1WWIA

Crystal structure of ttk003001566 from thermus thermophilus hb8
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
148
structure length
148
Chain Sequence
MLMKVAEFERLFRQAAGLDVDKNDLKRVSDFLRNKLYDLLAVAERNAKYNGRDLIFEPDLPIAKGLQETLQEFRRMDTALELKPVLDALAALPPLDLEVAEDVRNLLPELAGALVVAYARVLKELDPALKNPQTEHHERAERVFNLLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein TTHA1479
publication title Crystal structure of ttk003001566 from Thermus Thermophilus HB8
rcsb
source organism Thermus thermophilus hb8
total genus 51
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2005-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09123 DUF1931 Domain of unknown function (DUF1931)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1wwiA00
1ID3B 3KXBA 3O62D 5DNNB 2FJ7A 5B33D 3AZIB 3W96C 3UT9C 4CAYA 5AV8C 2CV5B 5AVCC 5GT0A 3NQJA 3REKA 1P34D 4KGCB 5G49A 5B1LD 4ZUXB 5AV8B 5CPJB 2NQBA 3TU4C 5B40D 5JRGD 5AV9C 5B32G 1KX3C 3AFAD 4JJND 3RELD 1P3GC 3B0CT 4WU8B 1M1AC 3LZ0A 3C1CC 3LELD 1KX3B 1ZLAC 4Z66D 1P3FD 1M1AB 3UTAC 2YFVA 1P3KD 3W99D 3X1UC 1KX4D 4XZQD 4YM6C 5F99C 3REJB 3UTAB 3MGQD 3REID 3REHA 4H9QB 4WU9C 3AZLB 3X1UB 1P3LA 2NZDD 5E5AB 1M18D 4AWLB 1TAFA 2HIOA 3KUYA 3AZGD 3AZFD 3MGPC 4H9SA 3MVDC 3X1TB 2BYKB 4XUJD 3WA9B 1TZYB 1P3AB 1P3BC 1ID3D 1P3PC 4KUDA 5GXQB 3B6FB 4LD9A 5B2JA 3MVDB 3A6NA 5CPIB 5DNND 3B6GB 3AZID 3AZMA 4UUZA 5CPKA 2RVQD 1P3PB 4H9RA 4H9PB 2AROD 4KGCD 4J8XD 4ZUXD 5CPJD 3AZNC 3WAAA 4DRBA 1KX5C 3B0DC 3O62C 1P3IB 3AZND 3WTPE 4H9OA 5B33C 4WU8D 3MGSB 4Z5TD 1A7WA 3B0DB 2LY8A 1P34C 3AZEB 5AV5A 4G92C 5GSUA 3WKJB 5B40C 1JFIB 4YS3B 3NQUA 1H3OA 3AFAC 5B1LB 4JJNC 4G92B 3KWQB 4ZBJB 3RELC 2F8NA 1B67A 4KHAA 5BNVB 3REJD 5B40B 5JRGB 1KU5A 5KDMA 3LELC 3X1VA 3MGRB 3AZJB 4NFTA 3AZLD 4EO5B 2JSSA 1HQ3A 3KSYA 5AV6B 4Z66C 1P3FC 5E5AD 4J8UD 5AY8B 1P3OA 2IO5C 3LELB 3LZ1C 3W99C 5B0ZB 3AYWA 3X1TD 1KX4C 3WA9D 4XZQC 1F66A 1TZYD 3LZ1A 4X23B 3MGQC 3REIC 1P3AD 3C1BB 1P3KB 3W99B 5GXQD 3B6FD 1KX4B 1M19B 4XZQB 3B6GD 2NZDC 1M18C 1BH9A 1BFMA 3AZGC 5GT3D 5B32A 3AZFC 3VH6W 4WNNB 4XUJC 5AVBC 5CP6A 3UTBA 2NZDB 1M18B 4J8VA 1S32B 3MNNB 3AZGB 1P3MB 5B0YA 1ID3C 3AZFB 2PYOA 1P3ID 5AVBA 5DNNC 4XUJB 1BH8A 1HTAA 3AZIC 5BNXA 1AOIA 5B31B 5DNMA 3LJAA 3MGSD 2AROC 5B24B 4KGCC 3X1SA 3AZED 4J8XC 2CV5A 2HUEC 4ZUXC 2CV5C 3AV2B 5CPJC 3WKJD 5CHLB 1U35B 4YS3D 1EQZD 2AROB 3W96A 3UT9A 5AV8A 4HGAC 4J8XB 2HUEB 5AVCA 4J8WD 3KWQD 4WU8C 3AN2B 3VH5A 3MGRD 3AZJD 4HGAB 4NE5A 5AV6D 3TU4A 4H9NB 4QLCB 4Z5TB 5AV9A 4G91B 5AY8D 1KX3A 1P3GA 2FJ7B 5B0ZD 1M1AA 3C1CA 5GT0B 3REJC 3NQJB 4X23D 2BYMB 1ZLAA 3C1BD 3AZLC 3AZHD 1M19D 3UTAA 2NQBB 5E5AC 4AWLC 4H9QA 3X1UA 4R8PD 5F99A 4YM6A 3X1TC 1WWSA 3WA9C 3LZ0B 4J8UB 1TZYC 1S32D 3MNND 4WU9A 1P3AC 1P3MD 4CSRB 1N1JB 5GXQC 3B6FC 5CPIC 3B6GC 5C3IB 3MGPA 3W97D 5B31D 3MVDA 5CPIA 3AV1D 5B24D 1P3BA 3AV2D 1P3PA 1U35D 5GT3B 5B2ID 3REHB 1P3IC 5B1MD 3W98D 1P3LB 1TAFB 3KUYB 3MGSC 3AN2D 3AZKD 3WTPD 3AZEC 3AZNA 1KX5A 3WKJC 3O62A 4QLCD 4YS3C 3KXBD 1EQZC 4KUDB 5B33A 4LD9B 5B2JB 5B1LC 2FJ7D 3KWQC 4ZBJC 3AZMB 5CPKB 5GT0D 5JRGC 1P34A 1EQZB 3REKD 4H9RB 5B1LA 3MGRC 3AZJC 4J8WB 4EO5C 4Z2MH 5AV6C 5BNVA 5B40A 5JRGA 2NQBD 3WAAB 5AY8C 3AFAA 4JJNA 3RELA 4H9OB 5B0ZC 1F1EA 3LZ0D 3LELA 4X23C 3C1BC 1P3KC 4Z66A 4NE6A 3R45B 3AZHC 5AV5B 1P3FA 1M19C 1P3KA 5JA4A 3W99A 3NQUB 1H3OB 1KX4A 4R8PC 4XZQA 3AZHB 2F8NB 3MGQA 3REIA 4KHAB 1S32C 3MNNC 1P3MC 5KDMB 3REHD 3X1VB 4R8PB 2NZDA 5F99D 1M18A 3AZGA 5BO0A 1P3LD 3VH6T 5FUGB 2HIOD 3KUYD 3AZFA 1P3OB 5B31C 3W97C 4XUJA 3AV1C 5B24C 1ID3A 3AV2C 1F66B 2RVQC 1U35C 3W97B 5B2IC 5DNNA 4WZSB 4KUDD 3AV1B 5B2JD 5B1MC 3AZIA 4LD9D 3A6ND 1Q9CA 3W98C 2YFWB 1B6WA 5BS7C 3AZMD 5CPKD 5B2IB 2AROA 5B32B 4KGCA 4J8XA 3AN2C 5B1MB 4ZUXA 3AZKC 3WTPC 5CPJA 3W98B 5CP6B 3WAAD 4QLCC 4Z5TC 4G91C 3V9RB 3KXBC 3AZKB 3WTPB 1BH8B 2FJ7C 4WU8A 4H9NA 4Z5TA 5BNXB 5GT0C 1KX5D 1AOIB 3LJAB 3KXBB 5DNMB 3REKC 3X1SB 5AV5D 4CAYB 5GSUD 2NQBC 2BYMA 2F8NH 5B31G 3REKB 3UT9B 3W96B 5G49B 5AVCB 3REJA 2F8ND 4WV4B 3LZ0C 4J8UC 3AZLA 3B0CW 3X1VD 1HQ3D 5E5AA 4J8UA 1R4VA 3TU4B 5AV9B 5C3IC 4CSRA 1N1JA 1P3OD 3X1TA 2BYKA 3WA9A 1P3GB 3AYWD 3C1CB 1TZYA 4M6BA 1P3AA 3B0BA 1F66D 3LZ1D 5GXQA 1ZLAB 3B6FA 2YFVB 5GT3C 3REHC 3B6GA 1P3LC 5GT3A 2HIOC 3KUYC 4H9PA 5B32D 4H9SC 4YM6B 5F99B 5CP6D 3UTBD 1WWIA 2HIOB 4DRAA 5BT1D 4J8VD 4WU9B 5B0YD 4Z2MG 1P3IA 4KUDC 4LD9C 5B2JC 2PYOD 5AVBD 3A6NC 3AZMC 3MGSA 5CPKC 3MGPB 1AOID 3LJAD 5DNMD 3AZEA 3A6NB 4J8WC 3X1SD 2CV5D 3WKJA 1P3BB 4UUZB 3WAAC 1JFIA 4YS3A 1EQZA 4J8WA 3KWQA 3UT9D 3W96D 5AV8D 5AVCD 3MGRA 3AZJA 5AV6A 3AZNB 5AV5C 5AY8A 5GSUC 3TU4D 1KX5B 3O62B 4E45A 5AV9D 1KX3D 5B33B 5B0ZA 3R45A 1P3GD 1M1AD 3C1CD 5GSUB 4X23A 3C1BA 1P34B 1ZLAD 3AZHA 3X1VC 1M19A 1HQ3C 3UTAD 1P3OC 3AFAB 4R8PA 4JJNB 3X1UD 3RELB 4WNNA 1HQ3B 4YM6D 3AYWC 1S32A 3MNNA 5FUGA 1P3MA 2F8NK 1F66C 4WU9D 4E44A 4Z66B 1P3FB 3AYWB 1ULYA 2IO5B 3W97A 5B31A 3LZ1B 5JA4B 3MGPD 3AV1A 3MVDD 5B32C 5B24A 5CPID 3AV2A 2YFWA 5CP6C 3MGQB 3REIB 3UTBC 1U35A 1P3BD 1BH9B 5B2IA 4J8VC 5BT1C 1P3PD 5B0YC 5B1MA 2CWEA 4NE3A 2PYOC 3VH6A 3W98A 2F8NG 5BS7A 3UTBB 5BO0B 2L5AA 3V9RA 4J8VB 5B0YB 1AOIC 3LJAC 5DNMC 3AZKA 3AN2A 3VH5W 3WTPA 2PYOB 5AVBB 3X1SC 3VH5T 4QLCA
chains in the Genus database with same CATH superfamily
1ID3B 3KXBA 3O62D 2Y2GA 5DNNB 2FJ7A 5B33D 3AZIB 3W96C 3UT9C 4CAYA 5AV8C 2UWXA 2CV5B 5AVCC 5GT0A 3NQJA 3REKA 2XD1A 1P34D 4KGCB 5G49A 5B1LD 4ZUXB 5AV8B 5CPJB 2NQBA 3TU4C 5B40D 5JRGD 5AV9C 5B32G 1KX3C 3AFAD 4JJND 3RELD 2F2AC 1P3GC 3B0CT 4WU8B 1M1AC 3LZ0A 3C1CC 3LELD 1KX3B 1ZLAC 4Z66D 1P3FD 1M1AB 2ZM5A 3UTAC 2YFVA 1P3KD 3W99D 3X1UC 1KX4D 2G5HC 4XZQD 4YM6C 5F99C 3REJB 3UTAB 3MGQD 3REID 3REHA 4H9QB 4WU9C 3AZLB 2ZY5A 3X1UB 1P3LA 2NZDD 5E5AB 1M18D 4AWLB 1TAFA 2HIOA 3KUYA 3AZGD 2Y2HA 3AZFD 3MGPC 4H9SA 3MVDC 3X1TB 2BYKB 4XUJD 3WA9B 1TZYB 1P3AB 1P3BC 1ID3D 1P3PC 4KUDA 5GXQB 3B6FB 4LD9A 5B2JA 3MVDB 3A6NA 5CPIB 5DNND 2VQRA 3B6GB 3AZID 3AZMA 4UUZA 5CPKA 2RVQD 1P3PB 4H9RA 4H9PB 2AROD 4KGCD 4J8XD 4ZUXD 5CPJD 3AZNC 3WAAA 4DRBA 1KX5C 3B0DC 3O62C 1P3IB 3AZND 3WTPE 4H9OA 5B33C 4WU8D 3MGSB 4Z5TD 1A7WA 3B0DB 2LY8A 1P34C 3AZEB 5AV5A 4G92C 5GSUA 3H0LC 3WKJB 5B40C 1JFIB 4YS3B 3NQUA 1H3OA 3AFAC 5B1LB 4JJNC 4G92B 2Y2MA 3KWQB 4ZBJB 3RELC 2F8NA 1B67A 4KHAA 5BNVB 3REJD 5B40B 5JRGB 1KU5A 5KDMA 3LELC 3X1VA 3MGRB 3AZJB 4NFTA 3AZLD 4EO5B 2JSSA 1HQ3A 3KSYA 5AV6B 4Z66C 1P3FC 5E5AD 4J8UD 5AY8B 1W2EA 1P3OA 2IO5C 3LELB 3LZ1C 3W99C 5B0ZB 3AYWA 3X1TD 1KX4C 3WA9D 4XZQC 1F66A 1TZYD 3LZ1A 4X23B 3MGQC 3REIC 1P3AD 3C1BB 1P3KB 3W99B 5GXQD 2G5IC 3B6FD 1KX4B 1M19B 4XZQB 3B6GD 2NZDC 1M18C 1BH9A 1BFMA 3AZGC 5GT3D 5B32A 3AZFC 3VH6W 4WNNB 4XUJC 5AVBC 5CP6A 2Y2LA 3UTBA 1M18B 2NZDB 4J8VA 1S32B 3MNNB 3AZGB 1P3MB 5B0YA 1ID3C 3AZFB 2PYOA 1P3ID 5AVBA 5DNNC 4XUJB 1BH8A 1HTAA 3AZIC 5BNXA 1AOIA 5B31B 5DNMA 3LJAA 3MGSD 2Y2JA 2AROC 5B24B 4KGCC 3X1SA 3AZED 4J8XC 2CV5A 2HUEC 4ZUXC 2CV5C 4DQYB 3AV2B 5CPJC 3WKJD 5CHLB 1U35B 4YS3D 1EQZD 2AROB 3W96A 3UT9A 5AV8A 4HGAC 4J8XB 2HUEB 5AVCA 4J8WD 3F6TA 3KWQD 3EPHA 4WU8C 3P5JB 3AN2B 3VH5A 3MGRD 3AZJD 4HGAB 4NE5A 5AV6D 3TU4A 4H9NB 4QLCB 4Z5TB 5AV9A 4G91B 5AY8D 1KX3A 1P3GA 2FJ7B 5B0ZD 1M1AA 3C1CA 5GT0B 3REJC 3NQJB 4X23D 2BYMB 1ZLAA 3C1BD 3AZLC 3AZHD 1M19D 3UTAA 2NQBB 5E5AC 4AWLC 4H9QA 3X1UA 4R8PD 5F99A 4YM6A 3X1TC 1WWSA 3WA9C 3LZ0B 4J8UB 1TZYC 1S32D 3MNND 4WU9A 1P3AC 1P3MD 3KFUG 4CSRB 1N1JB 5GXQC 3B6FC 5CPIC 3B6GC 5C3IB 3MGPA 3W97D 5B31D 3MVDA 5CPIA 3AV1D 5B24D 1P3BA 3AV2D 1P3PA 1U35D 5GT3B 5B2ID 3REHB 1P3IC 5B1MD 3W98D 1P3LB 1TAFB 3KUYB 3MGSC 3AN2D 3AZKD 3WTPD 3AZEC 3AZNA 1KX5A 3WKJC 3O62A 4QLCD 4YS3C 3KXBD 1EQZC 4KUDB 5B33A 4LD9B 5B2JB 5B1LC 2FJ7D 3KWQC 4ZBJC 3AZMB 5CPKB 5GT0D 5JRGC 1P34A 1EQZB 3REKD 4H9RB 5B1LA 3MGRC 3AZJC 4J8WB 4EO5C 4Z2MH 5AV6C 5BNVA 5B40A 5JRGA 2NQBD 3WAAB 5AY8C 3AFAA 4JJNA 3RELA 2BG1A 4H9OB 5B0ZC 3A1IA 1F1EA 3EPJA 3LZ0D 3LELA 4X23C 3C1BC 1P3KC 2J8PA 4Z66A 4NE6A 3R45B 3AZHC 5AV5B 1P3FA 1M19C 1P3KA 2RIQA 5JA4A 3W99A 3NQUB 1H3OB 1KX4A 4R8PC 4XZQA 3AZHB 2ZY4A 2F8NB 3MGQA 3REIA 4KHAB 2DQNC 3MNNC 1S32C 1P3MC 5KDMB 3REHD 3X1VB 4R8PB 2JE5A 2NZDA 5F99D 1M18A 3AZGA 5BO0A 1P3LD 3VH6T 5FUGB 2HIOD 3KUYD 3AZFA 1PZRA 5B31C 1P3OB 3W97C 4XUJA 3AV1C 5B24C 1ID3A 3AV2C 1F66B 2RVQC 1U35C 3W97B 5B2IC 3EPKA 5DNNA 4WZSB 4KUDD 3AV1B 5B2JD 5B1MC 3AZIA 4LD9D 3A6ND 1Q9CA 3W98C 2YFWB 1B6WA 5BS7C 3AZMD 5CPKD 2DF4C 3EG5B 5B2IB 2Y2NA 2AROA 5B32B 4KGCA 4J8XA 3AN2C 5B1MB 4ZUXA 3AZKC 3WTPC 5CPJA 3W98B 5CP6B 3WAAD 4QLCC 4Z5TC 4G91C 3V9RB 3KXBC 3AZKB 3WTPB 1BH8B 2FJ7C 4WU8A 4H9NA 3H0RC 4Z5TA 5BNXB 5GT0C 1KX5D 1AOIB 3LJAB 3KXBB 5DNMB 3REKC 3X1SB 5AV5D 4CAYB 5GSUD 2NQBC 2Y2PA 2BYMA 2F8NH 5B31G 4UPKA 3REKB 3UT9B 3W96B 5G49B 5AVCB 3REJA 2F8ND 4WV4B 2Y2OA 3LZ0C 4J8UC 3AZLA 3B0CW 3X1VD 1HQ3D 5E5AA 4J8UA 1R4VA 3TU4B 5AV9B 5C3IC 4CSRA 1N1JA 1P3OD 3X1TA 2BYKA 3WA9A 1P3GB 3AYWD 3C1CB 1TZYA 4M6BA 1P3AA 3B0BA 1F66D 2Y2IA 3LZ1D 1T3UA 5GXQA 1ZLAB 3B6FA 2YFVB 5GT3C 3REHC 3B6GA 3IP4C 1Z2CB 1P3LC 3H0MC 5GT3A 2HIOC 3KUYC 4H9PA 5B32D 4H9SC 4YM6B 5F99B 5CP6D 3UTBD 1WWIA 2FFFB 2HIOB 4DRAA 5BT1D 4J8VD 3FDDA 5B0YD 4WU9B 4Z2MG 1P3IA 4KUDC 4LD9C 5B2JC 2PYOD 5AVBD 3A6NC 3EPLA 3MGSA 2JCHA 2ZY2A 3AZMC 5CPKC 3MGPB 1AOID 3LJAD 5DNMD 3AZEA 3A6NB 4J8WC 3X1SD 2CV5D 3WKJA 1P3BB 4UUZB 3WAAC 1JFIA 4YS3A 1EQZA 4J8WA 3KWQA 2W8SA 3UT9D 3W96D 5AV8D 5AVCD 3MGRA 3AZJA 5AV6A 3AZNB 5AV5C 5AY8A 5GSUC 3TU4D 1KX5B 3O62B 4E45A 5AV9D 3AL0C 1KX3D 5B33B 5B0ZA 3R45A 1P3GD 2Y2QA 1M1AD 3C1CD 5GSUB 4X23A 3C1BA 1P34B 1ZLAD 3AZHA 3X1VC 1M19A 1HQ3C 2Y2KA 3UTAD 1P3OC 3AFAB 4R8PA 4JJNB 3X1UD 3RELB 4WNNA 1HQ3B 4YM6D 3AYWC 1S32A 3MNNA 5FUGA 1P3MA 2F8NK 1F66C 4WU9D 4E44A 4Z66B 1P3FB 4WJ3C 3AYWB 2XD5A 1ULYA 2IO5B 3W97A 5B31A 3LZ1B 5JA4B 3MGPD 3AV1A 3MVDD 5B32C 5B24A 5CPID 3A1KA 3AV2A 2YFWA 5CP6C 3MGQB 3REIB 3UTBC 1U35A 1P3BD 1BH9B 5B2IA 4J8VC 5BT1C 1P3PD 5B0YC 5B1MA 2CWEA 4NE3A 2PYOC 3VH6A 3W98A 2F8NG 5BS7A 3UTBB 5BO0B 2ZY3A 2L5AA 3V9RA 4J8VB 5B0YB 1AOIC 3LJAC 5DNMC 3AZKA 3AN2A 3VH5W 3WTPA 2PYOB 5AVBB 3X1SC 3VH5T 4QLCA
chains in the Genus database with same CATH topology
1ID3B 3KXBA 3O62D 2Y2GA 5DNNB 2FJ7A 5B33D 3AZIB 3W96C 3UT9C 4CAYA 5AV8C 2UWXA 2CV5B 5AVCC 5GT0A 3NQJA 3REKA 2XD1A 1P34D 4KGCB 5G49A 5B1LD 4ZUXB 5AV8B 5CPJB 2NQBA 3TU4C 5B40D 5JRGD 5AV9C 5B32G 1KX3C 3AFAD 4JJND 3RELD 2F2AC 1P3GC 3B0CT 4WU8B 1M1AC 3LZ0A 3C1CC 3LELD 1KX3B 1ZLAC 4Z66D 1P3FD 1M1AB 2ZM5A 3UTAC 2YFVA 1P3KD 3W99D 3X1UC 1KX4D 2G5HC 4XZQD 4YM6C 5F99C 3REJB 3UTAB 3MGQD 3REID 3REHA 4H9QB 4WU9C 3AZLB 2ZY5A 3X1UB 1P3LA 2NZDD 5E5AB 1M18D 4AWLB 1TAFA 2HIOA 3KUYA 3AZGD 2Y2HA 3AZFD 3MGPC 4H9SA 3MVDC 3X1TB 2BYKB 4XUJD 3WA9B 1TZYB 1P3AB 1P3BC 1ID3D 1P3PC 4KUDA 5GXQB 3B6FB 4LD9A 5B2JA 3MVDB 3A6NA 5CPIB 5DNND 2VQRA 3B6GB 3AZID 3AZMA 4UUZA 5CPKA 2RVQD 1P3PB 4H9RA 4H9PB 2AROD 4KGCD 4J8XD 4ZUXD 5CPJD 3AZNC 3WAAA 4DRBA 1KX5C 3B0DC 3O62C 1P3IB 3AZND 3WTPE 4H9OA 5B33C 4WU8D 3MGSB 4Z5TD 1A7WA 3B0DB 2LY8A 1P34C 3AZEB 5AV5A 4G92C 5GSUA 3H0LC 3WKJB 5B40C 1JFIB 4YS3B 3NQUA 1H3OA 3AFAC 5B1LB 4JJNC 4G92B 2Y2MA 3KWQB 4ZBJB 3RELC 2F8NA 1B67A 4KHAA 5BNVB 3REJD 5B40B 5JRGB 1KU5A 5KDMA 3LELC 3X1VA 3MGRB 3AZJB 4NFTA 3AZLD 4EO5B 2JSSA 1HQ3A 3KSYA 5AV6B 4Z66C 1P3FC 5E5AD 4J8UD 5AY8B 1W2EA 1P3OA 2IO5C 3LELB 3LZ1C 3W99C 5B0ZB 3AYWA 3X1TD 1KX4C 3WA9D 4XZQC 1F66A 1TZYD 3LZ1A 4X23B 3MGQC 3REIC 1P3AD 3C1BB 1P3KB 3W99B 5GXQD 2G5IC 3B6FD 1KX4B 1M19B 4XZQB 3B6GD 2NZDC 1M18C 1BH9A 1BFMA 3AZGC 5GT3D 5B32A 3AZFC 3VH6W 4WNNB 4XUJC 5AVBC 5CP6A 2Y2LA 3UTBA 1M18B 2NZDB 4J8VA 1S32B 3MNNB 3AZGB 1P3MB 5B0YA 1ID3C 3AZFB 2PYOA 1P3ID 5AVBA 5DNNC 4XUJB 1BH8A 1HTAA 3AZIC 5BNXA 1AOIA 5B31B 5DNMA 3LJAA 3MGSD 2Y2JA 2AROC 5B24B 4KGCC 3X1SA 3AZED 4J8XC 2CV5A 2HUEC 4ZUXC 2CV5C 4DQYB 3AV2B 5CPJC 3WKJD 5CHLB 1U35B 4YS3D 1EQZD 2AROB 3W96A 3UT9A 5AV8A 4HGAC 4J8XB 2HUEB 5AVCA 4J8WD 3F6TA 3KWQD 3EPHA 4WU8C 3P5JB 3AN2B 3VH5A 3MGRD 3AZJD 4HGAB 4NE5A 5AV6D 3TU4A 4H9NB 4QLCB 4Z5TB 5AV9A 4G91B 5AY8D 1KX3A 1P3GA 2FJ7B 5B0ZD 1M1AA 3C1CA 5GT0B 3REJC 3NQJB 4X23D 2BYMB 1ZLAA 3C1BD 3AZLC 3AZHD 1M19D 3UTAA 2NQBB 5E5AC 4AWLC 4H9QA 3X1UA 4R8PD 5F99A 4YM6A 3X1TC 1WWSA 3WA9C 3LZ0B 4J8UB 1TZYC 1S32D 3MNND 4WU9A 1P3AC 1P3MD 3KFUG 4CSRB 1N1JB 5GXQC 3B6FC 5CPIC 3B6GC 5C3IB 3MGPA 3W97D 5B31D 3MVDA 5CPIA 3AV1D 5B24D 1P3BA 3AV2D 1P3PA 1U35D 5GT3B 5B2ID 3REHB 1P3IC 5B1MD 3W98D 1P3LB 1TAFB 3KUYB 3MGSC 3AN2D 3AZKD 3WTPD 3AZEC 3AZNA 1KX5A 3WKJC 3O62A 4QLCD 4YS3C 3KXBD 1EQZC 4KUDB 5B33A 4LD9B 5B2JB 5B1LC 2FJ7D 3KWQC 4ZBJC 3AZMB 5CPKB 5GT0D 5JRGC 1P34A 1EQZB 3REKD 4H9RB 5B1LA 3MGRC 3AZJC 4J8WB 4EO5C 4Z2MH 5AV6C 5BNVA 5B40A 5JRGA 2NQBD 3WAAB 5AY8C 3AFAA 4JJNA 3RELA 2BG1A 4H9OB 5B0ZC 3A1IA 1F1EA 3EPJA 3LZ0D 3LELA 4X23C 3C1BC 1P3KC 2J8PA 4Z66A 4NE6A 3R45B 3AZHC 5AV5B 1P3FA 1M19C 1P3KA 2RIQA 5JA4A 3W99A 3NQUB 1H3OB 1KX4A 4R8PC 4XZQA 3AZHB 2ZY4A 2F8NB 3MGQA 3REIA 4KHAB 2DQNC 3MNNC 1S32C 1P3MC 5KDMB 3REHD 3X1VB 4R8PB 2JE5A 2NZDA 5F99D 1M18A 3AZGA 5BO0A 1P3LD 3VH6T 5FUGB 2HIOD 3KUYD 3AZFA 1PZRA 5B31C 1P3OB 3W97C 4XUJA 3AV1C 5B24C 1ID3A 3AV2C 1F66B 2RVQC 1U35C 3W97B 5B2IC 3EPKA 5DNNA 4WZSB 4KUDD 3AV1B 5B2JD 5B1MC 3AZIA 4LD9D 3A6ND 1Q9CA 3W98C 2YFWB 1B6WA 5BS7C 3AZMD 5CPKD 2DF4C 3EG5B 5B2IB 2Y2NA 2AROA 5B32B 4KGCA 4J8XA 3AN2C 5B1MB 4ZUXA 3AZKC 3WTPC 5CPJA 3W98B 5CP6B 3WAAD 4QLCC 4Z5TC 4G91C 3V9RB 3KXBC 3AZKB 3WTPB 1BH8B 2FJ7C 4WU8A 4H9NA 3H0RC 4Z5TA 5BNXB 5GT0C 1KX5D 1AOIB 3LJAB 3KXBB 5DNMB 3REKC 3X1SB 5AV5D 4CAYB 5GSUD 2NQBC 2Y2PA 2BYMA 2F8NH 5B31G 4UPKA 3REKB 3UT9B 3W96B 5G49B 5AVCB 3REJA 2F8ND 4WV4B 2Y2OA 3LZ0C 4J8UC 3AZLA 3B0CW 3X1VD 1HQ3D 5E5AA 4J8UA 1R4VA 3TU4B 5AV9B 5C3IC 4CSRA 1N1JA 1P3OD 3X1TA 2BYKA 3WA9A 1P3GB 3AYWD 3C1CB 1TZYA 4M6BA 1P3AA 3B0BA 1F66D 2Y2IA 3LZ1D 1T3UA 5GXQA 1ZLAB 3B6FA 2YFVB 5GT3C 3REHC 3B6GA 3IP4C 1Z2CB 1P3LC 3H0MC 5GT3A 2HIOC 3KUYC 4H9PA 5B32D 4H9SC 4YM6B 5F99B 5CP6D 3UTBD 1WWIA 2FFFB 2HIOB 4DRAA 5BT1D 4J8VD 3FDDA 5B0YD 4WU9B 4Z2MG 1P3IA 4KUDC 4LD9C 5B2JC 2PYOD 5AVBD 3A6NC 3EPLA 3MGSA 2JCHA 2ZY2A 3AZMC 5CPKC 3MGPB 1AOID 3LJAD 5DNMD 3AZEA 3A6NB 4J8WC 3X1SD 2CV5D 3WKJA 1P3BB 4UUZB 3WAAC 1JFIA 4YS3A 1EQZA 4J8WA 3KWQA 2W8SA 3UT9D 3W96D 5AV8D 5AVCD 3MGRA 3AZJA 5AV6A 3AZNB 5AV5C 5AY8A 5GSUC 3TU4D 1KX5B 3O62B 4E45A 5AV9D 3AL0C 1KX3D 5B33B 5B0ZA 3R45A 1P3GD 2Y2QA 1M1AD 3C1CD 5GSUB 4X23A 3C1BA 1P34B 1ZLAD 3AZHA 3X1VC 1M19A 1HQ3C 2Y2KA 3UTAD 1P3OC 3AFAB 4R8PA 4JJNB 3X1UD 3RELB 4WNNA 1HQ3B 4YM6D 3AYWC 1S32A 3MNNA 5FUGA 1P3MA 2F8NK 1F66C 4WU9D 4E44A 4Z66B 1P3FB 4WJ3C 3AYWB 2XD5A 1ULYA 2IO5B 3W97A 5B31A 3LZ1B 5JA4B 3MGPD 3AV1A 3MVDD 5B32C 5B24A 5CPID 3A1KA 3AV2A 2YFWA 5CP6C 3MGQB 3REIB 3UTBC 1U35A 1P3BD 1BH9B 5B2IA 4J8VC 5BT1C 1P3PD 5B0YC 5B1MA 2CWEA 4NE3A 2PYOC 3VH6A 3W98A 2F8NG 5BS7A 3UTBB 5BO0B 2ZY3A 2L5AA 3V9RA 4J8VB 5B0YB 1AOIC 3LJAC 5DNMC 3AZKA 3AN2A 3VH5W 3WTPA 2PYOB 5AVBB 3X1SC 3VH5T 4QLCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ID3 B;  3KXB A;  3O62 D;  5DNN B;  2FJ7 A;  5B33 D;  3AZI B;  3W96 C;  3UT9 C;  4CAY A;  5AV8 C;  2CV5 B;  5AVC C;  5GT0 A;  3NQJ A;  3REK A;  1P34 D;  4KGC B;  5G49 A;  5B1L D;  4ZUX B;  5AV8 B;  5CPJ B;  2NQB A;  3TU4 C;  5B40 D;  5JRG D;  5AV9 C;  5B32 G;  1KX3 C;  3AFA D;  4JJN D;  3REL D;  1P3G C;  3B0C T;  4WU8 B;  1M1A C;  3LZ0 A;  3C1C C;  3LEL D;  1KX3 B;  1ZLA C;  4Z66 D;  1P3F D;  1M1A B;  3UTA C;  2YFV A;  1P3K D;  3W99 D;  3X1U C;  1KX4 D;  4XZQ D;  4YM6 C;  5F99 C;  3REJ B;  3UTA B;  3MGQ D;  3REI D;  3REH A;  4H9Q B;  4WU9 C;  3AZL B;  3X1U B;  1P3L A;  2NZD D;  5E5A B;  1M18 D;  4AWL B;  1TAF A;  2HIO A;  3KUY A;  3AZG D;  3AZF D;  3MGP C;  4H9S A;  3MVD C;  3X1T B;  2BYK B;  4XUJ D;  3WA9 B;  1TZY B;  1P3A B;  1P3B C;  1ID3 D;  1P3P C;  4KUD A;  5GXQ B;  3B6F B;  4LD9 A;  5B2J A;  3MVD B;  3A6N A;  5CPI B;  5DNN D;  3B6G B;  3AZI D;  3AZM A;  4UUZ A;  5CPK A;  2RVQ D;  1P3P B;  4H9R A;  4H9P B;  2ARO D;  4KGC D;  4J8X D;  4ZUX D;  5CPJ D;  3AZN C;  3WAA A;  4DRB A;  1KX5 C;  3B0D C;  3O62 C;  1P3I B;  3AZN D;  3WTP E;  4H9O A;  5B33 C;  4WU8 D;  3MGS B;  4Z5T D;  1A7W A;  3B0D B;  2LY8 A;  1P34 C;  3AZE B;  5AV5 A;  4G92 C;  5GSU A;  3WKJ B;  5B40 C;  1JFI B;  4YS3 B;  3NQU A;  1H3O A;  3AFA C;  5B1L B;  4JJN C;  4G92 B;  3KWQ B;  4ZBJ B;  3REL C;  2F8N A;  1B67 A;  4KHA A;  5BNV B;  3REJ D;  5B40 B;  5JRG B;  1KU5 A;  5KDM A;  3LEL C;  3X1V A;  3MGR B;  3AZJ B;  4NFT A;  3AZL D;  4EO5 B;  2JSS A;  1HQ3 A;  3KSY A;  5AV6 B;  4Z66 C;  1P3F C;  5E5A D;  4J8U D;  5AY8 B;  1P3O A;  2IO5 C;  3LEL B;  3LZ1 C;  3W99 C;  5B0Z B;  3AYW A;  3X1T D;  1KX4 C;  3WA9 D;  4XZQ C;  1F66 A;  1TZY D;  3LZ1 A;  4X23 B;  3MGQ C;  3REI C;  1P3A D;  3C1B B;  1P3K B;  3W99 B;  5GXQ D;  3B6F D;  1KX4 B;  1M19 B;  4XZQ B;  3B6G D;  2NZD C;  1M18 C;  1BH9 A;  1BFM A;  3AZG C;  5GT3 D;  5B32 A;  3AZF C;  3VH6 W;  4WNN B;  4XUJ C;  5AVB C;  5CP6 A;  3UTB A;  2NZD B;  1M18 B;  4J8V A;  1S32 B;  3MNN B;  3AZG B;  1P3M B;  5B0Y A;  1ID3 C;  3AZF B;  2PYO A;  1P3I D;  5AVB A;  5DNN C;  4XUJ B;  1BH8 A;  1HTA A;  3AZI C;  5BNX A;  1AOI A;  5B31 B;  5DNM A;  3LJA A;  3MGS D;  2ARO C;  5B24 B;  4KGC C;  3X1S A;  3AZE D;  4J8X C;  2CV5 A;  2HUE C;  4ZUX C;  2CV5 C;  3AV2 B;  5CPJ C;  3WKJ D;  5CHL B;  1U35 B;  4YS3 D;  1EQZ D;  2ARO B;  3W96 A;  3UT9 A;  5AV8 A;  4HGA C;  4J8X B;  2HUE B;  5AVC A;  4J8W D;  3KWQ D;  4WU8 C;  3AN2 B;  3VH5 A;  3MGR D;  3AZJ D;  4HGA B;  4NE5 A;  5AV6 D;  3TU4 A;  4H9N B;  4QLC B;  4Z5T B;  5AV9 A;  4G91 B;  5AY8 D;  1KX3 A;  1P3G A;  2FJ7 B;  5B0Z D;  1M1A A;  3C1C A;  5GT0 B;  3REJ C;  3NQJ B;  4X23 D;  2BYM B;  1ZLA A;  3C1B D;  3AZL C;  3AZH D;  1M19 D;  3UTA A;  2NQB B;  5E5A C;  4AWL C;  4H9Q A;  3X1U A;  4R8P D;  5F99 A;  4YM6 A;  3X1T C;  1WWS A;  3WA9 C;  3LZ0 B;  4J8U B;  1TZY C;  1S32 D;  3MNN D;  4WU9 A;  1P3A C;  1P3M D;  4CSR B;  1N1J B;  5GXQ C;  3B6F C;  5CPI C;  3B6G C;  5C3I B;  3MGP A;  3W97 D;  5B31 D;  3MVD A;  5CPI A;  3AV1 D;  5B24 D;  1P3B A;  3AV2 D;  1P3P A;  1U35 D;  5GT3 B;  5B2I D;  3REH B;  1P3I C;  5B1M D;  3W98 D;  1P3L B;  1TAF B;  3KUY B;  3MGS C;  3AN2 D;  3AZK D;  3WTP D;  3AZE C;  3AZN A;  1KX5 A;  3WKJ C;  3O62 A;  4QLC D;  4YS3 C;  3KXB D;  1EQZ C;  4KUD B;  5B33 A;  4LD9 B;  5B2J B;  5B1L C;  2FJ7 D;  3KWQ C;  4ZBJ C;  3AZM B;  5CPK B;  5GT0 D;  5JRG C;  1P34 A;  1EQZ B;  3REK D;  4H9R B;  5B1L A;  3MGR C;  3AZJ C;  4J8W B;  4EO5 C;  4Z2M H;  5AV6 C;  5BNV A;  5B40 A;  5JRG A;  2NQB D;  3WAA B;  5AY8 C;  3AFA A;  4JJN A;  3REL A;  4H9O B;  5B0Z C;  1F1E A;  3LZ0 D;  3LEL A;  4X23 C;  3C1B C;  1P3K C;  4Z66 A;  4NE6 A;  3R45 B;  3AZH C;  5AV5 B;  1P3F A;  1M19 C;  1P3K A;  5JA4 A;  3W99 A;  3NQU B;  1H3O B;  1KX4 A;  4R8P C;  4XZQ A;  3AZH B;  2F8N B;  3MGQ A;  3REI A;  4KHA B;  1S32 C;  3MNN C;  1P3M C;  5KDM B;  3REH D;  3X1V B;  4R8P B;  2NZD A;  5F99 D;  1M18 A;  3AZG A;  5BO0 A;  1P3L D;  3VH6 T;  5FUG B;  2HIO D;  3KUY D;  3AZF A;  1P3O B;  5B31 C;  3W97 C;  4XUJ A;  3AV1 C;  5B24 C;  1ID3 A;  3AV2 C;  1F66 B;  2RVQ C;  1U35 C;  3W97 B;  5B2I C;  5DNN A;  4WZS B;  4KUD D;  3AV1 B;  5B2J D;  5B1M C;  3AZI A;  4LD9 D;  3A6N D;  1Q9C A;  3W98 C;  2YFW B;  1B6W A;  5BS7 C;  3AZM D;  5CPK D;  5B2I B;  2ARO A;  5B32 B;  4KGC A;  4J8X A;  3AN2 C;  5B1M B;  4ZUX A;  3AZK C;  3WTP C;  5CPJ A;  3W98 B;  5CP6 B;  3WAA D;  4QLC C;  4Z5T C;  4G91 C;  3V9R B;  3KXB C;  3AZK B;  3WTP B;  1BH8 B;  2FJ7 C;  4WU8 A;  4H9N A;  4Z5T A;  5BNX B;  5GT0 C;  1KX5 D;  1AOI B;  3LJA B;  3KXB B;  5DNM B;  3REK C;  3X1S B;  5AV5 D;  4CAY B;  5GSU D;  2NQB C;  2BYM A;  2F8N H;  5B31 G;  3REK B;  3UT9 B;  3W96 B;  5G49 B;  5AVC B;  3REJ A;  2F8N D;  4WV4 B;  3LZ0 C;  4J8U C;  3AZL A;  3B0C W;  3X1V D;  1HQ3 D;  5E5A A;  4J8U A;  1R4V A;  3TU4 B;  5AV9 B;  5C3I C;  4CSR A;  1N1J A;  1P3O D;  3X1T A;  2BYK A;  3WA9 A;  1P3G B;  3AYW D;  3C1C B;  1TZY A;  4M6B A;  1P3A A;  3B0B A;  1F66 D;  3LZ1 D;  5GXQ A;  1ZLA B;  3B6F A;  2YFV B;  5GT3 C;  3REH C;  3B6G A;  1P3L C;  5GT3 A;  2HIO C;  3KUY C;  4H9P A;  5B32 D;  4H9S C;  4YM6 B;  5F99 B;  5CP6 D;  3UTB D;  1WWI A;  2HIO B;  4DRA A;  5BT1 D;  4J8V D;  4WU9 B;  5B0Y D;  4Z2M G;  1P3I A;  4KUD C;  4LD9 C;  5B2J C;  2PYO D;  5AVB D;  3A6N C;  3AZM C;  3MGS A;  5CPK C;  3MGP B;  1AOI D;  3LJA D;  5DNM D;  3AZE A;  3A6N B;  4J8W C;  3X1S D;  2CV5 D;  3WKJ A;  1P3B B;  4UUZ B;  3WAA C;  1JFI A;  4YS3 A;  1EQZ A;  4J8W A;  3KWQ A;  3UT9 D;  3W96 D;  5AV8 D;  5AVC D;  3MGR A;  3AZJ A;  5AV6 A;  3AZN B;  5AV5 C;  5AY8 A;  5GSU C;  3TU4 D;  1KX5 B;  3O62 B;  4E45 A;  5AV9 D;  1KX3 D;  5B33 B;  5B0Z A;  3R45 A;  1P3G D;  1M1A D;  3C1C D;  5GSU B;  4X23 A;  3C1B A;  1P34 B;  1ZLA D;  3AZH A;  3X1V C;  1M19 A;  1HQ3 C;  3UTA D;  1P3O C;  3AFA B;  4R8P A;  4JJN B;  3X1U D;  3REL B;  4WNN A;  1HQ3 B;  4YM6 D;  3AYW C;  1S32 A;  3MNN A;  5FUG A;  1P3M A;  2F8N K;  1F66 C;  4WU9 D;  4E44 A;  4Z66 B;  1P3F B;  3AYW B;  1ULY A;  2IO5 B;  3W97 A;  5B31 A;  3LZ1 B;  5JA4 B;  3MGP D;  3AV1 A;  3MVD D;  5B32 C;  5B24 A;  5CPI D;  3AV2 A;  2YFW A;  5CP6 C;  3MGQ B;  3REI B;  3UTB C;  1U35 A;  1P3B D;  1BH9 B;  5B2I A;  4J8V C;  5BT1 C;  1P3P D;  5B0Y C;  5B1M A;  2CWE A;  4NE3 A;  2PYO C;  3VH6 A;  3W98 A;  2F8N G;  5BS7 A;  3UTB B;  5BO0 B;  2L5A A;  3V9R A;  4J8V B;  5B0Y B;  1AOI C;  3LJA C;  5DNM C;  3AZK A;  3AN2 A;  3VH5 W;  3WTP A;  2PYO B;  5AVB B;  3X1S C;  3VH5 T;  4QLC A; 
#chains in the Genus database with same CATH topology
 1ID3 B;  3KXB A;  3O62 D;  2Y2G A;  5DNN B;  2FJ7 A;  5B33 D;  3AZI B;  3W96 C;  3UT9 C;  4CAY A;  5AV8 C;  2UWX A;  2CV5 B;  5AVC C;  5GT0 A;  3NQJ A;  3REK A;  2XD1 A;  1P34 D;  4KGC B;  5G49 A;  5B1L D;  4ZUX B;  5AV8 B;  5CPJ B;  2NQB A;  3TU4 C;  5B40 D;  5JRG D;  5AV9 C;  5B32 G;  1KX3 C;  3AFA D;  4JJN D;  3REL D;  2F2A C;  1P3G C;  3B0C T;  4WU8 B;  1M1A C;  3LZ0 A;  3C1C C;  3LEL D;  1KX3 B;  1ZLA C;  4Z66 D;  1P3F D;  1M1A B;  2ZM5 A;  3UTA C;  2YFV A;  1P3K D;  3W99 D;  3X1U C;  1KX4 D;  2G5H C;  4XZQ D;  4YM6 C;  5F99 C;  3REJ B;  3UTA B;  3MGQ D;  3REI D;  3REH A;  4H9Q B;  4WU9 C;  3AZL B;  2ZY5 A;  3X1U B;  1P3L A;  2NZD D;  5E5A B;  1M18 D;  4AWL B;  1TAF A;  2HIO A;  3KUY A;  3AZG D;  2Y2H A;  3AZF D;  3MGP C;  4H9S A;  3MVD C;  3X1T B;  2BYK B;  4XUJ D;  3WA9 B;  1TZY B;  1P3A B;  1P3B C;  1ID3 D;  1P3P C;  4KUD A;  5GXQ B;  3B6F B;  4LD9 A;  5B2J A;  3MVD B;  3A6N A;  5CPI B;  5DNN D;  2VQR A;  3B6G B;  3AZI D;  3AZM A;  4UUZ A;  5CPK A;  2RVQ D;  1P3P B;  4H9R A;  4H9P B;  2ARO D;  4KGC D;  4J8X D;  4ZUX D;  5CPJ D;  3AZN C;  3WAA A;  4DRB A;  1KX5 C;  3B0D C;  3O62 C;  1P3I B;  3AZN D;  3WTP E;  4H9O A;  5B33 C;  4WU8 D;  3MGS B;  4Z5T D;  1A7W A;  3B0D B;  2LY8 A;  1P34 C;  3AZE B;  5AV5 A;  4G92 C;  5GSU A;  3H0L C;  3WKJ B;  5B40 C;  1JFI B;  4YS3 B;  3NQU A;  1H3O A;  3AFA C;  5B1L B;  4JJN C;  4G92 B;  2Y2M A;  3KWQ B;  4ZBJ B;  3REL C;  2F8N A;  1B67 A;  4KHA A;  5BNV B;  3REJ D;  5B40 B;  5JRG B;  1KU5 A;  5KDM A;  3LEL C;  3X1V A;  3MGR B;  3AZJ B;  4NFT A;  3AZL D;  4EO5 B;  2JSS A;  1HQ3 A;  3KSY A;  5AV6 B;  4Z66 C;  1P3F C;  5E5A D;  4J8U D;  5AY8 B;  1W2E A;  1P3O A;  2IO5 C;  3LEL B;  3LZ1 C;  3W99 C;  5B0Z B;  3AYW A;  3X1T D;  1KX4 C;  3WA9 D;  4XZQ C;  1F66 A;  1TZY D;  3LZ1 A;  4X23 B;  3MGQ C;  3REI C;  1P3A D;  3C1B B;  1P3K B;  3W99 B;  5GXQ D;  2G5I C;  3B6F D;  1KX4 B;  1M19 B;  4XZQ B;  3B6G D;  2NZD C;  1M18 C;  1BH9 A;  1BFM A;  3AZG C;  5GT3 D;  5B32 A;  3AZF C;  3VH6 W;  4WNN B;  4XUJ C;  5AVB C;  5CP6 A;  2Y2L A;  3UTB A;  1M18 B;  2NZD B;  4J8V A;  1S32 B;  3MNN B;  3AZG B;  1P3M B;  5B0Y A;  1ID3 C;  3AZF B;  2PYO A;  1P3I D;  5AVB A;  5DNN C;  4XUJ B;  1BH8 A;  1HTA A;  3AZI C;  5BNX A;  1AOI A;  5B31 B;  5DNM A;  3LJA A;  3MGS D;  2Y2J A;  2ARO C;  5B24 B;  4KGC C;  3X1S A;  3AZE D;  4J8X C;  2CV5 A;  2HUE C;  4ZUX C;  2CV5 C;  4DQY B;  3AV2 B;  5CPJ C;  3WKJ D;  5CHL B;  1U35 B;  4YS3 D;  1EQZ D;  2ARO B;  3W96 A;  3UT9 A;  5AV8 A;  4HGA C;  4J8X B;  2HUE B;  5AVC A;  4J8W D;  3F6T A;  3KWQ D;  3EPH A;  4WU8 C;  3P5J B;  3AN2 B;  3VH5 A;  3MGR D;  3AZJ D;  4HGA B;  4NE5 A;  5AV6 D;  3TU4 A;  4H9N B;  4QLC B;  4Z5T B;  5AV9 A;  4G91 B;  5AY8 D;  1KX3 A;  1P3G A;  2FJ7 B;  5B0Z D;  1M1A A;  3C1C A;  5GT0 B;  3REJ C;  3NQJ B;  4X23 D;  2BYM B;  1ZLA A;  3C1B D;  3AZL C;  3AZH D;  1M19 D;  3UTA A;  2NQB B;  5E5A C;  4AWL C;  4H9Q A;  3X1U A;  4R8P D;  5F99 A;  4YM6 A;  3X1T C;  1WWS A;  3WA9 C;  3LZ0 B;  4J8U B;  1TZY C;  1S32 D;  3MNN D;  4WU9 A;  1P3A C;  1P3M D;  3KFU G;  4CSR B;  1N1J B;  5GXQ C;  3B6F C;  5CPI C;  3B6G C;  5C3I B;  3MGP A;  3W97 D;  5B31 D;  3MVD A;  5CPI A;  3AV1 D;  5B24 D;  1P3B A;  3AV2 D;  1P3P A;  1U35 D;  5GT3 B;  5B2I D;  3REH B;  1P3I C;  5B1M D;  3W98 D;  1P3L B;  1TAF B;  3KUY B;  3MGS C;  3AN2 D;  3AZK D;  3WTP D;  3AZE C;  3AZN A;  1KX5 A;  3WKJ C;  3O62 A;  4QLC D;  4YS3 C;  3KXB D;  1EQZ C;  4KUD B;  5B33 A;  4LD9 B;  5B2J B;  5B1L C;  2FJ7 D;  3KWQ C;  4ZBJ C;  3AZM B;  5CPK B;  5GT0 D;  5JRG C;  1P34 A;  1EQZ B;  3REK D;  4H9R B;  5B1L A;  3MGR C;  3AZJ C;  4J8W B;  4EO5 C;  4Z2M H;  5AV6 C;  5BNV A;  5B40 A;  5JRG A;  2NQB D;  3WAA B;  5AY8 C;  3AFA A;  4JJN A;  3REL A;  2BG1 A;  4H9O B;  5B0Z C;  3A1I A;  1F1E A;  3EPJ A;  3LZ0 D;  3LEL A;  4X23 C;  3C1B C;  1P3K C;  2J8P A;  4Z66 A;  4NE6 A;  3R45 B;  3AZH C;  5AV5 B;  1P3F A;  1M19 C;  1P3K A;  2RIQ A;  5JA4 A;  3W99 A;  3NQU B;  1H3O B;  1KX4 A;  4R8P C;  4XZQ A;  3AZH B;  2ZY4 A;  2F8N B;  3MGQ A;  3REI A;  4KHA B;  2DQN C;  3MNN C;  1S32 C;  1P3M C;  5KDM B;  3REH D;  3X1V B;  4R8P B;  2JE5 A;  2NZD A;  5F99 D;  1M18 A;  3AZG A;  5BO0 A;  1P3L D;  3VH6 T;  5FUG B;  2HIO D;  3KUY D;  3AZF A;  1PZR A;  5B31 C;  1P3O B;  3W97 C;  4XUJ A;  3AV1 C;  5B24 C;  1ID3 A;  3AV2 C;  1F66 B;  2RVQ C;  1U35 C;  3W97 B;  5B2I C;  3EPK A;  5DNN A;  4WZS B;  4KUD D;  3AV1 B;  5B2J D;  5B1M C;  3AZI A;  4LD9 D;  3A6N D;  1Q9C A;  3W98 C;  2YFW B;  1B6W A;  5BS7 C;  3AZM D;  5CPK D;  2DF4 C;  3EG5 B;  5B2I B;  2Y2N A;  2ARO A;  5B32 B;  4KGC A;  4J8X A;  3AN2 C;  5B1M B;  4ZUX A;  3AZK C;  3WTP C;  5CPJ A;  3W98 B;  5CP6 B;  3WAA D;  4QLC C;  4Z5T C;  4G91 C;  3V9R B;  3KXB C;  3AZK B;  3WTP B;  1BH8 B;  2FJ7 C;  4WU8 A;  4H9N A;  3H0R C;  4Z5T A;  5BNX B;  5GT0 C;  1KX5 D;  1AOI B;  3LJA B;  3KXB B;  5DNM B;  3REK C;  3X1S B;  5AV5 D;  4CAY B;  5GSU D;  2NQB C;  2Y2P A;  2BYM A;  2F8N H;  5B31 G;  4UPK A;  3REK B;  3UT9 B;  3W96 B;  5G49 B;  5AVC B;  3REJ A;  2F8N D;  4WV4 B;  2Y2O A;  3LZ0 C;  4J8U C;  3AZL A;  3B0C W;  3X1V D;  1HQ3 D;  5E5A A;  4J8U A;  1R4V A;  3TU4 B;  5AV9 B;  5C3I C;  4CSR A;  1N1J A;  1P3O D;  3X1T A;  2BYK A;  3WA9 A;  1P3G B;  3AYW D;  3C1C B;  1TZY A;  4M6B A;  1P3A A;  3B0B A;  1F66 D;  2Y2I A;  3LZ1 D;  1T3U A;  5GXQ A;  1ZLA B;  3B6F A;  2YFV B;  5GT3 C;  3REH C;  3B6G A;  3IP4 C;  1Z2C B;  1P3L C;  3H0M C;  5GT3 A;  2HIO C;  3KUY C;  4H9P A;  5B32 D;  4H9S C;  4YM6 B;  5F99 B;  5CP6 D;  3UTB D;  1WWI A;  2FFF B;  2HIO B;  4DRA A;  5BT1 D;  4J8V D;  3FDD A;  5B0Y D;  4WU9 B;  4Z2M G;  1P3I A;  4KUD C;  4LD9 C;  5B2J C;  2PYO D;  5AVB D;  3A6N C;  3EPL A;  3MGS A;  2JCH A;  2ZY2 A;  3AZM C;  5CPK C;  3MGP B;  1AOI D;  3LJA D;  5DNM D;  3AZE A;  3A6N B;  4J8W C;  3X1S D;  2CV5 D;  3WKJ A;  1P3B B;  4UUZ B;  3WAA C;  1JFI A;  4YS3 A;  1EQZ A;  4J8W A;  3KWQ A;  2W8S A;  3UT9 D;  3W96 D;  5AV8 D;  5AVC D;  3MGR A;  3AZJ A;  5AV6 A;  3AZN B;  5AV5 C;  5AY8 A;  5GSU C;  3TU4 D;  1KX5 B;  3O62 B;  4E45 A;  5AV9 D;  3AL0 C;  1KX3 D;  5B33 B;  5B0Z A;  3R45 A;  1P3G D;  2Y2Q A;  1M1A D;  3C1C D;  5GSU B;  4X23 A;  3C1B A;  1P34 B;  1ZLA D;  3AZH A;  3X1V C;  1M19 A;  1HQ3 C;  2Y2K A;  3UTA D;  1P3O C;  3AFA B;  4R8P A;  4JJN B;  3X1U D;  3REL B;  4WNN A;  1HQ3 B;  4YM6 D;  3AYW C;  1S32 A;  3MNN A;  5FUG A;  1P3M A;  2F8N K;  1F66 C;  4WU9 D;  4E44 A;  4Z66 B;  1P3F B;  4WJ3 C;  3AYW B;  2XD5 A;  1ULY A;  2IO5 B;  3W97 A;  5B31 A;  3LZ1 B;  5JA4 B;  3MGP D;  3AV1 A;  3MVD D;  5B32 C;  5B24 A;  5CPI D;  3A1K A;  3AV2 A;  2YFW A;  5CP6 C;  3MGQ B;  3REI B;  3UTB C;  1U35 A;  1P3B D;  1BH9 B;  5B2I A;  4J8V C;  5BT1 C;  1P3P D;  5B0Y C;  5B1M A;  2CWE A;  4NE3 A;  2PYO C;  3VH6 A;  3W98 A;  2F8N G;  5BS7 A;  3UTB B;  5BO0 B;  2ZY3 A;  2L5A A;  3V9R A;  4J8V B;  5B0Y B;  1AOI C;  3LJA C;  5DNM C;  3AZK A;  3AN2 A;  3VH5 W;  3WTP A;  2PYO B;  5AVB B;  3X1S C;  3VH5 T;  4QLC A; 
#chains in the Genus database with same CATH homology
 1ID3 B;  3KXB A;  3O62 D;  2Y2G A;  5DNN B;  2FJ7 A;  5B33 D;  3AZI B;  3W96 C;  3UT9 C;  4CAY A;  5AV8 C;  2UWX A;  2CV5 B;  5AVC C;  5GT0 A;  3NQJ A;  3REK A;  2XD1 A;  1P34 D;  4KGC B;  5G49 A;  5B1L D;  4ZUX B;  5AV8 B;  5CPJ B;  2NQB A;  3TU4 C;  5B40 D;  5JRG D;  5AV9 C;  5B32 G;  1KX3 C;  3AFA D;  4JJN D;  3REL D;  2F2A C;  1P3G C;  3B0C T;  4WU8 B;  1M1A C;  3LZ0 A;  3C1C C;  3LEL D;  1KX3 B;  1ZLA C;  4Z66 D;  1P3F D;  1M1A B;  2ZM5 A;  3UTA C;  2YFV A;  1P3K D;  3W99 D;  3X1U C;  1KX4 D;  2G5H C;  4XZQ D;  4YM6 C;  5F99 C;  3REJ B;  3UTA B;  3MGQ D;  3REI D;  3REH A;  4H9Q B;  4WU9 C;  3AZL B;  2ZY5 A;  3X1U B;  1P3L A;  2NZD D;  5E5A B;  1M18 D;  4AWL B;  1TAF A;  2HIO A;  3KUY A;  3AZG D;  2Y2H A;  3AZF D;  3MGP C;  4H9S A;  3MVD C;  3X1T B;  2BYK B;  4XUJ D;  3WA9 B;  1TZY B;  1P3A B;  1P3B C;  1ID3 D;  1P3P C;  4KUD A;  5GXQ B;  3B6F B;  4LD9 A;  5B2J A;  3MVD B;  3A6N A;  5CPI B;  5DNN D;  2VQR A;  3B6G B;  3AZI D;  3AZM A;  4UUZ A;  5CPK A;  2RVQ D;  1P3P B;  4H9R A;  4H9P B;  2ARO D;  4KGC D;  4J8X D;  4ZUX D;  5CPJ D;  3AZN C;  3WAA A;  4DRB A;  1KX5 C;  3B0D C;  3O62 C;  1P3I B;  3AZN D;  3WTP E;  4H9O A;  5B33 C;  4WU8 D;  3MGS B;  4Z5T D;  1A7W A;  3B0D B;  2LY8 A;  1P34 C;  3AZE B;  5AV5 A;  4G92 C;  5GSU A;  3H0L C;  3WKJ B;  5B40 C;  1JFI B;  4YS3 B;  3NQU A;  1H3O A;  3AFA C;  5B1L B;  4JJN C;  4G92 B;  2Y2M A;  3KWQ B;  4ZBJ B;  3REL C;  2F8N A;  1B67 A;  4KHA A;  5BNV B;  3REJ D;  5B40 B;  5JRG B;  1KU5 A;  5KDM A;  3LEL C;  3X1V A;  3MGR B;  3AZJ B;  4NFT A;  3AZL D;  4EO5 B;  2JSS A;  1HQ3 A;  3KSY A;  5AV6 B;  4Z66 C;  1P3F C;  5E5A D;  4J8U D;  5AY8 B;  1W2E A;  1P3O A;  2IO5 C;  3LEL B;  3LZ1 C;  3W99 C;  5B0Z B;  3AYW A;  3X1T D;  1KX4 C;  3WA9 D;  4XZQ C;  1F66 A;  1TZY D;  3LZ1 A;  4X23 B;  3MGQ C;  3REI C;  1P3A D;  3C1B B;  1P3K B;  3W99 B;  5GXQ D;  2G5I C;  3B6F D;  1KX4 B;  1M19 B;  4XZQ B;  3B6G D;  2NZD C;  1M18 C;  1BH9 A;  1BFM A;  3AZG C;  5GT3 D;  5B32 A;  3AZF C;  3VH6 W;  4WNN B;  4XUJ C;  5AVB C;  5CP6 A;  2Y2L A;  3UTB A;  1M18 B;  2NZD B;  4J8V A;  1S32 B;  3MNN B;  3AZG B;  1P3M B;  5B0Y A;  1ID3 C;  3AZF B;  2PYO A;  1P3I D;  5AVB A;  5DNN C;  4XUJ B;  1BH8 A;  1HTA A;  3AZI C;  5BNX A;  1AOI A;  5B31 B;  5DNM A;  3LJA A;  3MGS D;  2Y2J A;  2ARO C;  5B24 B;  4KGC C;  3X1S A;  3AZE D;  4J8X C;  2CV5 A;  2HUE C;  4ZUX C;  2CV5 C;  4DQY B;  3AV2 B;  5CPJ C;  3WKJ D;  5CHL B;  1U35 B;  4YS3 D;  1EQZ D;  2ARO B;  3W96 A;  3UT9 A;  5AV8 A;  4HGA C;  4J8X B;  2HUE B;  5AVC A;  4J8W D;  3F6T A;  3KWQ D;  3EPH A;  4WU8 C;  3P5J B;  3AN2 B;  3VH5 A;  3MGR D;  3AZJ D;  4HGA B;  4NE5 A;  5AV6 D;  3TU4 A;  4H9N B;  4QLC B;  4Z5T B;  5AV9 A;  4G91 B;  5AY8 D;  1KX3 A;  1P3G A;  2FJ7 B;  5B0Z D;  1M1A A;  3C1C A;  5GT0 B;  3REJ C;  3NQJ B;  4X23 D;  2BYM B;  1ZLA A;  3C1B D;  3AZL C;  3AZH D;  1M19 D;  3UTA A;  2NQB B;  5E5A C;  4AWL C;  4H9Q A;  3X1U A;  4R8P D;  5F99 A;  4YM6 A;  3X1T C;  1WWS A;  3WA9 C;  3LZ0 B;  4J8U B;  1TZY C;  1S32 D;  3MNN D;  4WU9 A;  1P3A C;  1P3M D;  3KFU G;  4CSR B;  1N1J B;  5GXQ C;  3B6F C;  5CPI C;  3B6G C;  5C3I B;  3MGP A;  3W97 D;  5B31 D;  3MVD A;  5CPI A;  3AV1 D;  5B24 D;  1P3B A;  3AV2 D;  1P3P A;  1U35 D;  5GT3 B;  5B2I D;  3REH B;  1P3I C;  5B1M D;  3W98 D;  1P3L B;  1TAF B;  3KUY B;  3MGS C;  3AN2 D;  3AZK D;  3WTP D;  3AZE C;  3AZN A;  1KX5 A;  3WKJ C;  3O62 A;  4QLC D;  4YS3 C;  3KXB D;  1EQZ C;  4KUD B;  5B33 A;  4LD9 B;  5B2J B;  5B1L C;  2FJ7 D;  3KWQ C;  4ZBJ C;  3AZM B;  5CPK B;  5GT0 D;  5JRG C;  1P34 A;  1EQZ B;  3REK D;  4H9R B;  5B1L A;  3MGR C;  3AZJ C;  4J8W B;  4EO5 C;  4Z2M H;  5AV6 C;  5BNV A;  5B40 A;  5JRG A;  2NQB D;  3WAA B;  5AY8 C;  3AFA A;  4JJN A;  3REL A;  2BG1 A;  4H9O B;  5B0Z C;  3A1I A;  1F1E A;  3EPJ A;  3LZ0 D;  3LEL A;  4X23 C;  3C1B C;  1P3K C;  2J8P A;  4Z66 A;  4NE6 A;  3R45 B;  3AZH C;  5AV5 B;  1P3F A;  1M19 C;  1P3K A;  2RIQ A;  5JA4 A;  3W99 A;  3NQU B;  1H3O B;  1KX4 A;  4R8P C;  4XZQ A;  3AZH B;  2ZY4 A;  2F8N B;  3MGQ A;  3REI A;  4KHA B;  2DQN C;  3MNN C;  1S32 C;  1P3M C;  5KDM B;  3REH D;  3X1V B;  4R8P B;  2JE5 A;  2NZD A;  5F99 D;  1M18 A;  3AZG A;  5BO0 A;  1P3L D;  3VH6 T;  5FUG B;  2HIO D;  3KUY D;  3AZF A;  1PZR A;  5B31 C;  1P3O B;  3W97 C;  4XUJ A;  3AV1 C;  5B24 C;  1ID3 A;  3AV2 C;  1F66 B;  2RVQ C;  1U35 C;  3W97 B;  5B2I C;  3EPK A;  5DNN A;  4WZS B;  4KUD D;  3AV1 B;  5B2J D;  5B1M C;  3AZI A;  4LD9 D;  3A6N D;  1Q9C A;  3W98 C;  2YFW B;  1B6W A;  5BS7 C;  3AZM D;  5CPK D;  2DF4 C;  3EG5 B;  5B2I B;  2Y2N A;  2ARO A;  5B32 B;  4KGC A;  4J8X A;  3AN2 C;  5B1M B;  4ZUX A;  3AZK C;  3WTP C;  5CPJ A;  3W98 B;  5CP6 B;  3WAA D;  4QLC C;  4Z5T C;  4G91 C;  3V9R B;  3KXB C;  3AZK B;  3WTP B;  1BH8 B;  2FJ7 C;  4WU8 A;  4H9N A;  3H0R C;  4Z5T A;  5BNX B;  5GT0 C;  1KX5 D;  1AOI B;  3LJA B;  3KXB B;  5DNM B;  3REK C;  3X1S B;  5AV5 D;  4CAY B;  5GSU D;  2NQB C;  2Y2P A;  2BYM A;  2F8N H;  5B31 G;  4UPK A;  3REK B;  3UT9 B;  3W96 B;  5G49 B;  5AVC B;  3REJ A;  2F8N D;  4WV4 B;  2Y2O A;  3LZ0 C;  4J8U C;  3AZL A;  3B0C W;  3X1V D;  1HQ3 D;  5E5A A;  4J8U A;  1R4V A;  3TU4 B;  5AV9 B;  5C3I C;  4CSR A;  1N1J A;  1P3O D;  3X1T A;  2BYK A;  3WA9 A;  1P3G B;  3AYW D;  3C1C B;  1TZY A;  4M6B A;  1P3A A;  3B0B A;  1F66 D;  2Y2I A;  3LZ1 D;  1T3U A;  5GXQ A;  1ZLA B;  3B6F A;  2YFV B;  5GT3 C;  3REH C;  3B6G A;  3IP4 C;  1Z2C B;  1P3L C;  3H0M C;  5GT3 A;  2HIO C;  3KUY C;  4H9P A;  5B32 D;  4H9S C;  4YM6 B;  5F99 B;  5CP6 D;  3UTB D;  1WWI A;  2FFF B;  2HIO B;  4DRA A;  5BT1 D;  4J8V D;  3FDD A;  5B0Y D;  4WU9 B;  4Z2M G;  1P3I A;  4KUD C;  4LD9 C;  5B2J C;  2PYO D;  5AVB D;  3A6N C;  3EPL A;  3MGS A;  2JCH A;  2ZY2 A;  3AZM C;  5CPK C;  3MGP B;  1AOI D;  3LJA D;  5DNM D;  3AZE A;  3A6N B;  4J8W C;  3X1S D;  2CV5 D;  3WKJ A;  1P3B B;  4UUZ B;  3WAA C;  1JFI A;  4YS3 A;  1EQZ A;  4J8W A;  3KWQ A;  2W8S A;  3UT9 D;  3W96 D;  5AV8 D;  5AVC D;  3MGR A;  3AZJ A;  5AV6 A;  3AZN B;  5AV5 C;  5AY8 A;  5GSU C;  3TU4 D;  1KX5 B;  3O62 B;  4E45 A;  5AV9 D;  3AL0 C;  1KX3 D;  5B33 B;  5B0Z A;  3R45 A;  1P3G D;  2Y2Q A;  1M1A D;  3C1C D;  5GSU B;  4X23 A;  3C1B A;  1P34 B;  1ZLA D;  3AZH A;  3X1V C;  1M19 A;  1HQ3 C;  2Y2K A;  3UTA D;  1P3O C;  3AFA B;  4R8P A;  4JJN B;  3X1U D;  3REL B;  4WNN A;  1HQ3 B;  4YM6 D;  3AYW C;  1S32 A;  3MNN A;  5FUG A;  1P3M A;  2F8N K;  1F66 C;  4WU9 D;  4E44 A;  4Z66 B;  1P3F B;  4WJ3 C;  3AYW B;  2XD5 A;  1ULY A;  2IO5 B;  3W97 A;  5B31 A;  3LZ1 B;  5JA4 B;  3MGP D;  3AV1 A;  3MVD D;  5B32 C;  5B24 A;  5CPI D;  3A1K A;  3AV2 A;  2YFW A;  5CP6 C;  3MGQ B;  3REI B;  3UTB C;  1U35 A;  1P3B D;  1BH9 B;  5B2I A;  4J8V C;  5BT1 C;  1P3P D;  5B0Y C;  5B1M A;  2CWE A;  4NE3 A;  2PYO C;  3VH6 A;  3W98 A;  2F8N G;  5BS7 A;  3UTB B;  5BO0 B;  2ZY3 A;  2L5A A;  3V9R A;  4J8V B;  5B0Y B;  1AOI C;  3LJA C;  5DNM C;  3AZK A;  3AN2 A;  3VH5 W;  3WTP A;  2PYO B;  5AVB B;  3X1S C;  3VH5 T;  4QLC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...