVCC 3VH5W 3LELC 2F8ND 5GT3C 4J8XC 4H9OA 3AN2D 3WKJA 1P3BA 3REHA 4CSRA 5B31D 3LJAB 5AVBB 5B24B 3UTAA 3AZLB 4Z5TD 1JFIB 3KUYD 4HGAB 3AZJB 5F99B 4H9SA 2F8NK 4QLCD 5BNVB 4YS3A 1H3OB 1R4VA 5C3IC 4J8WC 5B32G 2FJ7A 3W98B 3REIC 1EQZA 1P3ID 1AOIC 5AY8B 3REJA 5AV8A 1P3KD 1N1JB 1P3AA 5B0ZD 3NQUA 5B2ID 3RELC 3WAAB 4JJND 3AYWB 3W99A 1M19D 3AZHB 2F8NA 4NE3A 1ZLAC 3AV2B 3X1VA 2NZDB 4R8PD 3MGPB 5AVCB 5GT3B 4J8XB 5GT0D 5B1MC 1BH9A 5DNMC 3X1TC 3KWQD 1P3PD 2CV5A 3REKC 3AZGC 3AZLD 4LD9C 3AZFD 3UTBD 3C1BC 3X1SA 2AROD 1M18C 3C1CD 5C3IB 4J8WB 5CPJC 3LZ1D 1P3LD 3REIB 1F66C 5AV6C 3AZKA 1AOIB 2YFVB 3A6NC 3W96C 5B1LD 1M1AC 3RELB 1TZYD 4UUZB 3AZEA 5KDMA 1ID3C 5GSUD 5CPID 3UT9C 1KX4C 2F8NG 5B1MB 1P3AB 2NQBC 1BFMA 3MGQC 4X23C 5DNND 3B6FC 4KGCD 5B33C 3LZ0C 2HIOC 1P3OC 5DNMB 5E5AC 3AZMC 3MGRC 3WA9C 3LJAA 5B40D 5AVBA 5B24A 5B31G 3X1TB 5GXQC 3B0CT 4ZUXC 3MVDC 3AV1C 1JFIA 3AZJA 5F99A 3REKB 3AZGB 4LD9B 4J8VD 2F8NH 2PYOC 5BNVA 3C1BB 4DRBA 3TU4C 1KX3C 3KSYA 1M18B 4YM6C 1H3OA 4WU9C 3WKJD 1P3BD 3KXBC 5CPJB 4DRAA 1F66B 3MGSC 5AV6B 5JRGC 3UTAD 1P3FC 3A6NB 3W98A 5AY8A 1N1JA 3W96B 1M1AB 3WAAA 1S32C 3AYWA 3AZHA 4YS3D 3AV2A 1ID3B 2NZDA 3NQJB 3MGPA 5AVCA 5GT3A 3UT9B 1U35C 1KX4B 3MNNC 4J8XA 3REJC 1P3GC 3MGQB 5AV5C 4X23B 2FJ7D 3B6FB 5B33B 1EQZD 3LZ0B 5AV8D 5B1MD 2HIOB 1P3AD 3B0DC 1P3OB 3AZMB 5E5AB 4E44A 3MGRB 3WA9B 5GXQB 1B67A 4AWLC 4ZUXB 3W99D 3MVDB 3AV1B 3X1VD 4Z66C 4H9QB 2PYOB 2BYKB 3TU4B 1KX3B 1KX5C 1A7WA 4YM6B 4WU9B 4XZQC 2HUEC 3KXBB 4J8WA 3MGSB 4KUDC 5B32C 5JRGB 3REIA 5CPKC 1TAFB 1AOIA 4XUJC 2YFVA 1P3MC 4G91C 4WU8C 2CV5D 2RVQC 3VH6A 3RELA 1S32B 4UUZA 5BT1C 1ZLAA 5CHLB 3AZNC 3X1SD 3AFAC 3W97C 5AV9C 4J8UC 1U35B 3MNNB 3WTPC 3REJB 1P3GB 5B1MA 5AV5B 3AZKD 2JSSA 2CWEA 3B0DB 3WTPE 5DNMA 3O62C 1HQ3C 3B6GC 3X1TA 2HIOD 3LELB 5E5AD 3AZED 3REKA 3AZGA 4LD9A 4Z66B 3AZIC 1P34C 3C1BA 1KX5B 1M18A 4XZQB 2HUEB 3X1UC 5CPJA 3VH6T 4KUDB 5B32B 3LJAD 1F66A 5CPKB 5AV6A 5AVBD 4XUJB 5B24D 3A6NA 1P3MB 4H9PB 4G91B 3W96A 4WU8B 3AZJD 4NFTA 5F99D 1M1AA 4EO5C 3AZNB 4Z2MG 3AFAB 1ID3A 3NQJA 5CP6C 3W97B 5AV9B 4J8UB 3WTPB 3UT9A 1KX4A 4WV4B 5B2JC 2NQBA 3MGQA 4H9RB 4X23A 3B6FA 2LY8A 3W98D 5B33A 3LZ0A 5AY8D 3AN2C 2HIOA 1P3OA 3AZMA 5E5AA 3O62B 3MGRA 1ZLAB 3WA9A 3B6GB 4Z2MH 3WAAD 5GXQA 5B31C 4ZUXA 3AYWD 3MVDA 3AZHD 3AV1A 3AV2D 4Z5TC 2NZDD 4H9NB 3B0BA 3MGPD 3KUYC 4H9QA 5AVCD 3LELD 5BS7C 5GT3D 3AZIB 2PYOA 1P34B 4J8XD 2BYKA 3TU4A 4QLCC 1KX3A 4Z66D 4YM6A 4WU9A 3VH5A 5BNXB 3X1UB 3KXBA 3MGSA 5JRGA 1P3FA 1TAFA 1P3IC 1P3KC 5B0ZC 1S32A 5B2IC 4JJNC 5CP6B 1M19C 4R8PC 1U35A 5B2JB
chains in the Genus database with same CATH superfamily
1P3GA 4J8WD 5AV5A 5GT0C 2RIQA 3REID 2BYMB 1AOID 3AN2B 5B0YC 3RELD 5B31B 3LELA 1ZLAD 4Z5TB 3KWQC 5FUGB 1P3PC 2NQBB 3B0CW 3KUYB 4Z66A 3VH5T 3AZLC 3V9RB 4QLCB 1KX5A 3AZFC 3UTBC 3AZID 2AROC 4XZQA 5BO0B 2BG1A 5DNMD 3C1CC 4KUDA 5B32A 5CPKA 4XUJA 3X1TD 3LZ1C 1P3MA 3X1UD 4H9PA 5JA4B 1P3LC 1P3IB 5G49B 4WU8A 1P3KB 3REKD 3AZGD 5B0ZB 4LD9D 3AL0C 5B1LC 5B2IB 1TZYC 3C1BD 4JJNB 3AZNA 3AFAA 1M19B 3W97A 1M18D 5AV9A 4J8UA 1P3FB 4R8PB 1Z2CB 3WTPA 5GSUC 5CPJD 4M6BA 5CPIC 4H9RA 5GT0B 1F66D 5AV6D 1WWSA 3A6ND 2L5AA 5DNNC 4KGCC 4E45A 3W96D 5B0YB 3O62A 1HQ3A 1M1AD 3B6GA 4KHAB 5B40C 3KWQB 1P3PB 1B6WA 1ID3D 4H9NA 4WZSB 4WNNB 3UT9D 4J8VC 3AZIA 1P34A 1KX4D 3AZFB 2NQBD 3MGQD 1F1EA 4X23D 3B6FD 3UTBB 3KFUG 5B33D 3LZ0D 2AROB 4AWLB 1P3OD 5BNXA 3X1UA 3AZMD 2F2AC 3MGRD 3C1CB 1HTAA 3WKJC 1P3BC 3WA9D 4G92C 3REHC 3LZ1B 5GXQD 4ZUXD 1P3LB 2YFWB 3MVDD 3UTAC 3AV1D 1BH8B 4H9SC 5B1LB 2PYOD 1TZYB 3TU4D 1KX3D 5CP6A 3EPJA 4YM6D 4YS3C 4WU9D 2XD1A 5B2JA 5GSUB 3KXBD 1WWIA 5CPIB 3MGSD 5JRGD 1P3FD 2IO5C 2BYMA 4CAYB 5DNNB 2FJ7C 4KGCB 3AN2A 1EQZC 2J8PA 2Y2NA 5AV8C 1P3AC 3MNNA 1S32D 5B31A 5B40B 4NE6A 5B0YD 3R45B 3W99C 4Z5TA 5FUGA 1ULYA 3KUYA 3X1VC 5BS7A 4J8VB 1U35D 3MNND 3REJD 1P3GD 3V9RA 4QLCA 5AV5D 1HQ3B 4H9OB 2Y2OA 5BO0A 4NE5A 3WKJB 1P3BB 4G92B 4CSRB 3REHB 3VH6W 3UTAB 5JA4A 1P3IA 5G49A 1P3KA 5B0ZA 2CV5C 5B2IA 1KU5A 4JJNA 1KX5D 1M19A 4YS3B 3X1SC 2XD5A 4R8PA 4XZQD 4KUDD 5B32D 5GT0A 2IO5B 4ZBJC 5CPKD 4XUJD 1P3MD 2FJ7B 1EQZB 4EO5B 3AZKC 4WU8D 5AV8B 5B0YA 2RVQD 2DF4C 3NQUB 4KHAA 5BT1D 3AZND 3W99B 3KWQA 1P3PA 3AFAD 2F8NB 3AZEC 3W97D 3X1VB 5AV9D 4J8UD 3AZLA 4WNNA 3WTPD 3AZFA 3UTBA 4DQYB 2AROA 3O62D 1HQ3D 3C1CA 1BH9B 3B6GD 3LZ1A 3LJAC 1P3LA 2YFWA 5AVBC 5B24C 3REHD 2CV5B 1BH8A 4HGAC 3AZJC 5F99C 5B1LA 1P34D 1TZYA 1Q9CA 3X1SB 2ZY4A 2G5HC 5GSUA 5CPIA 4ZBJB 4CAYA 5DNNA 4KGCA 2VQRA 3AZKB 3W98C 5AY8C 5B40A 3WAAC 3R45A 3AYWC 3AZEB 5CP6D 3AZHC 5KDMB 3AV2C 2NZDC 4J8VA 3MGPC 5B2JD 5AVCC 3VH5W 3LELC 2F8ND 5GT3C 4J8XC 4H9OA 3AN2D 3WKJA 1P3BA 3REHA 4CSRA 5B31D 3LJAB 5AVBB 5B24B 3UTAA 3AZLB 4Z5TD 3EPKA 1JFIB 3KUYD 4HGAB 3AZJB 5F99B 4H9SA 2F8NK 2G5IC 4QLCD 5BNVB 4YS3A 1H3OB 1R4VA 5C3IC 4J8WC 5B32G 2FJ7A 3W98B 3REIC 1EQZA 1P3ID 1AOIC 5AY8B 3REJA 5AV8A 1P3KD 1N1JB 1P3AA 3NQUA 5B0ZD 5B2ID 3RELC 3WAAB 4JJND 3AYWB 3W99A 1M19D 3AZHB 2F8NA 4NE3A 1ZLAC 3AV2B 3X1VA 2NZDB 4R8PD 3MGPB 5AVCB 5GT3B 4J8XB 5GT0D 2Y2PA 5B1MC 1BH9A 5DNMC 2ZY2A 3X1TC 3KWQD 1P3PD 2CV5A 3REKC 3AZGC 3AZLD 4LD9C 2Y2MA 3AZFD 3UTBD 2ZM5A 3C1BC 3X1SA 2AROD 1M18C 3C1CD 5C3IB 4J8WB 5CPJC 3LZ1D 3P5JB 1P3LD 3REIB 1F66C 5AV6C 3AZKA 2FFFB 2YFVB 3A6NC 1AOIB 3W96C 2Y2GA 5B1LD 1M1AC 3RELB 1TZYD 4UUZB 3AZEA 2Y2LA 5KDMA 1ID3C 5GSUD 5CPID 3UT9C 1KX4C 3F6TA 2F8NG 5B1MB 1P3AB 2NQBC 1BFMA 3MGQC 4X23C 5DNND 3B6FC 4KGCD 5B33C 3LZ0C 2HIOC 1P3OC 5DNMB 5E5AC 3AZMC 3MGRC 3WA9C 3LJAA 5B40D 5AVBA 5B24A 5B31G 3X1TB 5GXQC 3B0CT 4ZUXC 3MVDC 3AV1C 1JFIA 3AZJA 5F99A 3REKB 3AZGB 4LD9B 4J8VD 2F8NH 2PYOC 5BNVA 3C1BB 4DRBA 3TU4C 1KX3C 3KSYA 1M18B 4YM6C 1H3OA 4WU9C 3WKJD 1P3BD 3KXBC 5CPJB 4DRAA 1F66B 3MGSC 5AV6B 5JRGC 3EPLA 3UTAD 3A6NB 1P3FC 3W98A 5AY8A 1N1JA 3W96B 1M1AB 2W8SA 3WAAA 1S32C 3AYWA 3AZHA 4YS3D 3AV2A 1ID3B 2NZDA 3NQJB 3MGPA 5AVCA 5GT3A 3UT9B 1U35C 1KX4B 3MNNC 4J8XA 3REJC 1P3GC 3MGQB 5AV5C 4X23B 2FJ7D 3B6FB 5B33B 1EQZD 3LZ0B 5AV8D 3EG5B 2HIOB 5B1MD 3B0DC 1P3AD 3AZMB 5E5AB 1P3OB 4E44A 3MGRB 3WA9B 1PZRA 5GXQB 1B67A 4AWLC 4ZUXB 3W99D 3MVDB 1W2EA 3AV1B 3X1VD 4H9QB 4Z66C 3H0MC 2PYOB 4WJ3C 2BYKB 3TU4B 1KX3B 1KX5C 1A7WA 4YM6B 4WU9B 4XZQC 2Y2HA 2HUEC 3KXBB 4J8WA 2Y2QA 3MGSB 4KUDC 5B32C 5JRGB 3REIA 5CPKC 1TAFB 1AOIA 4XUJC 2YFVA 1P3MC 4G91C 4WU8C 2CV5D 2RVQC 3VH6A 3RELA 1S32B 4UUZA 5BT1C 1ZLAA 5CHLB 3AZNC 3X1SD 3AFAC 3IP4C 3W97C 5AV9C 4J8UC 1U35B 3MNNB 3WTPC 3REJB 1P3GB 5B1MA 5AV5B 3AZKD 2JSSA 2CWEA 3B0DB 3WTPE 5DNMA 3O62C 1HQ3C 2Y2JA 3B6GC 3X1TA 2HIOD 3LELB 3H0LC 5E5AD 3AZED 3REKA 3AZGA 4LD9A 4Z66B 3AZIC 1P34C 3C1BA 1KX5B 1M18A 4XZQB 2HUEB 2Y2IA 3X1UC 5CPJA 3VH6T 4KUDB 5B32B 3LJAD 1F66A 5CPKB 5AV6A 5AVBD 4XUJB 5B24D 3A6NA 1P3MB 4H9PB 2ZY5A 4G91B 3W96A 4WU8B 3AZJD 4NFTA 5F99D 4UPKA 1M1AA 2DQNC 4EO5C 3AZNB 4Z2MG 3AFAB 1ID3A 3NQJA 5CP6C 3W97B 3H0RC 5AV9B 4J8UB 3WTPB 3UT9A 1KX4A 4WV4B 5B2JC 2NQBA 3MGQA 4H9RB 4X23A 3B6FA 2LY8A 3W98D 5B33A 3LZ0A 5AY8D 2Y2KA 2HIOA 3AN2C 1P3OA 2JCHA 5E5AA 3O62B 3MGRA 3AZMA 1ZLAB 3WA9A 3A1KA 3B6GB 4Z2MH 2JE5A 5GXQA 3WAAD 5B31C 4ZUXA 3AYWD 3MVDA 2UWXA 3AZHD 3AV1A 3AV2D 4Z5TC 2NZDD 4H9NB 3B0BA 3MGPD 3KUYC 4H9QA 1T3UA 5AVCD 5BS7C 3LELD 5GT3D 3AZIB 2PYOA 1P34B 4J8XD 2BYKA 3TU4A 4QLCC 2ZY3A 3A1IA 1KX3A 4Z66D 4YM6A 3EPHA 4WU9A 3VH5A 5BNXB 3X1UB 3KXBA 3MGSA 5JRGA 1P3FA 1TAFA 1P3IC 1P3KC 5B0ZC 3FDDA 1S32A 5B2IC 4JJNC 5CP6B 1M19C 4R8PC 1U35A 5B2JB
chains in the Genus database with same CATH topology
1P3GA 4J8WD 5AV5A 5GT0C 2RIQA 3REID 2BYMB 1AOID 3AN2B 5B0YC 3RELD 5B31B 3LELA 1ZLAD 4Z5TB 3KWQC 5FUGB 1P3PC 2NQBB 3B0CW 3KUYB 4Z66A 3VH5T 3AZLC 3V9RB 4QLCB 1KX5A 3AZFC 3UTBC 3AZID 2AROC 4XZQA 5BO0B 2BG1A 5DNMD 3C1CC 4KUDA 5B32A 5CPKA 4XUJA 3X1TD 3LZ1C 1P3MA 3X1UD 4H9PA 5JA4B 1P3LC 1P3IB 5G49B 4WU8A 1P3KB 3REKD 3AZGD 5B0ZB 4LD9D 3AL0C 5B1LC 5B2IB 1TZYC 3C1BD 4JJNB 3AZNA 3AFAA 1M19B 3W97A 1M18D 5AV9A 4J8UA 1P3FB 4R8PB 1Z2CB 3WTPA 5GSUC 5CPJD 4M6BA 5CPIC 4H9RA 5GT0B 1F66D 5AV6D 1WWSA 3A6ND 2L5AA 5DNNC 4KGCC 4E45A 3W96D 5B0YB 3O62A 1HQ3A 1M1AD 3B6GA 4KHAB 5B40C 3KWQB 1P3PB 1B6WA 1ID3D 4H9NA 4WZSB 4WNNB 3UT9D 4J8VC 3AZIA 1P34A 1KX4D 3AZFB 2NQBD 3MGQD 1F1EA 4X23D 3B6FD 3UTBB 3KFUG 5B33D 3LZ0D 2AROB 4AWLB 1P3OD 5BNXA 3X1UA 3AZMD 2F2AC 3MGRD 3C1CB 1HTAA 3WKJC 1P3BC 3WA9D 4G92C 3REHC 3LZ1B 5GXQD 4ZUXD 1P3LB 2YFWB 3MVDD 3UTAC 3AV1D 1BH8B 4H9SC 5B1LB 2PYOD 1TZYB 3TU4D 1KX3D 5CP6A 3EPJA 4YM6D 4YS3C 4WU9D 2XD1A 5B2JA 5GSUB 3KXBD 1WWIA 5CPIB 3MGSD 5JRGD 1P3FD 2IO5C 2BYMA 4CAYB 5DNNB 2FJ7C 4KGCB 3AN2A 1EQZC 2J8PA 2Y2NA 5AV8C 1P3AC 3MNNA 1S32D 5B31A 5B40B 4NE6A 5B0YD 3R45B 3W99C 4Z5TA 5FUGA 1ULYA 3KUYA 3X1VC 5BS7A 4J8VB 1U35D 3MNND 3REJD 1P3GD 3V9RA 4QLCA 5AV5D 1HQ3B 4H9OB 2Y2OA 5BO0A 4NE5A 3WKJB 1P3BB 4G92B 4CSRB 3REHB 3VH6W 3UTAB 5JA4A 1P3IA 5G49A 1P3KA 5B0ZA 2CV5C 5B2IA 1KU5A 4JJNA 1KX5D 1M19A 4YS3B 3X1SC 2XD5A 4R8PA 4XZQD 4KUDD 5B32D 5GT0A 2IO5B 4ZBJC 5CPKD 4XUJD 1P3MD 2FJ7B 1EQZB 4EO5B 3AZKC 4WU8D 5AV8B 5B0YA 2RVQD 2DF4C 3NQUB 4KHAA 5BT1D 3AZND 3W99B 3KWQA 1P3PA 3AFAD 2F8NB 3AZEC 3W97D 3X1VB 5AV9D 4J8UD 3AZLA 4WNNA 3WTPD 3AZFA 3UTBA 4DQYB 2AROA 3O62D 1HQ3D 3C1CA 1BH9B 3B6GD 3LZ1A 3LJAC 1P3LA 2YFWA 5AVBC 5B24C 3REHD 2CV5B 1BH8A 4HGAC 3AZJC 5F99C 5B1LA 1P34D 1TZYA 1Q9CA 3X1SB 2ZY4A 2G5HC 5GSUA 5CPIA 4ZBJB 4CAYA 5DNNA 4KGCA 2VQRA 3AZKB 3W98C 5AY8C 5B40A 3WAAC 3R45A 3AYWC 3AZEB 5CP6D 3AZHC 5KDMB 3AV2C 2NZDC 4J8VA 3MGPC 5B2JD 5AVCC 3VH5W 3LELC 2F8ND 5GT3C 4J8XC 4H9OA 3AN2D 3WKJA 1P3BA 3REHA 4CSRA 5B31D 3LJAB 5AVBB 5B24B 3UTAA 3AZLB 4Z5TD 3EPKA 1JFIB 3KUYD 4HGAB 3AZJB 5F99B 4H9SA 2F8NK 2G5IC 4QLCD 5BNVB 4YS3A 1H3OB 1R4VA 5C3IC 4J8WC 5B32G 2FJ7A 3W98B 3REIC 1EQZA 1P3ID 1AOIC 5AY8B 3REJA 5AV8A 1P3KD 1N1JB 1P3AA 3NQUA 5B0ZD 5B2ID 3RELC 3WAAB 4JJND 3AYWB 3W99A 1M19D 3AZHB 2F8NA 4NE3A 1ZLAC 3AV2B 3X1VA 2NZDB 4R8PD 3MGPB 5AVCB 5GT3B 4J8XB 5GT0D 2Y2PA 5B1MC 1BH9A 5DNMC 2ZY2A 3X1TC 3KWQD 1P3PD 2CV5A 3REKC 3AZGC 3AZLD 4LD9C 2Y2MA 3AZFD 3UTBD 2ZM5A 3C1BC 3X1SA 2AROD 1M18C 3C1CD 5C3IB 4J8WB 5CPJC 3LZ1D 3P5JB 1P3LD 3REIB 1F66C 5AV6C 3AZKA 2FFFB 2YFVB 3A6NC 1AOIB 3W96C 2Y2GA 5B1LD 1M1AC 3RELB 1TZYD 4UUZB 3AZEA 2Y2LA 5KDMA 1ID3C 5GSUD 5CPID 3UT9C 1KX4C 3F6TA 2F8NG 5B1MB 1P3AB 2NQBC 1BFMA 3MGQC 4X23C 5DNND 3B6FC 4KGCD 5B33C 3LZ0C 2HIOC 1P3OC 5DNMB 5E5AC 3AZMC 3MGRC 3WA9C 3LJAA 5B40D 5AVBA 5B24A 5B31G 3X1TB 5GXQC 3B0CT 4ZUXC 3MVDC 3AV1C 1JFIA 3AZJA 5F99A 3REKB 3AZGB 4LD9B 4J8VD 2F8NH 2PYOC 5BNVA 3C1BB 4DRBA 3TU4C 1KX3C 3KSYA 1M18B 4YM6C 1H3OA 4WU9C 3WKJD 1P3BD 3KXBC 5CPJB 4DRAA 1F66B 3MGSC 5AV6B 5JRGC 3EPLA 3UTAD 3A6NB 1P3FC 3W98A 5AY8A 1N1JA 3W96B 1M1AB 2W8SA 3WAAA 1S32C 3AYWA 3AZHA 4YS3D 3AV2A 1ID3B 2NZDA 3NQJB 3MGPA 5AVCA 5GT3A 3UT9B 1U35C 1KX4B 3MNNC 4J8XA 3REJC 1P3GC 3MGQB 5AV5C 4X23B 2FJ7D 3B6FB 5B33B 1EQZD 3LZ0B 5AV8D 3EG5B 2HIOB 5B1MD 3B0DC 1P3AD 3AZMB 5E5AB 1P3OB 4E44A 3MGRB 3WA9B 1PZRA 5GXQB 1B67A 4AWLC 4ZUXB 3W99D 3MVDB 1W2EA 3AV1B 3X1VD 4H9QB 4Z66C 3H0MC 2PYOB 4WJ3C 2BYKB 3TU4B 1KX3B 1KX5C 1A7WA 4YM6B 4WU9B 4XZQC 2Y2HA 2HUEC 3KXBB 4J8WA 2Y2QA 3MGSB 4KUDC 5B32C 5JRGB 3REIA 5CPKC 1TAFB 1AOIA 4XUJC 2YFVA 1P3MC 4G91C 4WU8C 2CV5D 2RVQC 3VH6A 3RELA 1S32B 4UUZA 5BT1C 1ZLAA 5CHLB 3AZNC 3X1SD 3AFAC 3IP4C 3W97C 5AV9C 4J8UC 1U35B 3MNNB 3WTPC 3REJB 1P3GB 5B1MA 5AV5B 3AZKD 2JSSA 2CWEA 3B0DB 3WTPE 5DNMA 3O62C 1HQ3C 2Y2JA 3B6GC 3X1TA 2HIOD 3LELB 3H0LC 5E5AD 3AZED 3REKA 3AZGA 4LD9A 4Z66B 3AZIC 1P34C 3C1BA 1KX5B 1M18A 4XZQB 2HUEB 2Y2IA 3X1UC 5CPJA 3VH6T 4KUDB 5B32B 3LJAD 1F66A 5CPKB 5AV6A 5AVBD 4XUJB 5B24D 3A6NA 1P3MB 4H9PB 2ZY5A 4G91B 3W96A 4WU8B 3AZJD 4NFTA 5F99D 4UPKA 1M1AA 2DQNC 4EO5C 3AZNB 4Z2MG 3AFAB 1ID3A 3NQJA 5CP6C 3W97B 3H0RC 5AV9B 4J8UB 3WTPB 3UT9A 1KX4A 4WV4B 5B2JC 2NQBA 3MGQA 4H9RB 4X23A 3B6FA 2LY8A 3W98D 5B33A 3LZ0A 5AY8D 2Y2KA 2HIOA 3AN2C 1P3OA 2JCHA 5E5AA 3O62B 3MGRA 3AZMA 1ZLAB 3WA9A 3A1KA 3B6GB 4Z2MH 2JE5A 5GXQA 3WAAD 5B31C 4ZUXA 3AYWD 3MVDA 2UWXA 3AZHD 3AV1A 3AV2D 4Z5TC 2NZDD 4H9NB 3B0BA 3MGPD 3KUYC 4H9QA 1T3UA 5AVCD 5BS7C 3LELD 5GT3D 3AZIB 2PYOA 1P34B 4J8XD 2BYKA 3TU4A 4QLCC 2ZY3A 3A1IA 1KX3A 4Z66D 4YM6A 3EPHA 4WU9A 3VH5A 5BNXB 3X1UB 3KXBA 3MGSA 5JRGA 1P3FA 1TAFA 1P3IC 1P3KC 5B0ZC 3FDDA 1S32A 5B2IC 4JJNC 5CP6B 1M19C 4R8PC 1U35A 5B2JB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3G A;  4J8W D;  5AV5 A;  5GT0 C;  3REI D;  2BYM B;  1AOI D;  3AN2 B;  5B0Y C;  3REL D;  5B31 B;  3LEL A;  1ZLA D;  4Z5T B;  3KWQ C;  5FUG B;  1P3P C;  2NQB B;  3B0C W;  3KUY B;  4Z66 A;  3VH5 T;  3AZL C;  3V9R B;  4QLC B;  1KX5 A;  3AZF C;  3UTB C;  3AZI D;  2ARO C;  4XZQ A;  5BO0 B;  5DNM D;  3C1C C;  4KUD A;  5B32 A;  5CPK A;  4XUJ A;  3X1T D;  3LZ1 C;  1P3M A;  3X1U D;  4H9P A;  5JA4 B;  1P3L C;  1P3I B;  5G49 B;  4WU8 A;  1P3K B;  3REK D;  3AZG D;  5B0Z B;  4LD9 D;  5B1L C;  5B2I B;  1TZY C;  3C1B D;  4JJN B;  3AZN A;  3AFA A;  1M19 B;  3W97 A;  1M18 D;  5AV9 A;  4J8U A;  1P3F B;  4R8P B;  3WTP A;  5GSU C;  5CPJ D;  4M6B A;  5CPI C;  4H9R A;  5GT0 B;  1F66 D;  5AV6 D;  1WWS A;  3A6N D;  2L5A A;  5DNN C;  4KGC C;  4E45 A;  3W96 D;  5B0Y B;  3O62 A;  1HQ3 A;  1M1A D;  3B6G A;  4KHA B;  5B40 C;  3KWQ B;  1P3P B;  1B6W A;  1ID3 D;  4H9N A;  4WZS B;  4WNN B;  3UT9 D;  4J8V C;  3AZI A;  1P34 A;  1KX4 D;  3AZF B;  2NQB D;  3MGQ D;  1F1E A;  4X23 D;  3B6F D;  3UTB B;  5B33 D;  3LZ0 D;  2ARO B;  4AWL B;  1P3O D;  5BNX A;  3X1U A;  3AZM D;  3C1C B;  3MGR D;  3WKJ C;  1HTA A;  3WA9 D;  1P3B C;  4G92 C;  3REH C;  3LZ1 B;  5GXQ D;  4ZUX D;  1P3L B;  2YFW B;  3MVD D;  3UTA C;  3AV1 D;  1BH8 B;  4H9S C;  5B1L B;  2PYO D;  1TZY B;  3TU4 D;  1KX3 D;  5CP6 A;  4YM6 D;  4YS3 C;  4WU9 D;  5B2J A;  5GSU B;  3KXB D;  1WWI A;  5CPI B;  3MGS D;  5JRG D;  1P3F D;  2IO5 C;  2BYM A;  4CAY B;  5DNN B;  2FJ7 C;  4KGC B;  3AN2 A;  1EQZ C;  5AV8 C;  1P3A C;  3MNN A;  1S32 D;  5B31 A;  5B40 B;  4NE6 A;  5B0Y D;  3R45 B;  3W99 C;  4Z5T A;  5FUG A;  1ULY A;  3KUY A;  3X1V C;  5BS7 A;  4J8V B;  1U35 D;  3MNN D;  3REJ D;  1P3G D;  3V9R A;  4QLC A;  5AV5 D;  1HQ3 B;  4H9O B;  5BO0 A;  4NE5 A;  3WKJ B;  1P3B B;  4G92 B;  4CSR B;  3REH B;  3VH6 W;  3UTA B;  5JA4 A;  1P3I A;  5G49 A;  1P3K A;  5B0Z A;  2CV5 C;  5B2I A;  1KU5 A;  4JJN A;  1KX5 D;  1M19 A;  4YS3 B;  3X1S C;  4R8P A;  4XZQ D;  4KUD D;  5B32 D;  5GT0 A;  2IO5 B;  4ZBJ C;  5CPK D;  4XUJ D;  1P3M D;  2FJ7 B;  1EQZ B;  4EO5 B;  3AZK C;  4WU8 D;  5AV8 B;  5B0Y A;  2RVQ D;  3NQU B;  4KHA A;  5BT1 D;  3AZN D;  3W99 B;  3KWQ A;  1P3P A;  3AFA D;  2F8N B;  3AZE C;  3W97 D;  3X1V B;  5AV9 D;  4J8U D;  3AZL A;  4WNN A;  3WTP D;  3AZF A;  3UTB A;  2ARO A;  3O62 D;  1HQ3 D;  3C1C A;  1BH9 B;  3B6G D;  3LZ1 A;  3LJA C;  1P3L A;  2YFW A;  5AVB C;  5B24 C;  3REH D;  2CV5 B;  1BH8 A;  4HGA C;  3AZJ C;  5F99 C;  5B1L A;  1P34 D;  1TZY A;  1Q9C A;  3X1S B;  5GSU A;  5CPI A;  4ZBJ B;  4CAY A;  5DNN A;  4KGC A;  3AZK B;  3W98 C;  5AY8 C;  5B40 A;  3WAA C;  3R45 A;  3AYW C;  3AZE B;  5CP6 D;  3AZH C;  5KDM B;  3AV2 C;  2NZD C;  4J8V A;  3MGP C;  5B2J D;  5AVC C;  3VH5 W;  3LEL C;  2F8N D;  5GT3 C;  4J8X C;  4H9O A;  3AN2 D;  3WKJ A;  1P3B A;  3REH A;  4CSR A;  5B31 D;  3LJA B;  5AVB B;  5B24 B;  3UTA A;  3AZL B;  4Z5T D;  1JFI B;  3KUY D;  4HGA B;  3AZJ B;  5F99 B;  4H9S A;  2F8N K;  4QLC D;  5BNV B;  4YS3 A;  1H3O B;  1R4V A;  5C3I C;  4J8W C;  5B32 G;  2FJ7 A;  3W98 B;  3REI C;  1EQZ A;  1P3I D;  1AOI C;  5AY8 B;  3REJ A;  5AV8 A;  1P3K D;  1N1J B;  1P3A A;  5B0Z D;  3NQU A;  5B2I D;  3REL C;  3WAA B;  4JJN D;  3AYW B;  3W99 A;  1M19 D;  3AZH B;  2F8N A;  4NE3 A;  1ZLA C;  3AV2 B;  3X1V A;  2NZD B;  4R8P D;  3MGP B;  5AVC B;  5GT3 B;  4J8X B;  5GT0 D;  5B1M C;  1BH9 A;  5DNM C;  3X1T C;  3KWQ D;  1P3P D;  2CV5 A;  3REK C;  3AZG C;  3AZL D;  4LD9 C;  3AZF D;  3UTB D;  3C1B C;  3X1S A;  2ARO D;  1M18 C;  3C1C D;  5C3I B;  4J8W B;  5CPJ C;  3LZ1 D;  1P3L D;  3REI B;  1F66 C;  5AV6 C;  3AZK A;  1AOI B;  2YFV B;  3A6N C;  3W96 C;  5B1L D;  1M1A C;  3REL B;  1TZY D;  4UUZ B;  3AZE A;  5KDM A;  1ID3 C;  5GSU D;  5CPI D;  3UT9 C;  1KX4 C;  2F8N G;  5B1M B;  1P3A B;  2NQB C;  1BFM A;  3MGQ C;  4X23 C;  5DNN D;  3B6F C;  4KGC D;  5B33 C;  3LZ0 C;  2HIO C;  1P3O C;  5DNM B;  5E5A C;  3AZM C;  3MGR C;  3WA9 C;  3LJA A;  5B40 D;  5AVB A;  5B24 A;  5B31 G;  3X1T B;  5GXQ C;  3B0C T;  4ZUX C;  3MVD C;  3AV1 C;  1JFI A;  3AZJ A;  5F99 A;  3REK B;  3AZG B;  4LD9 B;  4J8V D;  2F8N H;  2PYO C;  5BNV A;  3C1B B;  4DRB A;  3TU4 C;  1KX3 C;  3KSY A;  1M18 B;  4YM6 C;  1H3O A;  4WU9 C;  3WKJ D;  1P3B D;  3KXB C;  5CPJ B;  4DRA A;  1F66 B;  3MGS C;  5AV6 B;  5JRG C;  3UTA D;  1P3F C;  3A6N B;  3W98 A;  5AY8 A;  1N1J A;  3W96 B;  1M1A B;  3WAA A;  1S32 C;  3AYW A;  3AZH A;  4YS3 D;  3AV2 A;  1ID3 B;  2NZD A;  3NQJ B;  3MGP A;  5AVC A;  5GT3 A;  3UT9 B;  1U35 C;  1KX4 B;  3MNN C;  4J8X A;  3REJ C;  1P3G C;  3MGQ B;  5AV5 C;  4X23 B;  2FJ7 D;  3B6F B;  5B33 B;  1EQZ D;  3LZ0 B;  5AV8 D;  5B1M D;  2HIO B;  1P3A D;  3B0D C;  1P3O B;  3AZM B;  5E5A B;  4E44 A;  3MGR B;  3WA9 B;  5GXQ B;  1B67 A;  4AWL C;  4ZUX B;  3W99 D;  3MVD B;  3AV1 B;  3X1V D;  4Z66 C;  4H9Q B;  2PYO B;  2BYK B;  3TU4 B;  1KX3 B;  1KX5 C;  1A7W A;  4YM6 B;  4WU9 B;  4XZQ C;  2HUE C;  3KXB B;  4J8W A;  3MGS B;  4KUD C;  5B32 C;  5JRG B;  3REI A;  5CPK C;  1TAF B;  1AOI A;  4XUJ C;  2YFV A;  1P3M C;  4G91 C;  4WU8 C;  2CV5 D;  2RVQ C;  3VH6 A;  3REL A;  1S32 B;  4UUZ A;  5BT1 C;  1ZLA A;  5CHL B;  3AZN C;  3X1S D;  3AFA C;  3W97 C;  5AV9 C;  4J8U C;  1U35 B;  3MNN B;  3WTP C;  3REJ B;  1P3G B;  5B1M A;  5AV5 B;  3AZK D;  2JSS A;  2CWE A;  3B0D B;  3WTP E;  5DNM A;  3O62 C;  1HQ3 C;  3B6G C;  3X1T A;  2HIO D;  3LEL B;  5E5A D;  3AZE D;  3REK A;  3AZG A;  4LD9 A;  4Z66 B;  3AZI C;  1P34 C;  3C1B A;  1KX5 B;  1M18 A;  4XZQ B;  2HUE B;  3X1U C;  5CPJ A;  3VH6 T;  4KUD B;  5B32 B;  3LJA D;  1F66 A;  5CPK B;  5AV6 A;  5AVB D;  4XUJ B;  5B24 D;  3A6N A;  1P3M B;  4H9P B;  4G91 B;  3W96 A;  4WU8 B;  3AZJ D;  4NFT A;  5F99 D;  1M1A A;  4EO5 C;  3AZN B;  4Z2M G;  3AFA B;  1ID3 A;  3NQJ A;  5CP6 C;  3W97 B;  5AV9 B;  4J8U B;  3WTP B;  3UT9 A;  1KX4 A;  4WV4 B;  5B2J C;  2NQB A;  3MGQ A;  4H9R B;  4X23 A;  3B6F A;  2LY8 A;  3W98 D;  5B33 A;  3LZ0 A;  5AY8 D;  3AN2 C;  2HIO A;  1P3O A;  3AZM A;  5E5A A;  3O62 B;  3MGR A;  1ZLA B;  3WA9 A;  3B6G B;  4Z2M H;  3WAA D;  5GXQ A;  5B31 C;  4ZUX A;  3AYW D;  3MVD A;  3AZH D;  3AV1 A;  3AV2 D;  4Z5T C;  2NZD D;  4H9N B;  3B0B A;  3MGP D;  3KUY C;  4H9Q A;  5AVC D;  3LEL D;  5BS7 C;  5GT3 D;  3AZI B;  2PYO A;  1P34 B;  4J8X D;  2BYK A;  3TU4 A;  4QLC C;  1KX3 A;  4Z66 D;  4YM6 A;  4WU9 A;  3VH5 A;  5BNX B;  3X1U B;  3KXB A;  3MGS A;  5JRG A;  1P3F A;  1TAF A;  1P3I C;  1P3K C;  5B0Z C;  1S32 A;  5B2I C;  4JJN C;  5CP6 B;  1M19 C;  4R8P C;  1U35 A;  5B2J B; 
#chains in the Genus database with same CATH topology
 1P3G A;  4J8W D;  5AV5 A;  5GT0 C;  2RIQ A;  3REI D;  2BYM B;  1AOI D;  3AN2 B;  5B0Y C;  3REL D;  5B31 B;  3LEL A;  1ZLA D;  4Z5T B;  3KWQ C;  5FUG B;  1P3P C;  2NQB B;  3B0C W;  3KUY B;  4Z66 A;  3VH5 T;  3AZL C;  3V9R B;  4QLC B;  1KX5 A;  3AZF C;  3UTB C;  3AZI D;  2ARO C;  4XZQ A;  5BO0 B;  2BG1 A;  5DNM D;  3C1C C;  4KUD A;  5B32 A;  5CPK A;  4XUJ A;  3X1T D;  3LZ1 C;  1P3M A;  3X1U D;  4H9P A;  5JA4 B;  1P3L C;  1P3I B;  5G49 B;  4WU8 A;  1P3K B;  3REK D;  3AZG D;  5B0Z B;  4LD9 D;  3AL0 C;  5B1L C;  5B2I B;  1TZY C;  3C1B D;  4JJN B;  3AZN A;  3AFA A;  1M19 B;  3W97 A;  1M18 D;  5AV9 A;  4J8U A;  1P3F B;  4R8P B;  1Z2C B;  3WTP A;  5GSU C;  5CPJ D;  4M6B A;  5CPI C;  4H9R A;  5GT0 B;  1F66 D;  5AV6 D;  1WWS A;  3A6N D;  2L5A A;  5DNN C;  4KGC C;  4E45 A;  3W96 D;  5B0Y B;  3O62 A;  1HQ3 A;  1M1A D;  3B6G A;  4KHA B;  5B40 C;  3KWQ B;  1P3P B;  1B6W A;  1ID3 D;  4H9N A;  4WZS B;  4WNN B;  3UT9 D;  4J8V C;  3AZI A;  1P34 A;  1KX4 D;  3AZF B;  2NQB D;  3MGQ D;  1F1E A;  4X23 D;  3B6F D;  3UTB B;  3KFU G;  5B33 D;  3LZ0 D;  2ARO B;  4AWL B;  1P3O D;  5BNX A;  3X1U A;  3AZM D;  2F2A C;  3MGR D;  3C1C B;  1HTA A;  3WKJ C;  1P3B C;  3WA9 D;  4G92 C;  3REH C;  3LZ1 B;  5GXQ D;  4ZUX D;  1P3L B;  2YFW B;  3MVD D;  3UTA C;  3AV1 D;  1BH8 B;  4H9S C;  5B1L B;  2PYO D;  1TZY B;  3TU4 D;  1KX3 D;  5CP6 A;  3EPJ A;  4YM6 D;  4YS3 C;  4WU9 D;  2XD1 A;  5B2J A;  5GSU B;  3KXB D;  1WWI A;  5CPI B;  3MGS D;  5JRG D;  1P3F D;  2IO5 C;  2BYM A;  4CAY B;  5DNN B;  2FJ7 C;  4KGC B;  3AN2 A;  1EQZ C;  2J8P A;  2Y2N A;  5AV8 C;  1P3A C;  3MNN A;  1S32 D;  5B31 A;  5B40 B;  4NE6 A;  5B0Y D;  3R45 B;  3W99 C;  4Z5T A;  5FUG A;  1ULY A;  3KUY A;  3X1V C;  5BS7 A;  4J8V B;  1U35 D;  3MNN D;  3REJ D;  1P3G D;  3V9R A;  4QLC A;  5AV5 D;  1HQ3 B;  4H9O B;  2Y2O A;  5BO0 A;  4NE5 A;  3WKJ B;  1P3B B;  4G92 B;  4CSR B;  3REH B;  3VH6 W;  3UTA B;  5JA4 A;  1P3I A;  5G49 A;  1P3K A;  5B0Z A;  2CV5 C;  5B2I A;  1KU5 A;  4JJN A;  1KX5 D;  1M19 A;  4YS3 B;  3X1S C;  2XD5 A;  4R8P A;  4XZQ D;  4KUD D;  5B32 D;  5GT0 A;  2IO5 B;  4ZBJ C;  5CPK D;  4XUJ D;  1P3M D;  2FJ7 B;  1EQZ B;  4EO5 B;  3AZK C;  4WU8 D;  5AV8 B;  5B0Y A;  2RVQ D;  2DF4 C;  3NQU B;  4KHA A;  5BT1 D;  3AZN D;  3W99 B;  3KWQ A;  1P3P A;  3AFA D;  2F8N B;  3AZE C;  3W97 D;  3X1V B;  5AV9 D;  4J8U D;  3AZL A;  4WNN A;  3WTP D;  3AZF A;  3UTB A;  4DQY B;  2ARO A;  3O62 D;  1HQ3 D;  3C1C A;  1BH9 B;  3B6G D;  3LZ1 A;  3LJA C;  1P3L A;  2YFW A;  5AVB C;  5B24 C;  3REH D;  2CV5 B;  1BH8 A;  4HGA C;  3AZJ C;  5F99 C;  5B1L A;  1P34 D;  1TZY A;  1Q9C A;  3X1S B;  2ZY4 A;  2G5H C;  5GSU A;  5CPI A;  4ZBJ B;  4CAY A;  5DNN A;  4KGC A;  2VQR A;  3AZK B;  3W98 C;  5AY8 C;  5B40 A;  3WAA C;  3R45 A;  3AYW C;  3AZE B;  5CP6 D;  3AZH C;  5KDM B;  3AV2 C;  2NZD C;  4J8V A;  3MGP C;  5B2J D;  5AVC C;  3VH5 W;  3LEL C;  2F8N D;  5GT3 C;  4J8X C;  4H9O A;  3AN2 D;  3WKJ A;  1P3B A;  3REH A;  4CSR A;  5B31 D;  3LJA B;  5AVB B;  5B24 B;  3UTA A;  3AZL B;  4Z5T D;  3EPK A;  1JFI B;  3KUY D;  4HGA B;  3AZJ B;  5F99 B;  4H9S A;  2F8N K;  2G5I C;  4QLC D;  5BNV B;  4YS3 A;  1H3O B;  1R4V A;  5C3I C;  4J8W C;  5B32 G;  2FJ7 A;  3W98 B;  3REI C;  1EQZ A;  1P3I D;  1AOI C;  5AY8 B;  3REJ A;  5AV8 A;  1P3K D;  1N1J B;  1P3A A;  3NQU A;  5B0Z D;  5B2I D;  3REL C;  3WAA B;  4JJN D;  3AYW B;  3W99 A;  1M19 D;  3AZH B;  2F8N A;  4NE3 A;  1ZLA C;  3AV2 B;  3X1V A;  2NZD B;  4R8P D;  3MGP B;  5AVC B;  5GT3 B;  4J8X B;  5GT0 D;  2Y2P A;  5B1M C;  1BH9 A;  5DNM C;  2ZY2 A;  3X1T C;  3KWQ D;  1P3P D;  2CV5 A;  3REK C;  3AZG C;  3AZL D;  4LD9 C;  2Y2M A;  3AZF D;  3UTB D;  2ZM5 A;  3C1B C;  3X1S A;  2ARO D;  1M18 C;  3C1C D;  5C3I B;  4J8W B;  5CPJ C;  3LZ1 D;  3P5J B;  1P3L D;  3REI B;  1F66 C;  5AV6 C;  3AZK A;  2FFF B;  2YFV B;  3A6N C;  1AOI B;  3W96 C;  2Y2G A;  5B1L D;  1M1A C;  3REL B;  1TZY D;  4UUZ B;  3AZE A;  2Y2L A;  5KDM A;  1ID3 C;  5GSU D;  5CPI D;  3UT9 C;  1KX4 C;  3F6T A;  2F8N G;  5B1M B;  1P3A B;  2NQB C;  1BFM A;  3MGQ C;  4X23 C;  5DNN D;  3B6F C;  4KGC D;  5B33 C;  3LZ0 C;  2HIO C;  1P3O C;  5DNM B;  5E5A C;  3AZM C;  3MGR C;  3WA9 C;  3LJA A;  5B40 D;  5AVB A;  5B24 A;  5B31 G;  3X1T B;  5GXQ C;  3B0C T;  4ZUX C;  3MVD C;  3AV1 C;  1JFI A;  3AZJ A;  5F99 A;  3REK B;  3AZG B;  4LD9 B;  4J8V D;  2F8N H;  2PYO C;  5BNV A;  3C1B B;  4DRB A;  3TU4 C;  1KX3 C;  3KSY A;  1M18 B;  4YM6 C;  1H3O A;  4WU9 C;  3WKJ D;  1P3B D;  3KXB C;  5CPJ B;  4DRA A;  1F66 B;  3MGS C;  5AV6 B;  5JRG C;  3EPL A;  3UTA D;  3A6N B;  1P3F C;  3W98 A;  5AY8 A;  1N1J A;  3W96 B;  1M1A B;  2W8S A;  3WAA A;  1S32 C;  3AYW A;  3AZH A;  4YS3 D;  3AV2 A;  1ID3 B;  2NZD A;  3NQJ B;  3MGP A;  5AVC A;  5GT3 A;  3UT9 B;  1U35 C;  1KX4 B;  3MNN C;  4J8X A;  3REJ C;  1P3G C;  3MGQ B;  5AV5 C;  4X23 B;  2FJ7 D;  3B6F B;  5B33 B;  1EQZ D;  3LZ0 B;  5AV8 D;  3EG5 B;  2HIO B;  5B1M D;  3B0D C;  1P3A D;  3AZM B;  5E5A B;  1P3O B;  4E44 A;  3MGR B;  3WA9 B;  1PZR A;  5GXQ B;  1B67 A;  4AWL C;  4ZUX B;  3W99 D;  3MVD B;  1W2E A;  3AV1 B;  3X1V D;  4H9Q B;  4Z66 C;  3H0M C;  2PYO B;  4WJ3 C;  2BYK B;  3TU4 B;  1KX3 B;  1KX5 C;  1A7W A;  4YM6 B;  4WU9 B;  4XZQ C;  2Y2H A;  2HUE C;  3KXB B;  4J8W A;  2Y2Q A;  3MGS B;  4KUD C;  5B32 C;  5JRG B;  3REI A;  5CPK C;  1TAF B;  1AOI A;  4XUJ C;  2YFV A;  1P3M C;  4G91 C;  4WU8 C;  2CV5 D;  2RVQ C;  3VH6 A;  3REL A;  1S32 B;  4UUZ A;  5BT1 C;  1ZLA A;  5CHL B;  3AZN C;  3X1S D;  3AFA C;  3IP4 C;  3W97 C;  5AV9 C;  4J8U C;  1U35 B;  3MNN B;  3WTP C;  3REJ B;  1P3G B;  5B1M A;  5AV5 B;  3AZK D;  2JSS A;  2CWE A;  3B0D B;  3WTP E;  5DNM A;  3O62 C;  1HQ3 C;  2Y2J A;  3B6G C;  3X1T A;  2HIO D;  3LEL B;  3H0L C;  5E5A D;  3AZE D;  3REK A;  3AZG A;  4LD9 A;  4Z66 B;  3AZI C;  1P34 C;  3C1B A;  1KX5 B;  1M18 A;  4XZQ B;  2HUE B;  2Y2I A;  3X1U C;  5CPJ A;  3VH6 T;  4KUD B;  5B32 B;  3LJA D;  1F66 A;  5CPK B;  5AV6 A;  5AVB D;  4XUJ B;  5B24 D;  3A6N A;  1P3M B;  4H9P B;  2ZY5 A;  4G91 B;  3W96 A;  4WU8 B;  3AZJ D;  4NFT A;  5F99 D;  4UPK A;  1M1A A;  2DQN C;  4EO5 C;  3AZN B;  4Z2M G;  3AFA B;  1ID3 A;  3NQJ A;  5CP6 C;  3W97 B;  3H0R C;  5AV9 B;  4J8U B;  3WTP B;  3UT9 A;  1KX4 A;  4WV4 B;  5B2J C;  2NQB A;  3MGQ A;  4H9R B;  4X23 A;  3B6F A;  2LY8 A;  3W98 D;  5B33 A;  3LZ0 A;  5AY8 D;  2Y2K A;  2HIO A;  3AN2 C;  1P3O A;  2JCH A;  5E5A A;  3O62 B;  3MGR A;  3AZM A;  1ZLA B;  3WA9 A;  3A1K A;  3B6G B;  4Z2M H;  2JE5 A;  5GXQ A;  3WAA D;  5B31 C;  4ZUX A;  3AYW D;  3MVD A;  2UWX A;  3AZH D;  3AV1 A;  3AV2 D;  4Z5T C;  2NZD D;  4H9N B;  3B0B A;  3MGP D;  3KUY C;  4H9Q A;  1T3U A;  5AVC D;  5BS7 C;  3LEL D;  5GT3 D;  3AZI B;  2PYO A;  1P34 B;  4J8X D;  2BYK A;  3TU4 A;  4QLC C;  2ZY3 A;  3A1I A;  1KX3 A;  4Z66 D;  4YM6 A;  3EPH A;  4WU9 A;  3VH5 A;  5BNX B;  3X1U B;  3KXB A;  3MGS A;  5JRG A;  1P3F A;  1TAF A;  1P3I C;  1P3K C;  5B0Z C;  3FDD A;  1S32 A;  5B2I C;  4JJN C;  5CP6 B;  1M19 C;  4R8P C;  1U35 A;  5B2J B; 
#chains in the Genus database with same CATH homology
 1P3G A;  4J8W D;  5AV5 A;  5GT0 C;  2RIQ A;  3REI D;  2BYM B;  1AOI D;  3AN2 B;  5B0Y C;  3REL D;  5B31 B;  3LEL A;  1ZLA D;  4Z5T B;  3KWQ C;  5FUG B;  1P3P C;  2NQB B;  3B0C W;  3KUY B;  4Z66 A;  3VH5 T;  3AZL C;  3V9R B;  4QLC B;  1KX5 A;  3AZF C;  3UTB C;  3AZI D;  2ARO C;  4XZQ A;  5BO0 B;  2BG1 A;  5DNM D;  3C1C C;  4KUD A;  5B32 A;  5CPK A;  4XUJ A;  3X1T D;  3LZ1 C;  1P3M A;  3X1U D;  4H9P A;  5JA4 B;  1P3L C;  1P3I B;  5G49 B;  4WU8 A;  1P3K B;  3REK D;  3AZG D;  5B0Z B;  4LD9 D;  3AL0 C;  5B1L C;  5B2I B;  1TZY C;  3C1B D;  4JJN B;  3AZN A;  3AFA A;  1M19 B;  3W97 A;  1M18 D;  5AV9 A;  4J8U A;  1P3F B;  4R8P B;  1Z2C B;  3WTP A;  5GSU C;  5CPJ D;  4M6B A;  5CPI C;  4H9R A;  5GT0 B;  1F66 D;  5AV6 D;  1WWS A;  3A6N D;  2L5A A;  5DNN C;  4KGC C;  4E45 A;  3W96 D;  5B0Y B;  3O62 A;  1HQ3 A;  1M1A D;  3B6G A;  4KHA B;  5B40 C;  3KWQ B;  1P3P B;  1B6W A;  1ID3 D;  4H9N A;  4WZS B;  4WNN B;  3UT9 D;  4J8V C;  3AZI A;  1P34 A;  1KX4 D;  3AZF B;  2NQB D;  3MGQ D;  1F1E A;  4X23 D;  3B6F D;  3UTB B;  3KFU G;  5B33 D;  3LZ0 D;  2ARO B;  4AWL B;  1P3O D;  5BNX A;  3X1U A;  3AZM D;  2F2A C;  3MGR D;  3C1C B;  1HTA A;  3WKJ C;  1P3B C;  3WA9 D;  4G92 C;  3REH C;  3LZ1 B;  5GXQ D;  4ZUX D;  1P3L B;  2YFW B;  3MVD D;  3UTA C;  3AV1 D;  1BH8 B;  4H9S C;  5B1L B;  2PYO D;  1TZY B;  3TU4 D;  1KX3 D;  5CP6 A;  3EPJ A;  4YM6 D;  4YS3 C;  4WU9 D;  2XD1 A;  5B2J A;  5GSU B;  3KXB D;  1WWI A;  5CPI B;  3MGS D;  5JRG D;  1P3F D;  2IO5 C;  2BYM A;  4CAY B;  5DNN B;  2FJ7 C;  4KGC B;  3AN2 A;  1EQZ C;  2J8P A;  2Y2N A;  5AV8 C;  1P3A C;  3MNN A;  1S32 D;  5B31 A;  5B40 B;  4NE6 A;  5B0Y D;  3R45 B;  3W99 C;  4Z5T A;  5FUG A;  1ULY A;  3KUY A;  3X1V C;  5BS7 A;  4J8V B;  1U35 D;  3MNN D;  3REJ D;  1P3G D;  3V9R A;  4QLC A;  5AV5 D;  1HQ3 B;  4H9O B;  2Y2O A;  5BO0 A;  4NE5 A;  3WKJ B;  1P3B B;  4G92 B;  4CSR B;  3REH B;  3VH6 W;  3UTA B;  5JA4 A;  1P3I A;  5G49 A;  1P3K A;  5B0Z A;  2CV5 C;  5B2I A;  1KU5 A;  4JJN A;  1KX5 D;  1M19 A;  4YS3 B;  3X1S C;  2XD5 A;  4R8P A;  4XZQ D;  4KUD D;  5B32 D;  5GT0 A;  2IO5 B;  4ZBJ C;  5CPK D;  4XUJ D;  1P3M D;  2FJ7 B;  1EQZ B;  4EO5 B;  3AZK C;  4WU8 D;  5AV8 B;  5B0Y A;  2RVQ D;  2DF4 C;  3NQU B;  4KHA A;  5BT1 D;  3AZN D;  3W99 B;  3KWQ A;  1P3P A;  3AFA D;  2F8N B;  3AZE C;  3W97 D;  3X1V B;  5AV9 D;  4J8U D;  3AZL A;  4WNN A;  3WTP D;  3AZF A;  3UTB A;  4DQY B;  2ARO A;  3O62 D;  1HQ3 D;  3C1C A;  1BH9 B;  3B6G D;  3LZ1 A;  3LJA C;  1P3L A;  2YFW A;  5AVB C;  5B24 C;  3REH D;  2CV5 B;  1BH8 A;  4HGA C;  3AZJ C;  5F99 C;  5B1L A;  1P34 D;  1TZY A;  1Q9C A;  3X1S B;  2ZY4 A;  2G5H C;  5GSU A;  5CPI A;  4ZBJ B;  4CAY A;  5DNN A;  4KGC A;  2VQR A;  3AZK B;  3W98 C;  5AY8 C;  5B40 A;  3WAA C;  3R45 A;  3AYW C;  3AZE B;  5CP6 D;  3AZH C;  5KDM B;  3AV2 C;  2NZD C;  4J8V A;  3MGP C;  5B2J D;  5AVC C;  3VH5 W;  3LEL C;  2F8N D;  5GT3 C;  4J8X C;  4H9O A;  3AN2 D;  3WKJ A;  1P3B A;  3REH A;  4CSR A;  5B31 D;  3LJA B;  5AVB B;  5B24 B;  3UTA A;  3AZL B;  4Z5T D;  3EPK A;  1JFI B;  3KUY D;  4HGA B;  3AZJ B;  5F99 B;  4H9S A;  2F8N K;  2G5I C;  4QLC D;  5BNV B;  4YS3 A;  1H3O B;  1R4V A;  5C3I C;  4J8W C;  5B32 G;  2FJ7 A;  3W98 B;  3REI C;  1EQZ A;  1P3I D;  1AOI C;  5AY8 B;  3REJ A;  5AV8 A;  1P3K D;  1N1J B;  1P3A A;  3NQU A;  5B0Z D;  5B2I D;  3REL C;  3WAA B;  4JJN D;  3AYW B;  3W99 A;  1M19 D;  3AZH B;  2F8N A;  4NE3 A;  1ZLA C;  3AV2 B;  3X1V A;  2NZD B;  4R8P D;  3MGP B;  5AVC B;  5GT3 B;  4J8X B;  5GT0 D;  2Y2P A;  5B1M C;  1BH9 A;  5DNM C;  2ZY2 A;  3X1T C;  3KWQ D;  1P3P D;  2CV5 A;  3REK C;  3AZG C;  3AZL D;  4LD9 C;  2Y2M A;  3AZF D;  3UTB D;  2ZM5 A;  3C1B C;  3X1S A;  2ARO D;  1M18 C;  3C1C D;  5C3I B;  4J8W B;  5CPJ C;  3LZ1 D;  3P5J B;  1P3L D;  3REI B;  1F66 C;  5AV6 C;  3AZK A;  2FFF B;  2YFV B;  3A6N C;  1AOI B;  3W96 C;  2Y2G A;  5B1L D;  1M1A C;  3REL B;  1TZY D;  4UUZ B;  3AZE A;  2Y2L A;  5KDM A;  1ID3 C;  5GSU D;  5CPI D;  3UT9 C;  1KX4 C;  3F6T A;  2F8N G;  5B1M B;  1P3A B;  2NQB C;  1BFM A;  3MGQ C;  4X23 C;  5DNN D;  3B6F C;  4KGC D;  5B33 C;  3LZ0 C;  2HIO C;  1P3O C;  5DNM B;  5E5A C;  3AZM C;  3MGR C;  3WA9 C;  3LJA A;  5B40 D;  5AVB A;  5B24 A;  5B31 G;  3X1T B;  5GXQ C;  3B0C T;  4ZUX C;  3MVD C;  3AV1 C;  1JFI A;  3AZJ A;  5F99 A;  3REK B;  3AZG B;  4LD9 B;  4J8V D;  2F8N H;  2PYO C;  5BNV A;  3C1B B;  4DRB A;  3TU4 C;  1KX3 C;  3KSY A;  1M18 B;  4YM6 C;  1H3O A;  4WU9 C;  3WKJ D;  1P3B D;  3KXB C;  5CPJ B;  4DRA A;  1F66 B;  3MGS C;  5AV6 B;  5JRG C;  3EPL A;  3UTA D;  3A6N B;  1P3F C;  3W98 A;  5AY8 A;  1N1J A;  3W96 B;  1M1A B;  2W8S A;  3WAA A;  1S32 C;  3AYW A;  3AZH A;  4YS3 D;  3AV2 A;  1ID3 B;  2NZD A;  3NQJ B;  3MGP A;  5AVC A;  5GT3 A;  3UT9 B;  1U35 C;  1KX4 B;  3MNN C;  4J8X A;  3REJ C;  1P3G C;  3MGQ B;  5AV5 C;  4X23 B;  2FJ7 D;  3B6F B;  5B33 B;  1EQZ D;  3LZ0 B;  5AV8 D;  3EG5 B;  2HIO B;  5B1M D;  3B0D C;  1P3A D;  3AZM B;  5E5A B;  1P3O B;  4E44 A;  3MGR B;  3WA9 B;  1PZR A;  5GXQ B;  1B67 A;  4AWL C;  4ZUX B;  3W99 D;  3MVD B;  1W2E A;  3AV1 B;  3X1V D;  4H9Q B;  4Z66 C;  3H0M C;  2PYO B;  4WJ3 C;  2BYK B;  3TU4 B;  1KX3 B;  1KX5 C;  1A7W A;  4YM6 B;  4WU9 B;  4XZQ C;  2Y2H A;  2HUE C;  3KXB B;  4J8W A;  2Y2Q A;  3MGS B;  4KUD C;  5B32 C;  5JRG B;  3REI A;  5CPK C;  1TAF B;  1AOI A;  4XUJ C;  2YFV A;  1P3M C;  4G91 C;  4WU8 C;  2CV5 D;  2RVQ C;  3VH6 A;  3REL A;  1S32 B;  4UUZ A;  5BT1 C;  1ZLA A;  5CHL B;  3AZN C;  3X1S D;  3AFA C;  3IP4 C;  3W97 C;  5AV9 C;  4J8U C;  1U35 B;  3MNN B;  3WTP C;  3REJ B;  1P3G B;  5B1M A;  5AV5 B;  3AZK D;  2JSS A;  2CWE A;  3B0D B;  3WTP E;  5DNM A;  3O62 C;  1HQ3 C;  2Y2J A;  3B6G C;  3X1T A;  2HIO D;  3LEL B;  3H0L C;  5E5A D;  3AZE D;  3REK A;  3AZG A;  4LD9 A;  4Z66 B;  3AZI C;  1P34 C;  3C1B A;  1KX5 B;  1M18 A;  4XZQ B;  2HUE B;  2Y2I A;  3X1U C;  5CPJ A;  3VH6 T;  4KUD B;  5B32 B;  3LJA D;  1F66 A;  5CPK B;  5AV6 A;  5AVB D;  4XUJ B;  5B24 D;  3A6N A;  1P3M B;  4H9P B;  2ZY5 A;  4G91 B;  3W96 A;  4WU8 B;  3AZJ D;  4NFT A;  5F99 D;  4UPK A;  1M1A A;  2DQN C;  4EO5 C;  3AZN B;  4Z2M G;  3AFA B;  1ID3 A;  3NQJ A;  5CP6 C;  3W97 B;  3H0R C;  5AV9 B;  4J8U B;  3WTP B;  3UT9 A;  1KX4 A;  4WV4 B;  5B2J C;  2NQB A;  3MGQ A;  4H9R B;  4X23 A;  3B6F A;  2LY8 A;  3W98 D;  5B33 A;  3LZ0 A;  5AY8 D;  2Y2K A;  2HIO A;  3AN2 C;  1P3O A;  2JCH A;  5E5A A;  3O62 B;  3MGR A;  3AZM A;  1ZLA B;  3WA9 A;  3A1K A;  3B6G B;  4Z2M H;  2JE5 A;  5GXQ A;  3WAA D;  5B31 C;  4ZUX A;  3AYW D;  3MVD A;  2UWX A;  3AZH D;  3AV1 A;  3AV2 D;  4Z5T C;  2NZD D;  4H9N B;  3B0B A;  3MGP D;  3KUY C;  4H9Q A;  1T3U A;  5AVC D;  5BS7 C;  3LEL D;  5GT3 D;  3AZI B;  2PYO A;  1P34 B;  4J8X D;  2BYK A;  3TU4 A;  4QLC C;  2ZY3 A;  3A1I A;  1KX3 A;  4Z66 D;  4YM6 A;  3EPH A;  4WU9 A;  3VH5 A;  5BNX B;  3X1U B;  3KXB A;  3MGS A;  5JRG A;  1P3F A;  1TAF A;  1P3I C;  1P3K C;  5B0Z C;  3FDD A;  1S32 A;  5B2I C;  4JJN C;  5CP6 B;  1M19 C;  4R8P C;  1U35 A;  5B2J B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...