3UT9B

Crystal structure of nucleosome core particle assembled with a palindromic widom '601' derivative (ncp-601l)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
79
structure length
79
Chain Sequence
b'DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title The mechanics behind DNA sequence-dependent properties of the nucleosome
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 29
structure length 79
sequence length 79
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3ut9B00
5AV6D 5AV9A 3MGQD 1P3ID 3NQUB 3NQUA 3REKD 5GSUB 5AV9D 4DRBA 5DNNC 1ID3B 4XUJC 5AV8B 1ID3A 5AV8A 4H9NB 4H9NA 1ZLAC 3W96C 3MNNB 3MNNA 2HIOC 4G92C 3TU4C 1KX3B 3LZ1D 3AYWC 1KX3A 5AV8D 3X1UC 3UTBC 4QLCC 5B32C 1TAFB 4J8VD 1TAFA 2F8NB 2F8NA 5AVBD 1S32C 1WWSA 3W99B 5AVCB 3LZ0B 1P3KD 5AVCA 3LZ0A 3W99A 5GT0D 3WAAD 5CHLB 3AV1A 5GXQD 2FJ7C 4JJNC 5JA4B 2AROC 5JA4A 3LELB 3AV1D 5B40D 3B6GB 3B6GA 3R45B 3R45A 4KHAA 5DNMB 5DNMA 3AZFD 5B33D 3X1SB 4UUZA 4HGAB 3X1SA 5AV5B 4XZQC 5AV5A 2BYMB 2BYMA 3W98B 3W98A 2IO5C 3WTPE 4H9SA 3W96B 3W96A 4EO5C 2HUEB 5DNND 4LD9C 4XUJD 3X1UB 3AYWA 4QLCB 3X1UA 1P3MC 4QLCA 5B32B 5B32A 1ZLAD 1BH9B 1BH9A 2HIOD 3TU4D 3AYWD 3KWQC 3X1UD 3UTBD 4QLCD 3A6NB 5B32D 3A6NA 2YFWB 2YFWA 3KUYB 3AZIC 1P3OD 3W97C 2AROB 1S32D 2AROA 3AV2C 5CPJC 4WV4B 5BS7C 2F8NK 5FUGB 3WA9B 5FUGA 3WA9A 2FJ7D 4JJND 1P3BC 2F8NG 5B0ZC 2PYOC 4XZQB 3UT9B 4XZQA 3UT9A 5B24B 4J8WB 5B24A 3WTPC 4J8WA 4WU8C 1F66B 3NQJB 3RELC 1F66A 3NQJA 4XZQD 4WU9B 4WU9A 5B2JC 5BNVA 5KDMB 4EO5B 5KDMA 4LD9B 2NQBC 4LD9A 3MGSB 5E5AC 3MGSA 3KXBB 3KXBA 1AOIB 3X1TB 1AOIA 3X1TA 4LD9D 3KSYA 5GSUC 1P3MD 1KX4B 1KX4A 1ID3C 3LJAB 3LJAA 3REHC 4DRAA 3MNNC 3KWQD 3AZJB 3AV2A 3AZJA 1KX3C 4KUDB 4KUDA 3AZID 4H9QB 2RVQC 1P34C 3W97D 3AV2D 4Z5TB 4Z5TA 5B0ZB 5CPJD 5B0ZA 2PYOB 2PYOA 3W99C 5AVCC 3LZ0C 1P3BD 1M19C 2PYOD 3LELC 3X1VC 3WTPD 4WU8D 3B6GC 3MGPB 3MGPA 3REJB 3REJA 3RELD 5DNMC 3AFAB 5E5AB 4NE6A 3AFAA 5E5AA 3X1SC 4ZBJB 5B2JD 4HGAC 5AV5C 2NQBD 5B2IB 5B2IA 4R8PB 3C1BC 5GSUA 4R8PA 5B0YB 5CPKB 3W98C 5B0YA 5CPKA 3REHB 4H9SC 3REHA 4Z2MG 5GSUD 1HTAA 2HUEC 4KGCB 1ID3D 4KGCA 3REHD 1P34B 1P34A 3MNND 1KX3D 2RVQD 3A6NC 1P34D 3KUYC 2F8ND 1M19B 1M19A 3W99D 5AVCD 3LZ0D 3LELA 3REIC 3X1VB 3WA9C 3X1VA 3VH6A 5AY8B 5AY8A 3LELD 3WKJC 4Z66B 3X1VD 4Z66A 3B6GD 3UT9C 5B24C 1JFIB 4J8WC 5CPIC 5DNMD 4J8UB 5B1MC 3C1BB 4J8UA 3C1BA 4J8XC 1JFIA 3AZEC 1EQZB 1F66C 1EQZA 3X1SD 5AV5D 1P3AB 1M18B 4WU9C 1P3AA 1M18A 3C1BD 3W98D 1KX5B 3MGSC 1KX5A 5F99C 4E44A 3KXBC 4H9OB 3W96D 4H9OA 1AOIC 5B1LB 5GT3C 3X1TC 5B1LA 3O62B 3O62A 1WWIA 3AZKB 3AZKA 1KX4C 3LJAC 3KUYA 3REIB 3AZJC 3REIA 3A6ND 4KUDC 3KUYD 1TZYC 4ZUXB 4ZUXA 3AZNB 2F8NH 3AZNA 2AROD 3REID 3WKJB 2YFVB 4Z5TC 3WKJA 2YFVA 1U35C 5JRGC 3WA9D 1N1JB 1N1JA 4AWLB 5CPIB 5B1MB 5CPIA 5B1MA 4J8XB 4J8XA 3MVDC 5CP6B 3AZEB 3AZEA 5CP6A 3WKJD 4YM6B 4YM6A 3UT9D 3AZLB 5B24D 4J8WD 3AZLA 5CPID 3C1CB 5B1MD 3MGPC 3C1CA 3REJC 3AZED 1F66D 3AFAC 5F99B 5F99A 4WU9D 4ZBJC 5GT3B 5GT3A 5B2IC 4WZSB 4R8PC 3MGSD 3UTAB 5C3IB 5B0YC 4NE3A 3KXBD 3UTAA 5CPKC 2NZDA 2NZDB 1AOID 5GT3D 3X1TD 5BO0B 5BT1C 5BO0A 1KX4D 4KGCC 3LJAD 1TZYB 1TZYA 4H9QA 3AN2B 3AN2A 3AZJD 1P3GC 1U35B 4KUDD 3AZGB 5JRGB 1U35A 3AZGA 1ULYA 1TZYD 5JRGA 1KU5A 4M6BA 4Z5TD 3MVDB 2CV5B 3MVDA 5B0ZD 1U35D 3LZ1C 2CV5A 5JRGD 1P3LB 1P3LA 1BFMA 1P3FB 1P3FA 3AZHB 5AY8C 3AZHA 2L5AA 3B6FC 1M1AB 4Z66C 1M1AA 3MGPD 2LY8A 3REJD 3AZMB 3AZMA 4J8UC 3AFAD 5E5AD 4WNNB 4WNNA 4Z2MH 1EQZC 4X23C 1P3AC 1M18C 5B2ID 4R8PD 5AV6B 5AV6A 1B6WA 2BYKB 5BNXB 5BNXA 2BYKA 5B0YD 3MGQA 3MGQB 3B0DB 5CPKD 1P3IA 1P3IB 1KX5C 1A7WA 5BT1D 3REKB 5B1LC 5AV9B 3REKA 3O62C 1P3GB 1P3GA 4KGCD 3AZKC 1P3GD 3LZ1B 3LZ1A 5B31C 4J8VB 4J8VA 4ZUXC 5AVBB 5AVBA 3AZNC 1M19D 3VH5T 1P3KB 1P3KA 3B6FB 5GT0B 3B6FA 5GT0A 3WAAB 3WAAA 1P3OC 4H9PB 4H9PA 5GXQB 4AWLC 5GXQA 5AY8D 5CP6C 3B6FD 4YM6C 4Z66D 4X23B 3AV1B 1R4VA 5B40B 4X23A 5B40A 4NE5A 3AZLC 3C1CC 4J8UD 3AZFB 5B33B 3AZFA 1EQZD 4H9RB 5B33A 4H9RA 3MGRC 4X23D 1B67A 1P3AD 1M18D 4KHAB 4G91C 1BH8B 1BH8A 1F1EA 4UUZB 1KX5D 3UTAC 5C3IC 2NZDC 4CSRB 4CSRA 3VH5W 5B1LD 5DNNB 3O62D 5DNNA 4XUJB 3AZKD 4XUJA 5B31B 5B31A 1H3OB 1H3OA 1ZLAB 1ZLAA 2HIOB 4G92B 3TU4B 2HIOA 1Q9CA 3TU4A 3AYWB 3AN2C 3UTBB 5B31D 3UTBA 3AZGC 4NFTA 1P3OB 1P3OA 1P3PC 4ZUXD 3AZND 1S32B 1S32A 1P3LC 2CV5C 4YS3C 2FJ7B 4JJNB 2FJ7A 4JJNA 4J8XD 1P3FC 5CP6D 2JSSA 3AZHC 3MGRB 4YM6D 3MGRA 1HQ3C 4E45A 3AZLD 1M1AC 3C1CD 4G91B 3AZMC 3MGRD 5F99D 5AV6C 2IO5B 3UTAD 3MGQC 1P3IC 2NZDD 3B0DC 5BNVB 3VH6T 3REKC 5AV9C 1P3MB 1P3MA 3VH5A 1P3PB 3B0CT 1P3PA 3AN2D 3KWQB 3KWQA 4CAYB 4CAYA 4YS3B 3AZGD 4YS3A 3AZIB 5AV8C 3AZIA 1P3PD 4J8VC 5B31G 3W97B 3W97A 5AVBC 3AV2B 3MVDD 1P3LD 2CV5D 4YS3D 5CPJB 3B0BA 3V9RB 5BS7A 3V9RA 5CPJA 1HQ3B 1P3KC 1HQ3A 5GT0C 3WAAC 1P3BB 5B32G 1P3BA 5GXQC 1P3FD 3AZHD 2CWEA 5G49B 5G49A 1HQ3D 3VH6W 1M1AD 3WTPB 4WU8B 3AV1C 3WTPA 4WU8A 5B40C 3AZMD 3RELB 3RELA 3B0CW 3AZFC 5B33C 5B2JB 5B2JA 2NQBB 2NQBA
chains in the Genus database with same CATH superfamily
5AV6D 5AV9A 3MGQD 1P3ID 3NQUB 2XD5A 3NQUA 3REKD 5GSUB 5AV9D 4DRBA 5DNNC 1ID3B 4XUJC 5AV8B 1ID3A 5AV8A 4H9NB 4H9NA 1ZLAC 3W96C 3MNNB 3MNNA 2HIOC 4G92C 3TU4C 1KX3B 3LZ1D 3AYWC 1KX3A 5AV8D 3X1UC 3UTBC 4QLCC 5B32C 1TAFB 4J8VD 1TAFA 2F8NB 2F8NA 5AVBD 1S32C 1WWSA 3W99B 5AVCB 3LZ0B 1P3KD 5AVCA 3LZ0A 3W99A 5GT0D 3WAAD 5CHLB 3AV1A 5GXQD 2FJ7C 4JJNC 5JA4B 2AROC 5JA4A 3LELB 3AV1D 5B40D 3B6GB 3B6GA 3R45B 3R45A 4KHAA 5DNMB 5DNMA 3AZFD 5B33D 3X1SB 4UUZA 4HGAB 3X1SA 5AV5B 4XZQC 5AV5A 2BYMB 2BYMA 3W98B 3FDDA 3W98A 2IO5C 3WTPE 4H9SA 3W96B 3W96A 4EO5C 2HUEB 5DNND 4LD9C 3AL0C 4XUJD 3X1UB 3AYWA 4QLCB 3X1UA 1P3MC 4QLCA 5B32B 5B32A 1ZLAD 1BH9B 1BH9A 2HIOD 3TU4D 3AYWD 3KWQC 3X1UD 3UTBD 4QLCD 3A6NB 5B32D 3A6NA 2YFWB 2YFWA 3F6TA 3KUYB 3AZIC 1P3OD 3W97C 2AROB 1S32D 2AROA 3AV2C 4UPKA 5CPJC 4WV4B 5BS7C 2F8NK 5FUGB 3WA9B 5FUGA 3WA9A 2FJ7D 4JJND 1P3BC 2F8NG 5B0ZC 2PYOC 4XZQB 3UT9B 4XZQA 3UT9A 5B24B 4J8WB 5B24A 3WTPC 4J8WA 4WU8C 1F66B 3NQJB 3RELC 1F66A 3NQJA 4XZQD 4WU9B 4WU9A 5B2JC 5BNVA 5KDMB 4EO5B 5KDMA 4LD9B 2NQBC 4LD9A 3MGSB 5E5AC 3MGSA 1PZRA 3KXBB 3A1IA 3KXBA 2RIQA 2FFFB 3X1TB 1AOIB 1AOIA 3X1TA 4LD9D 3KSYA 5GSUC 1P3MD 1KX4B 1KX4A 1ID3C 3LJAB 3LJAA 3REHC 2F2AC 2DQNC 4DRAA 3MNNC 3KWQD 3AZJB 3IP4C 3AZJA 3AV2A 1KX3C 4KUDB 4KUDA 3AZID 4H9QB 2RVQC 1P34C 3W97D 3AV2D 4Z5TB 4Z5TA 2JCHA 5B0ZB 5CPJD 5B0ZA 2PYOB 2PYOA 2Y2QA 3W99C 5AVCC 3LZ0C 1P3BD 1M19C 2PYOD 3LELC 3X1VC 3WTPD 4WU8D 3B6GC 3MGPB 3MGPA 3REJB 3REJA 3RELD 5DNMC 3AFAB 5E5AB 4NE6A 3AFAA 5E5AA 3X1SC 4ZBJB 5B2JD 4HGAC 5AV5C 2NQBD 5B2IB 5B2IA 2ZY2A 4R8PB 3C1BC 5GSUA 4R8PA 5B0YB 5CPKB 3W98C 5B0YA 5CPKA 3REHB 4H9SC 3REHA 4Z2MG 5GSUD 1HTAA 2HUEC 4KGCB 1ID3D 4KGCA 3REHD 1P34B 1P34A 3MNND 1KX3D 2RVQD 3A6NC 1P34D 3KUYC 2F8ND 1M19B 1M19A 2Y2NA 3W99D 5AVCD 3LZ0D 3LELA 3REIC 3X1VB 3WA9C 3X1VA 3VH6A 5AY8B 1JFIB 5AY8A 3LELD 3WKJC 4Z66B 3X1VD 4Z66A 3B6GD 3UT9C 2Y2HA 5B24C 3A1KA 4J8WC 5CPIC 5DNMD 4J8UB 5B1MC 3C1BB 4J8UA 3C1BA 4J8XC 1JFIA 3AZEC 1EQZB 1F66C 1EQZA 3X1SD 2G5HC 5AV5D 1P3AB 1M18B 3H0LC 4WU9C 1P3AA 1M18A 3C1BD 3W98D 1KX5B 2ZY3A 3MGSC 1KX5A 5F99C 3KFUG 4E44A 3KXBC 4H9OB 3W96D 4H9OA 1AOIC 5B1LB 5GT3C 3X1TC 5B1LA 3O62B 4WJ3C 3O62A 1WWIA 1Z2CB 3AZKB 3AZKA 1KX4C 3LJAC 3KUYA 3REIB 3AZJC 4DQYB 3REIA 3A6ND 4KUDC 3KUYD 1TZYC 4ZUXB 4ZUXA 3AZNB 2F8NH 3AZNA 2AROD 3REID 3WKJB 2YFVB 4Z5TC 3WKJA 2YFVA 1U35C 1T3UA 5JRGC 3WA9D 1N1JB 1N1JA 4AWLB 5CPIB 5B1MB 5CPIA 5B1MA 4J8XB 4J8XA 3MVDC 5CP6B 3AZEB 3AZEA 5CP6A 3WKJD 4YM6B 4YM6A 3UT9D 3AZLB 5B24D 4J8WD 3AZLA 5CPID 3C1CB 5B1MD 3MGPC 3C1CA 2Y2LA 3REJC 3AZED 1F66D 3AFAC 5F99B 5F99A 4WU9D 4ZBJC 5GT3B 5GT3A 5B2IC 3EPHA 4WZSB 4R8PC 3MGSD 3UTAB 5C3IB 5B0YC 4NE3A 3KXBD 3UTAA 5CPKC 2NZDA 2NZDB 1AOID 5GT3D 3X1TD 5BO0B 5BT1C 3EPKA 5BO0A 1KX4D 4KGCC 3LJAD 1TZYB 1TZYA 4H9QA 3AN2B 3AN2A 3AZJD 1P3GC 1U35B 4KUDD 2XD1A 5JRGB 3AZGB 3AZGA 1ULYA 1TZYD 5JRGA 1U35A 3H0RC 1KU5A 4M6BA 4Z5TD 3MVDB 2CV5B 3MVDA 5B0ZD 1U35D 3LZ1C 2CV5A 5JRGD 1P3LB 1P3LA 1BFMA 1P3FB 2UWXA 1P3FA 3AZHB 5AY8C 3AZHA 2L5AA 3B6FC 1M1AB 4Z66C 1M1AA 3MGPD 2LY8A 3REJD 3AZMB 2DF4C 3AZMA 4J8UC 3AFAD 5E5AD 4WNNB 4WNNA 4Z2MH 1EQZC 2BG1A 2G5IC 4X23C 1P3AC 1M18C 2Y2JA 5B2ID 4R8PD 5AV6B 5AV6A 1B6WA 2BYKB 5BNXB 5BNXA 2BYKA 5B0YD 3MGQA 3MGQB 3B0DB 5CPKD 1P3IA 1P3IB 1KX5C 1A7WA 5BT1D 2Y2MA 3REKB 5B1LC 3P5JB 5AV9B 3REKA 3O62C 1P3GB 1P3GA 4KGCD 3AZKC 1P3GD 3LZ1B 3LZ1A 5B31C 2Y2IA 4J8VB 2Y2GA 4J8VA 4ZUXC 5AVBB 5AVBA 3AZNC 1M19D 3VH5T 1P3KB 1P3KA 3B6FB 5GT0B 3B6FA 5GT0A 3WAAB 3WAAA 1P3OC 2ZM5A 4H9PB 4H9PA 5GXQB 4AWLC 5GXQA 5AY8D 5CP6C 3B6FD 4YM6C 4Z66D 4X23B 3AV1B 1R4VA 5B40B 2VQRA 5B40A 4X23A 4NE5A 3AZLC 3C1CC 4J8UD 2Y2KA 3AZFB 5B33B 3AZFA 1EQZD 4H9RB 5B33A 4H9RA 3EPLA 3MGRC 4X23D 1B67A 1P3AD 1M18D 4KHAB 4G91C 1BH8B 1BH8A 1F1EA 4UUZB 1KX5D 3UTAC 5C3IC 2NZDC 1W2EA 4CSRB 4CSRA 3VH5W 5B1LD 5DNNB 3O62D 5DNNA 4XUJB 3H0MC 3AZKD 4XUJA 5B31B 5B31A 1H3OB 2Y2OA 1H3OA 1ZLAB 1ZLAA 2W8SA 2HIOB 4G92B 3TU4B 2HIOA 2ZY4A 1Q9CA 3TU4A 3AYWB 3AN2C 3UTBB 5B31D 3UTBA 3AZGC 4NFTA 1P3OB 1P3OA 1P3PC 4ZUXD 2Y2PA 3AZND 1S32B 1S32A 1P3LC 2CV5C 4YS3C 2FJ7B 4JJNB 2FJ7A 4JJNA 4J8XD 1P3FC 5CP6D 2JSSA 3AZHC 3MGRB 4YM6D 3MGRA 1HQ3C 4E45A 3AZLD 1M1AC 3C1CD 4G91B 3AZMC 3MGRD 3EG5B 5F99D 5AV6C 2IO5B 3UTAD 3MGQC 1P3IC 2NZDD 3B0DC 5BNVB 2J8PA 3VH6T 3REKC 5AV9C 1P3MB 1P3MA 3VH5A 1P3PB 3B0CT 1P3PA 3AN2D 3KWQB 3KWQA 4CAYB 4CAYA 4YS3B 3AZGD 4YS3A 3AZIB 5AV8C 3AZIA 1P3PD 4J8VC 5B31G 3W97B 3W97A 5AVBC 3AV2B 3MVDD 1P3LD 2CV5D 4YS3D 5CPJB 3B0BA 3V9RB 5BS7A 3V9RA 5CPJA 1HQ3B 1P3KC 1HQ3A 5GT0C 3WAAC 2ZY5A 1P3BB 5B32G 1P3BA 5GXQC 1P3FD 3AZHD 2CWEA 5G49B 5G49A 1HQ3D 3VH6W 1M1AD 3WTPB 4WU8B 3EPJA 3WTPA 4WU8A 5B40C 3AV1C 3AZMD 3RELB 3RELA 3B0CW 3AZFC 5B33C 5B2JB 5B2JA 2NQBB 2NQBA 2JE5A
chains in the Genus database with same CATH topology
5AV6D 5AV9A 3MGQD 1P3ID 3NQUB 2XD5A 3NQUA 3REKD 5GSUB 5AV9D 4DRBA 5DNNC 1ID3B 4XUJC 5AV8B 1ID3A 5AV8A 4H9NB 4H9NA 1ZLAC 3W96C 3MNNB 3MNNA 2HIOC 4G92C 3TU4C 1KX3B 3LZ1D 3AYWC 1KX3A 5AV8D 3X1UC 3UTBC 4QLCC 5B32C 1TAFB 4J8VD 1TAFA 2F8NB 2F8NA 5AVBD 1S32C 1WWSA 3W99B 5AVCB 3LZ0B 1P3KD 5AVCA 3LZ0A 3W99A 5GT0D 3WAAD 5CHLB 3AV1A 5GXQD 2FJ7C 4JJNC 5JA4B 2AROC 5JA4A 3LELB 3AV1D 5B40D 3B6GB 3B6GA 3R45B 3R45A 4KHAA 5DNMB 5DNMA 3AZFD 5B33D 3X1SB 4UUZA 4HGAB 3X1SA 5AV5B 4XZQC 5AV5A 2BYMB 2BYMA 3W98B 3FDDA 3W98A 2IO5C 3WTPE 4H9SA 3W96B 3W96A 4EO5C 2HUEB 5DNND 4LD9C 3AL0C 4XUJD 3X1UB 3AYWA 4QLCB 3X1UA 1P3MC 4QLCA 5B32B 5B32A 1ZLAD 1BH9B 1BH9A 2HIOD 3TU4D 3AYWD 3KWQC 3X1UD 3UTBD 4QLCD 3A6NB 5B32D 3A6NA 2YFWB 2YFWA 3F6TA 3KUYB 3AZIC 1P3OD 3W97C 2AROB 1S32D 2AROA 3AV2C 4UPKA 5CPJC 4WV4B 5BS7C 2F8NK 5FUGB 3WA9B 5FUGA 3WA9A 2FJ7D 4JJND 1P3BC 2F8NG 5B0ZC 2PYOC 4XZQB 3UT9B 4XZQA 3UT9A 5B24B 4J8WB 5B24A 3WTPC 4J8WA 4WU8C 1F66B 3NQJB 3RELC 1F66A 3NQJA 4XZQD 4WU9B 4WU9A 5B2JC 5BNVA 5KDMB 4EO5B 5KDMA 4LD9B 2NQBC 4LD9A 3MGSB 5E5AC 3MGSA 1PZRA 3KXBB 3A1IA 3KXBA 2RIQA 2FFFB 3X1TB 1AOIB 1AOIA 3X1TA 4LD9D 3KSYA 5GSUC 1P3MD 1KX4B 1KX4A 1ID3C 3LJAB 3LJAA 3REHC 2F2AC 2DQNC 4DRAA 3MNNC 3KWQD 3AZJB 3IP4C 3AZJA 3AV2A 1KX3C 4KUDB 4KUDA 3AZID 4H9QB 2RVQC 1P34C 3W97D 3AV2D 4Z5TB 4Z5TA 2JCHA 5B0ZB 5CPJD 5B0ZA 2PYOB 2PYOA 2Y2QA 3W99C 5AVCC 3LZ0C 1P3BD 1M19C 2PYOD 3LELC 3X1VC 3WTPD 4WU8D 3B6GC 3MGPB 3MGPA 3REJB 3REJA 3RELD 5DNMC 3AFAB 5E5AB 4NE6A 3AFAA 5E5AA 3X1SC 4ZBJB 5B2JD 4HGAC 5AV5C 2NQBD 5B2IB 5B2IA 2ZY2A 4R8PB 3C1BC 5GSUA 4R8PA 5B0YB 5CPKB 3W98C 5B0YA 5CPKA 3REHB 4H9SC 3REHA 4Z2MG 5GSUD 1HTAA 2HUEC 4KGCB 1ID3D 4KGCA 3REHD 1P34B 1P34A 3MNND 1KX3D 2RVQD 3A6NC 1P34D 3KUYC 2F8ND 1M19B 1M19A 2Y2NA 3W99D 5AVCD 3LZ0D 3LELA 3REIC 3X1VB 3WA9C 3X1VA 3VH6A 5AY8B 1JFIB 5AY8A 3LELD 3WKJC 4Z66B 3X1VD 4Z66A 3B6GD 3UT9C 2Y2HA 5B24C 3A1KA 4J8WC 5CPIC 5DNMD 4J8UB 5B1MC 3C1BB 4J8UA 3C1BA 4J8XC 1JFIA 3AZEC 1EQZB 1F66C 1EQZA 3X1SD 2G5HC 5AV5D 1P3AB 1M18B 3H0LC 4WU9C 1P3AA 1M18A 3C1BD 3W98D 1KX5B 2ZY3A 3MGSC 1KX5A 5F99C 3KFUG 4E44A 3KXBC 4H9OB 3W96D 4H9OA 1AOIC 5B1LB 5GT3C 3X1TC 5B1LA 3O62B 4WJ3C 3O62A 1WWIA 1Z2CB 3AZKB 3AZKA 1KX4C 3LJAC 3KUYA 3REIB 3AZJC 4DQYB 3REIA 3A6ND 4KUDC 3KUYD 1TZYC 4ZUXB 4ZUXA 3AZNB 2F8NH 3AZNA 2AROD 3REID 3WKJB 2YFVB 4Z5TC 3WKJA 2YFVA 1U35C 1T3UA 5JRGC 3WA9D 1N1JB 1N1JA 4AWLB 5CPIB 5B1MB 5CPIA 5B1MA 4J8XB 4J8XA 3MVDC 5CP6B 3AZEB 3AZEA 5CP6A 3WKJD 4YM6B 4YM6A 3UT9D 3AZLB 5B24D 4J8WD 3AZLA 5CPID 3C1CB 5B1MD 3MGPC 3C1CA 2Y2LA 3REJC 3AZED 1F66D 3AFAC 5F99B 5F99A 4WU9D 4ZBJC 5GT3B 5GT3A 5B2IC 3EPHA 4WZSB 4R8PC 3MGSD 3UTAB 5C3IB 5B0YC 4NE3A 3KXBD 3UTAA 5CPKC 2NZDA 2NZDB 1AOID 5GT3D 3X1TD 5BO0B 5BT1C 3EPKA 5BO0A 1KX4D 4KGCC 3LJAD 1TZYB 1TZYA 4H9QA 3AN2B 3AN2A 3AZJD 1P3GC 1U35B 4KUDD 2XD1A 5JRGB 3AZGB 3AZGA 1ULYA 1TZYD 5JRGA 1U35A 3H0RC 1KU5A 4M6BA 4Z5TD 3MVDB 2CV5B 3MVDA 5B0ZD 1U35D 3LZ1C 2CV5A 5JRGD 1P3LB 1P3LA 1BFMA 1P3FB 2UWXA 1P3FA 3AZHB 5AY8C 3AZHA 2L5AA 3B6FC 1M1AB 4Z66C 1M1AA 3MGPD 2LY8A 3REJD 3AZMB 2DF4C 3AZMA 4J8UC 3AFAD 5E5AD 4WNNB 4WNNA 4Z2MH 1EQZC 2BG1A 2G5IC 4X23C 1P3AC 1M18C 2Y2JA 5B2ID 4R8PD 5AV6B 5AV6A 1B6WA 2BYKB 5BNXB 5BNXA 2BYKA 5B0YD 3MGQA 3MGQB 3B0DB 5CPKD 1P3IA 1P3IB 1KX5C 1A7WA 5BT1D 2Y2MA 3REKB 5B1LC 3P5JB 5AV9B 3REKA 3O62C 1P3GB 1P3GA 4KGCD 3AZKC 1P3GD 3LZ1B 3LZ1A 5B31C 2Y2IA 4J8VB 2Y2GA 4J8VA 4ZUXC 5AVBB 5AVBA 3AZNC 1M19D 3VH5T 1P3KB 1P3KA 3B6FB 5GT0B 3B6FA 5GT0A 3WAAB 3WAAA 1P3OC 2ZM5A 4H9PB 4H9PA 5GXQB 4AWLC 5GXQA 5AY8D 5CP6C 3B6FD 4YM6C 4Z66D 4X23B 3AV1B 1R4VA 5B40B 2VQRA 5B40A 4X23A 4NE5A 3AZLC 3C1CC 4J8UD 2Y2KA 3AZFB 5B33B 3AZFA 1EQZD 4H9RB 5B33A 4H9RA 3EPLA 3MGRC 4X23D 1B67A 1P3AD 1M18D 4KHAB 4G91C 1BH8B 1BH8A 1F1EA 4UUZB 1KX5D 3UTAC 5C3IC 2NZDC 1W2EA 4CSRB 4CSRA 3VH5W 5B1LD 5DNNB 3O62D 5DNNA 4XUJB 3H0MC 3AZKD 4XUJA 5B31B 5B31A 1H3OB 2Y2OA 1H3OA 1ZLAB 1ZLAA 2W8SA 2HIOB 4G92B 3TU4B 2HIOA 2ZY4A 1Q9CA 3TU4A 3AYWB 3AN2C 3UTBB 5B31D 3UTBA 3AZGC 4NFTA 1P3OB 1P3OA 1P3PC 4ZUXD 2Y2PA 3AZND 1S32B 1S32A 1P3LC 2CV5C 4YS3C 2FJ7B 4JJNB 2FJ7A 4JJNA 4J8XD 1P3FC 5CP6D 2JSSA 3AZHC 3MGRB 4YM6D 3MGRA 1HQ3C 4E45A 3AZLD 1M1AC 3C1CD 4G91B 3AZMC 3MGRD 3EG5B 5F99D 5AV6C 2IO5B 3UTAD 3MGQC 1P3IC 2NZDD 3B0DC 5BNVB 2J8PA 3VH6T 3REKC 5AV9C 1P3MB 1P3MA 3VH5A 1P3PB 3B0CT 1P3PA 3AN2D 3KWQB 3KWQA 4CAYB 4CAYA 4YS3B 3AZGD 4YS3A 3AZIB 5AV8C 3AZIA 1P3PD 4J8VC 5B31G 3W97B 3W97A 5AVBC 3AV2B 3MVDD 1P3LD 2CV5D 4YS3D 5CPJB 3B0BA 3V9RB 5BS7A 3V9RA 5CPJA 1HQ3B 1P3KC 1HQ3A 5GT0C 3WAAC 2ZY5A 1P3BB 5B32G 1P3BA 5GXQC 1P3FD 3AZHD 2CWEA 5G49B 5G49A 1HQ3D 3VH6W 1M1AD 3WTPB 4WU8B 3EPJA 3WTPA 4WU8A 5B40C 3AV1C 3AZMD 3RELB 3RELA 3B0CW 3AZFC 5B33C 5B2JB 5B2JA 2NQBB 2NQBA 2JE5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AV6 D;  5AV9 A;  3MGQ D;  1P3I D;  3NQU B;  3NQU A;  3REK D;  5GSU B;  5AV9 D;  4DRB A;  5DNN C;  1ID3 B;  4XUJ C;  5AV8 B;  1ID3 A;  5AV8 A;  4H9N B;  4H9N A;  1ZLA C;  3W96 C;  3MNN B;  3MNN A;  2HIO C;  4G92 C;  3TU4 C;  1KX3 B;  3LZ1 D;  3AYW C;  1KX3 A;  5AV8 D;  3X1U C;  3UTB C;  4QLC C;  5B32 C;  1TAF B;  4J8V D;  1TAF A;  2F8N B;  2F8N A;  5AVB D;  1S32 C;  1WWS A;  3W99 B;  5AVC B;  3LZ0 B;  1P3K D;  5AVC A;  3LZ0 A;  3W99 A;  5GT0 D;  3WAA D;  5CHL B;  3AV1 A;  5GXQ D;  2FJ7 C;  4JJN C;  5JA4 B;  2ARO C;  5JA4 A;  3LEL B;  3AV1 D;  5B40 D;  3B6G B;  3B6G A;  3R45 B;  3R45 A;  4KHA A;  5DNM B;  5DNM A;  3AZF D;  5B33 D;  3X1S B;  4UUZ A;  4HGA B;  3X1S A;  5AV5 B;  4XZQ C;  5AV5 A;  2BYM B;  2BYM A;  3W98 B;  3W98 A;  2IO5 C;  3WTP E;  4H9S A;  3W96 B;  3W96 A;  4EO5 C;  2HUE B;  5DNN D;  4LD9 C;  4XUJ D;  3X1U B;  3AYW A;  4QLC B;  3X1U A;  1P3M C;  4QLC A;  5B32 B;  5B32 A;  1ZLA D;  1BH9 B;  1BH9 A;  2HIO D;  3TU4 D;  3AYW D;  3KWQ C;  3X1U D;  3UTB D;  4QLC D;  3A6N B;  5B32 D;  3A6N A;  2YFW B;  2YFW A;  3KUY B;  3AZI C;  1P3O D;  3W97 C;  2ARO B;  1S32 D;  2ARO A;  3AV2 C;  5CPJ C;  4WV4 B;  5BS7 C;  2F8N K;  5FUG B;  3WA9 B;  5FUG A;  3WA9 A;  2FJ7 D;  4JJN D;  1P3B C;  2F8N G;  5B0Z C;  2PYO C;  4XZQ B;  3UT9 B;  4XZQ A;  3UT9 A;  5B24 B;  4J8W B;  5B24 A;  3WTP C;  4J8W A;  4WU8 C;  1F66 B;  3NQJ B;  3REL C;  1F66 A;  3NQJ A;  4XZQ D;  4WU9 B;  4WU9 A;  5B2J C;  5BNV A;  5KDM B;  4EO5 B;  5KDM A;  4LD9 B;  2NQB C;  4LD9 A;  3MGS B;  5E5A C;  3MGS A;  3KXB B;  3KXB A;  1AOI B;  3X1T B;  1AOI A;  3X1T A;  4LD9 D;  3KSY A;  5GSU C;  1P3M D;  1KX4 B;  1KX4 A;  1ID3 C;  3LJA B;  3LJA A;  3REH C;  4DRA A;  3MNN C;  3KWQ D;  3AZJ B;  3AV2 A;  3AZJ A;  1KX3 C;  4KUD B;  4KUD A;  3AZI D;  4H9Q B;  2RVQ C;  1P34 C;  3W97 D;  3AV2 D;  4Z5T B;  4Z5T A;  5B0Z B;  5CPJ D;  5B0Z A;  2PYO B;  2PYO A;  3W99 C;  5AVC C;  3LZ0 C;  1P3B D;  1M19 C;  2PYO D;  3LEL C;  3X1V C;  3WTP D;  4WU8 D;  3B6G C;  3MGP B;  3MGP A;  3REJ B;  3REJ A;  3REL D;  5DNM C;  3AFA B;  5E5A B;  4NE6 A;  3AFA A;  5E5A A;  3X1S C;  4ZBJ B;  5B2J D;  4HGA C;  5AV5 C;  2NQB D;  5B2I B;  5B2I A;  4R8P B;  3C1B C;  5GSU A;  4R8P A;  5B0Y B;  5CPK B;  3W98 C;  5B0Y A;  5CPK A;  3REH B;  4H9S C;  3REH A;  4Z2M G;  5GSU D;  1HTA A;  2HUE C;  4KGC B;  1ID3 D;  4KGC A;  3REH D;  1P34 B;  1P34 A;  3MNN D;  1KX3 D;  2RVQ D;  3A6N C;  1P34 D;  3KUY C;  2F8N D;  1M19 B;  1M19 A;  3W99 D;  5AVC D;  3LZ0 D;  3LEL A;  3REI C;  3X1V B;  3WA9 C;  3X1V A;  3VH6 A;  5AY8 B;  5AY8 A;  3LEL D;  3WKJ C;  4Z66 B;  3X1V D;  4Z66 A;  3B6G D;  3UT9 C;  5B24 C;  1JFI B;  4J8W C;  5CPI C;  5DNM D;  4J8U B;  5B1M C;  3C1B B;  4J8U A;  3C1B A;  4J8X C;  1JFI A;  3AZE C;  1EQZ B;  1F66 C;  1EQZ A;  3X1S D;  5AV5 D;  1P3A B;  1M18 B;  4WU9 C;  1P3A A;  1M18 A;  3C1B D;  3W98 D;  1KX5 B;  3MGS C;  1KX5 A;  5F99 C;  4E44 A;  3KXB C;  4H9O B;  3W96 D;  4H9O A;  1AOI C;  5B1L B;  5GT3 C;  3X1T C;  5B1L A;  3O62 B;  3O62 A;  1WWI A;  3AZK B;  3AZK A;  1KX4 C;  3LJA C;  3KUY A;  3REI B;  3AZJ C;  3REI A;  3A6N D;  4KUD C;  3KUY D;  1TZY C;  4ZUX B;  4ZUX A;  3AZN B;  2F8N H;  3AZN A;  2ARO D;  3REI D;  3WKJ B;  2YFV B;  4Z5T C;  3WKJ A;  2YFV A;  1U35 C;  5JRG C;  3WA9 D;  1N1J B;  1N1J A;  4AWL B;  5CPI B;  5B1M B;  5CPI A;  5B1M A;  4J8X B;  4J8X A;  3MVD C;  5CP6 B;  3AZE B;  3AZE A;  5CP6 A;  3WKJ D;  4YM6 B;  4YM6 A;  3UT9 D;  3AZL B;  5B24 D;  4J8W D;  3AZL A;  5CPI D;  3C1C B;  5B1M D;  3MGP C;  3C1C A;  3REJ C;  3AZE D;  1F66 D;  3AFA C;  5F99 B;  5F99 A;  4WU9 D;  4ZBJ C;  5GT3 B;  5GT3 A;  5B2I C;  4WZS B;  4R8P C;  3MGS D;  3UTA B;  5C3I B;  5B0Y C;  4NE3 A;  3KXB D;  3UTA A;  5CPK C;  2NZD A;  2NZD B;  1AOI D;  5GT3 D;  3X1T D;  5BO0 B;  5BT1 C;  5BO0 A;  1KX4 D;  4KGC C;  3LJA D;  1TZY B;  1TZY A;  4H9Q A;  3AN2 B;  3AN2 A;  3AZJ D;  1P3G C;  1U35 B;  4KUD D;  3AZG B;  5JRG B;  1U35 A;  3AZG A;  1ULY A;  1TZY D;  5JRG A;  1KU5 A;  4M6B A;  4Z5T D;  3MVD B;  2CV5 B;  3MVD A;  5B0Z D;  1U35 D;  3LZ1 C;  2CV5 A;  5JRG D;  1P3L B;  1P3L A;  1BFM A;  1P3F B;  1P3F A;  3AZH B;  5AY8 C;  3AZH A;  2L5A A;  3B6F C;  1M1A B;  4Z66 C;  1M1A A;  3MGP D;  2LY8 A;  3REJ D;  3AZM B;  3AZM A;  4J8U C;  3AFA D;  5E5A D;  4WNN B;  4WNN A;  4Z2M H;  1EQZ C;  4X23 C;  1P3A C;  1M18 C;  5B2I D;  4R8P D;  5AV6 B;  5AV6 A;  1B6W A;  2BYK B;  5BNX B;  5BNX A;  2BYK A;  5B0Y D;  3MGQ A;  3MGQ B;  3B0D B;  5CPK D;  1P3I A;  1P3I B;  1KX5 C;  1A7W A;  5BT1 D;  3REK B;  5B1L C;  5AV9 B;  3REK A;  3O62 C;  1P3G B;  1P3G A;  4KGC D;  3AZK C;  1P3G D;  3LZ1 B;  3LZ1 A;  5B31 C;  4J8V B;  4J8V A;  4ZUX C;  5AVB B;  5AVB A;  3AZN C;  1M19 D;  3VH5 T;  1P3K B;  1P3K A;  3B6F B;  5GT0 B;  3B6F A;  5GT0 A;  3WAA B;  3WAA A;  1P3O C;  4H9P B;  4H9P A;  5GXQ B;  4AWL C;  5GXQ A;  5AY8 D;  5CP6 C;  3B6F D;  4YM6 C;  4Z66 D;  4X23 B;  3AV1 B;  1R4V A;  5B40 B;  4X23 A;  5B40 A;  4NE5 A;  3AZL C;  3C1C C;  4J8U D;  3AZF B;  5B33 B;  3AZF A;  1EQZ D;  4H9R B;  5B33 A;  4H9R A;  3MGR C;  4X23 D;  1B67 A;  1P3A D;  1M18 D;  4KHA B;  4G91 C;  1BH8 B;  1BH8 A;  1F1E A;  4UUZ B;  1KX5 D;  3UTA C;  5C3I C;  2NZD C;  4CSR B;  4CSR A;  3VH5 W;  5B1L D;  5DNN B;  3O62 D;  5DNN A;  4XUJ B;  3AZK D;  4XUJ A;  5B31 B;  5B31 A;  1H3O B;  1H3O A;  1ZLA B;  1ZLA A;  2HIO B;  4G92 B;  3TU4 B;  2HIO A;  1Q9C A;  3TU4 A;  3AYW B;  3AN2 C;  3UTB B;  5B31 D;  3UTB A;  3AZG C;  4NFT A;  1P3O B;  1P3O A;  1P3P C;  4ZUX D;  3AZN D;  1S32 B;  1S32 A;  1P3L C;  2CV5 C;  4YS3 C;  2FJ7 B;  4JJN B;  2FJ7 A;  4JJN A;  4J8X D;  1P3F C;  5CP6 D;  2JSS A;  3AZH C;  3MGR B;  4YM6 D;  3MGR A;  1HQ3 C;  4E45 A;  3AZL D;  1M1A C;  3C1C D;  4G91 B;  3AZM C;  3MGR D;  5F99 D;  5AV6 C;  2IO5 B;  3UTA D;  3MGQ C;  1P3I C;  2NZD D;  3B0D C;  5BNV B;  3VH6 T;  3REK C;  5AV9 C;  1P3M B;  1P3M A;  3VH5 A;  1P3P B;  3B0C T;  1P3P A;  3AN2 D;  3KWQ B;  3KWQ A;  4CAY B;  4CAY A;  4YS3 B;  3AZG D;  4YS3 A;  3AZI B;  5AV8 C;  3AZI A;  1P3P D;  4J8V C;  5B31 G;  3W97 B;  3W97 A;  5AVB C;  3AV2 B;  3MVD D;  1P3L D;  2CV5 D;  4YS3 D;  5CPJ B;  3B0B A;  3V9R B;  5BS7 A;  3V9R A;  5CPJ A;  1HQ3 B;  1P3K C;  1HQ3 A;  5GT0 C;  3WAA C;  1P3B B;  5B32 G;  1P3B A;  5GXQ C;  1P3F D;  3AZH D;  2CWE A;  5G49 B;  5G49 A;  1HQ3 D;  3VH6 W;  1M1A D;  3WTP B;  4WU8 B;  3AV1 C;  3WTP A;  4WU8 A;  5B40 C;  3AZM D;  3REL B;  3REL A;  3B0C W;  3AZF C;  5B33 C;  5B2J B;  5B2J A;  2NQB B;  2NQB A; 
#chains in the Genus database with same CATH topology
 5AV6 D;  5AV9 A;  3MGQ D;  1P3I D;  3NQU B;  2XD5 A;  3NQU A;  3REK D;  5GSU B;  5AV9 D;  4DRB A;  5DNN C;  1ID3 B;  4XUJ C;  5AV8 B;  1ID3 A;  5AV8 A;  4H9N B;  4H9N A;  1ZLA C;  3W96 C;  3MNN B;  3MNN A;  2HIO C;  4G92 C;  3TU4 C;  1KX3 B;  3LZ1 D;  3AYW C;  1KX3 A;  5AV8 D;  3X1U C;  3UTB C;  4QLC C;  5B32 C;  1TAF B;  4J8V D;  1TAF A;  2F8N B;  2F8N A;  5AVB D;  1S32 C;  1WWS A;  3W99 B;  5AVC B;  3LZ0 B;  1P3K D;  5AVC A;  3LZ0 A;  3W99 A;  5GT0 D;  3WAA D;  5CHL B;  3AV1 A;  5GXQ D;  2FJ7 C;  4JJN C;  5JA4 B;  2ARO C;  5JA4 A;  3LEL B;  3AV1 D;  5B40 D;  3B6G B;  3B6G A;  3R45 B;  3R45 A;  4KHA A;  5DNM B;  5DNM A;  3AZF D;  5B33 D;  3X1S B;  4UUZ A;  4HGA B;  3X1S A;  5AV5 B;  4XZQ C;  5AV5 A;  2BYM B;  2BYM A;  3W98 B;  3FDD A;  3W98 A;  2IO5 C;  3WTP E;  4H9S A;  3W96 B;  3W96 A;  4EO5 C;  2HUE B;  5DNN D;  4LD9 C;  3AL0 C;  4XUJ D;  3X1U B;  3AYW A;  4QLC B;  3X1U A;  1P3M C;  4QLC A;  5B32 B;  5B32 A;  1ZLA D;  1BH9 B;  1BH9 A;  2HIO D;  3TU4 D;  3AYW D;  3KWQ C;  3X1U D;  3UTB D;  4QLC D;  3A6N B;  5B32 D;  3A6N A;  2YFW B;  2YFW A;  3F6T A;  3KUY B;  3AZI C;  1P3O D;  3W97 C;  2ARO B;  1S32 D;  2ARO A;  3AV2 C;  4UPK A;  5CPJ C;  4WV4 B;  5BS7 C;  2F8N K;  5FUG B;  3WA9 B;  5FUG A;  3WA9 A;  2FJ7 D;  4JJN D;  1P3B C;  2F8N G;  5B0Z C;  2PYO C;  4XZQ B;  3UT9 B;  4XZQ A;  3UT9 A;  5B24 B;  4J8W B;  5B24 A;  3WTP C;  4J8W A;  4WU8 C;  1F66 B;  3NQJ B;  3REL C;  1F66 A;  3NQJ A;  4XZQ D;  4WU9 B;  4WU9 A;  5B2J C;  5BNV A;  5KDM B;  4EO5 B;  5KDM A;  4LD9 B;  2NQB C;  4LD9 A;  3MGS B;  5E5A C;  3MGS A;  1PZR A;  3KXB B;  3A1I A;  3KXB A;  2RIQ A;  2FFF B;  3X1T B;  1AOI B;  1AOI A;  3X1T A;  4LD9 D;  3KSY A;  5GSU C;  1P3M D;  1KX4 B;  1KX4 A;  1ID3 C;  3LJA B;  3LJA A;  3REH C;  2F2A C;  2DQN C;  4DRA A;  3MNN C;  3KWQ D;  3AZJ B;  3IP4 C;  3AZJ A;  3AV2 A;  1KX3 C;  4KUD B;  4KUD A;  3AZI D;  4H9Q B;  2RVQ C;  1P34 C;  3W97 D;  3AV2 D;  4Z5T B;  4Z5T A;  2JCH A;  5B0Z B;  5CPJ D;  5B0Z A;  2PYO B;  2PYO A;  2Y2Q A;  3W99 C;  5AVC C;  3LZ0 C;  1P3B D;  1M19 C;  2PYO D;  3LEL C;  3X1V C;  3WTP D;  4WU8 D;  3B6G C;  3MGP B;  3MGP A;  3REJ B;  3REJ A;  3REL D;  5DNM C;  3AFA B;  5E5A B;  4NE6 A;  3AFA A;  5E5A A;  3X1S C;  4ZBJ B;  5B2J D;  4HGA C;  5AV5 C;  2NQB D;  5B2I B;  5B2I A;  2ZY2 A;  4R8P B;  3C1B C;  5GSU A;  4R8P A;  5B0Y B;  5CPK B;  3W98 C;  5B0Y A;  5CPK A;  3REH B;  4H9S C;  3REH A;  4Z2M G;  5GSU D;  1HTA A;  2HUE C;  4KGC B;  1ID3 D;  4KGC A;  3REH D;  1P34 B;  1P34 A;  3MNN D;  1KX3 D;  2RVQ D;  3A6N C;  1P34 D;  3KUY C;  2F8N D;  1M19 B;  1M19 A;  2Y2N A;  3W99 D;  5AVC D;  3LZ0 D;  3LEL A;  3REI C;  3X1V B;  3WA9 C;  3X1V A;  3VH6 A;  5AY8 B;  1JFI B;  5AY8 A;  3LEL D;  3WKJ C;  4Z66 B;  3X1V D;  4Z66 A;  3B6G D;  3UT9 C;  2Y2H A;  5B24 C;  3A1K A;  4J8W C;  5CPI C;  5DNM D;  4J8U B;  5B1M C;  3C1B B;  4J8U A;  3C1B A;  4J8X C;  1JFI A;  3AZE C;  1EQZ B;  1F66 C;  1EQZ A;  3X1S D;  2G5H C;  5AV5 D;  1P3A B;  1M18 B;  3H0L C;  4WU9 C;  1P3A A;  1M18 A;  3C1B D;  3W98 D;  1KX5 B;  2ZY3 A;  3MGS C;  1KX5 A;  5F99 C;  3KFU G;  4E44 A;  3KXB C;  4H9O B;  3W96 D;  4H9O A;  1AOI C;  5B1L B;  5GT3 C;  3X1T C;  5B1L A;  3O62 B;  4WJ3 C;  3O62 A;  1WWI A;  1Z2C B;  3AZK B;  3AZK A;  1KX4 C;  3LJA C;  3KUY A;  3REI B;  3AZJ C;  4DQY B;  3REI A;  3A6N D;  4KUD C;  3KUY D;  1TZY C;  4ZUX B;  4ZUX A;  3AZN B;  2F8N H;  3AZN A;  2ARO D;  3REI D;  3WKJ B;  2YFV B;  4Z5T C;  3WKJ A;  2YFV A;  1U35 C;  1T3U A;  5JRG C;  3WA9 D;  1N1J B;  1N1J A;  4AWL B;  5CPI B;  5B1M B;  5CPI A;  5B1M A;  4J8X B;  4J8X A;  3MVD C;  5CP6 B;  3AZE B;  3AZE A;  5CP6 A;  3WKJ D;  4YM6 B;  4YM6 A;  3UT9 D;  3AZL B;  5B24 D;  4J8W D;  3AZL A;  5CPI D;  3C1C B;  5B1M D;  3MGP C;  3C1C A;  2Y2L A;  3REJ C;  3AZE D;  1F66 D;  3AFA C;  5F99 B;  5F99 A;  4WU9 D;  4ZBJ C;  5GT3 B;  5GT3 A;  5B2I C;  3EPH A;  4WZS B;  4R8P C;  3MGS D;  3UTA B;  5C3I B;  5B0Y C;  4NE3 A;  3KXB D;  3UTA A;  5CPK C;  2NZD A;  2NZD B;  1AOI D;  5GT3 D;  3X1T D;  5BO0 B;  5BT1 C;  3EPK A;  5BO0 A;  1KX4 D;  4KGC C;  3LJA D;  1TZY B;  1TZY A;  4H9Q A;  3AN2 B;  3AN2 A;  3AZJ D;  1P3G C;  1U35 B;  4KUD D;  2XD1 A;  5JRG B;  3AZG B;  3AZG A;  1ULY A;  1TZY D;  5JRG A;  1U35 A;  3H0R C;  1KU5 A;  4M6B A;  4Z5T D;  3MVD B;  2CV5 B;  3MVD A;  5B0Z D;  1U35 D;  3LZ1 C;  2CV5 A;  5JRG D;  1P3L B;  1P3L A;  1BFM A;  1P3F B;  2UWX A;  1P3F A;  3AZH B;  5AY8 C;  3AZH A;  2L5A A;  3B6F C;  1M1A B;  4Z66 C;  1M1A A;  3MGP D;  2LY8 A;  3REJ D;  3AZM B;  2DF4 C;  3AZM A;  4J8U C;  3AFA D;  5E5A D;  4WNN B;  4WNN A;  4Z2M H;  1EQZ C;  2BG1 A;  2G5I C;  4X23 C;  1P3A C;  1M18 C;  2Y2J A;  5B2I D;  4R8P D;  5AV6 B;  5AV6 A;  1B6W A;  2BYK B;  5BNX B;  5BNX A;  2BYK A;  5B0Y D;  3MGQ A;  3MGQ B;  3B0D B;  5CPK D;  1P3I A;  1P3I B;  1KX5 C;  1A7W A;  5BT1 D;  2Y2M A;  3REK B;  5B1L C;  3P5J B;  5AV9 B;  3REK A;  3O62 C;  1P3G B;  1P3G A;  4KGC D;  3AZK C;  1P3G D;  3LZ1 B;  3LZ1 A;  5B31 C;  2Y2I A;  4J8V B;  2Y2G A;  4J8V A;  4ZUX C;  5AVB B;  5AVB A;  3AZN C;  1M19 D;  3VH5 T;  1P3K B;  1P3K A;  3B6F B;  5GT0 B;  3B6F A;  5GT0 A;  3WAA B;  3WAA A;  1P3O C;  2ZM5 A;  4H9P B;  4H9P A;  5GXQ B;  4AWL C;  5GXQ A;  5AY8 D;  5CP6 C;  3B6F D;  4YM6 C;  4Z66 D;  4X23 B;  3AV1 B;  1R4V A;  5B40 B;  2VQR A;  5B40 A;  4X23 A;  4NE5 A;  3AZL C;  3C1C C;  4J8U D;  2Y2K A;  3AZF B;  5B33 B;  3AZF A;  1EQZ D;  4H9R B;  5B33 A;  4H9R A;  3EPL A;  3MGR C;  4X23 D;  1B67 A;  1P3A D;  1M18 D;  4KHA B;  4G91 C;  1BH8 B;  1BH8 A;  1F1E A;  4UUZ B;  1KX5 D;  3UTA C;  5C3I C;  2NZD C;  1W2E A;  4CSR B;  4CSR A;  3VH5 W;  5B1L D;  5DNN B;  3O62 D;  5DNN A;  4XUJ B;  3H0M C;  3AZK D;  4XUJ A;  5B31 B;  5B31 A;  1H3O B;  2Y2O A;  1H3O A;  1ZLA B;  1ZLA A;  2W8S A;  2HIO B;  4G92 B;  3TU4 B;  2HIO A;  2ZY4 A;  1Q9C A;  3TU4 A;  3AYW B;  3AN2 C;  3UTB B;  5B31 D;  3UTB A;  3AZG C;  4NFT A;  1P3O B;  1P3O A;  1P3P C;  4ZUX D;  2Y2P A;  3AZN D;  1S32 B;  1S32 A;  1P3L C;  2CV5 C;  4YS3 C;  2FJ7 B;  4JJN B;  2FJ7 A;  4JJN A;  4J8X D;  1P3F C;  5CP6 D;  2JSS A;  3AZH C;  3MGR B;  4YM6 D;  3MGR A;  1HQ3 C;  4E45 A;  3AZL D;  1M1A C;  3C1C D;  4G91 B;  3AZM C;  3MGR D;  3EG5 B;  5F99 D;  5AV6 C;  2IO5 B;  3UTA D;  3MGQ C;  1P3I C;  2NZD D;  3B0D C;  5BNV B;  2J8P A;  3VH6 T;  3REK C;  5AV9 C;  1P3M B;  1P3M A;  3VH5 A;  1P3P B;  3B0C T;  1P3P A;  3AN2 D;  3KWQ B;  3KWQ A;  4CAY B;  4CAY A;  4YS3 B;  3AZG D;  4YS3 A;  3AZI B;  5AV8 C;  3AZI A;  1P3P D;  4J8V C;  5B31 G;  3W97 B;  3W97 A;  5AVB C;  3AV2 B;  3MVD D;  1P3L D;  2CV5 D;  4YS3 D;  5CPJ B;  3B0B A;  3V9R B;  5BS7 A;  3V9R A;  5CPJ A;  1HQ3 B;  1P3K C;  1HQ3 A;  5GT0 C;  3WAA C;  2ZY5 A;  1P3B B;  5B32 G;  1P3B A;  5GXQ C;  1P3F D;  3AZH D;  2CWE A;  5G49 B;  5G49 A;  1HQ3 D;  3VH6 W;  1M1A D;  3WTP B;  4WU8 B;  3EPJ A;  3WTP A;  4WU8 A;  5B40 C;  3AV1 C;  3AZM D;  3REL B;  3REL A;  3B0C W;  3AZF C;  5B33 C;  5B2J B;  5B2J A;  2NQB B;  2NQB A;  2JE5 A; 
#chains in the Genus database with same CATH homology
 5AV6 D;  5AV9 A;  3MGQ D;  1P3I D;  3NQU B;  2XD5 A;  3NQU A;  3REK D;  5GSU B;  5AV9 D;  4DRB A;  5DNN C;  1ID3 B;  4XUJ C;  5AV8 B;  1ID3 A;  5AV8 A;  4H9N B;  4H9N A;  1ZLA C;  3W96 C;  3MNN B;  3MNN A;  2HIO C;  4G92 C;  3TU4 C;  1KX3 B;  3LZ1 D;  3AYW C;  1KX3 A;  5AV8 D;  3X1U C;  3UTB C;  4QLC C;  5B32 C;  1TAF B;  4J8V D;  1TAF A;  2F8N B;  2F8N A;  5AVB D;  1S32 C;  1WWS A;  3W99 B;  5AVC B;  3LZ0 B;  1P3K D;  5AVC A;  3LZ0 A;  3W99 A;  5GT0 D;  3WAA D;  5CHL B;  3AV1 A;  5GXQ D;  2FJ7 C;  4JJN C;  5JA4 B;  2ARO C;  5JA4 A;  3LEL B;  3AV1 D;  5B40 D;  3B6G B;  3B6G A;  3R45 B;  3R45 A;  4KHA A;  5DNM B;  5DNM A;  3AZF D;  5B33 D;  3X1S B;  4UUZ A;  4HGA B;  3X1S A;  5AV5 B;  4XZQ C;  5AV5 A;  2BYM B;  2BYM A;  3W98 B;  3FDD A;  3W98 A;  2IO5 C;  3WTP E;  4H9S A;  3W96 B;  3W96 A;  4EO5 C;  2HUE B;  5DNN D;  4LD9 C;  3AL0 C;  4XUJ D;  3X1U B;  3AYW A;  4QLC B;  3X1U A;  1P3M C;  4QLC A;  5B32 B;  5B32 A;  1ZLA D;  1BH9 B;  1BH9 A;  2HIO D;  3TU4 D;  3AYW D;  3KWQ C;  3X1U D;  3UTB D;  4QLC D;  3A6N B;  5B32 D;  3A6N A;  2YFW B;  2YFW A;  3F6T A;  3KUY B;  3AZI C;  1P3O D;  3W97 C;  2ARO B;  1S32 D;  2ARO A;  3AV2 C;  4UPK A;  5CPJ C;  4WV4 B;  5BS7 C;  2F8N K;  5FUG B;  3WA9 B;  5FUG A;  3WA9 A;  2FJ7 D;  4JJN D;  1P3B C;  2F8N G;  5B0Z C;  2PYO C;  4XZQ B;  3UT9 B;  4XZQ A;  3UT9 A;  5B24 B;  4J8W B;  5B24 A;  3WTP C;  4J8W A;  4WU8 C;  1F66 B;  3NQJ B;  3REL C;  1F66 A;  3NQJ A;  4XZQ D;  4WU9 B;  4WU9 A;  5B2J C;  5BNV A;  5KDM B;  4EO5 B;  5KDM A;  4LD9 B;  2NQB C;  4LD9 A;  3MGS B;  5E5A C;  3MGS A;  1PZR A;  3KXB B;  3A1I A;  3KXB A;  2RIQ A;  2FFF B;  3X1T B;  1AOI B;  1AOI A;  3X1T A;  4LD9 D;  3KSY A;  5GSU C;  1P3M D;  1KX4 B;  1KX4 A;  1ID3 C;  3LJA B;  3LJA A;  3REH C;  2F2A C;  2DQN C;  4DRA A;  3MNN C;  3KWQ D;  3AZJ B;  3IP4 C;  3AZJ A;  3AV2 A;  1KX3 C;  4KUD B;  4KUD A;  3AZI D;  4H9Q B;  2RVQ C;  1P34 C;  3W97 D;  3AV2 D;  4Z5T B;  4Z5T A;  2JCH A;  5B0Z B;  5CPJ D;  5B0Z A;  2PYO B;  2PYO A;  2Y2Q A;  3W99 C;  5AVC C;  3LZ0 C;  1P3B D;  1M19 C;  2PYO D;  3LEL C;  3X1V C;  3WTP D;  4WU8 D;  3B6G C;  3MGP B;  3MGP A;  3REJ B;  3REJ A;  3REL D;  5DNM C;  3AFA B;  5E5A B;  4NE6 A;  3AFA A;  5E5A A;  3X1S C;  4ZBJ B;  5B2J D;  4HGA C;  5AV5 C;  2NQB D;  5B2I B;  5B2I A;  2ZY2 A;  4R8P B;  3C1B C;  5GSU A;  4R8P A;  5B0Y B;  5CPK B;  3W98 C;  5B0Y A;  5CPK A;  3REH B;  4H9S C;  3REH A;  4Z2M G;  5GSU D;  1HTA A;  2HUE C;  4KGC B;  1ID3 D;  4KGC A;  3REH D;  1P34 B;  1P34 A;  3MNN D;  1KX3 D;  2RVQ D;  3A6N C;  1P34 D;  3KUY C;  2F8N D;  1M19 B;  1M19 A;  2Y2N A;  3W99 D;  5AVC D;  3LZ0 D;  3LEL A;  3REI C;  3X1V B;  3WA9 C;  3X1V A;  3VH6 A;  5AY8 B;  1JFI B;  5AY8 A;  3LEL D;  3WKJ C;  4Z66 B;  3X1V D;  4Z66 A;  3B6G D;  3UT9 C;  2Y2H A;  5B24 C;  3A1K A;  4J8W C;  5CPI C;  5DNM D;  4J8U B;  5B1M C;  3C1B B;  4J8U A;  3C1B A;  4J8X C;  1JFI A;  3AZE C;  1EQZ B;  1F66 C;  1EQZ A;  3X1S D;  2G5H C;  5AV5 D;  1P3A B;  1M18 B;  3H0L C;  4WU9 C;  1P3A A;  1M18 A;  3C1B D;  3W98 D;  1KX5 B;  2ZY3 A;  3MGS C;  1KX5 A;  5F99 C;  3KFU G;  4E44 A;  3KXB C;  4H9O B;  3W96 D;  4H9O A;  1AOI C;  5B1L B;  5GT3 C;  3X1T C;  5B1L A;  3O62 B;  4WJ3 C;  3O62 A;  1WWI A;  1Z2C B;  3AZK B;  3AZK A;  1KX4 C;  3LJA C;  3KUY A;  3REI B;  3AZJ C;  4DQY B;  3REI A;  3A6N D;  4KUD C;  3KUY D;  1TZY C;  4ZUX B;  4ZUX A;  3AZN B;  2F8N H;  3AZN A;  2ARO D;  3REI D;  3WKJ B;  2YFV B;  4Z5T C;  3WKJ A;  2YFV A;  1U35 C;  1T3U A;  5JRG C;  3WA9 D;  1N1J B;  1N1J A;  4AWL B;  5CPI B;  5B1M B;  5CPI A;  5B1M A;  4J8X B;  4J8X A;  3MVD C;  5CP6 B;  3AZE B;  3AZE A;  5CP6 A;  3WKJ D;  4YM6 B;  4YM6 A;  3UT9 D;  3AZL B;  5B24 D;  4J8W D;  3AZL A;  5CPI D;  3C1C B;  5B1M D;  3MGP C;  3C1C A;  2Y2L A;  3REJ C;  3AZE D;  1F66 D;  3AFA C;  5F99 B;  5F99 A;  4WU9 D;  4ZBJ C;  5GT3 B;  5GT3 A;  5B2I C;  3EPH A;  4WZS B;  4R8P C;  3MGS D;  3UTA B;  5C3I B;  5B0Y C;  4NE3 A;  3KXB D;  3UTA A;  5CPK C;  2NZD A;  2NZD B;  1AOI D;  5GT3 D;  3X1T D;  5BO0 B;  5BT1 C;  3EPK A;  5BO0 A;  1KX4 D;  4KGC C;  3LJA D;  1TZY B;  1TZY A;  4H9Q A;  3AN2 B;  3AN2 A;  3AZJ D;  1P3G C;  1U35 B;  4KUD D;  2XD1 A;  5JRG B;  3AZG B;  3AZG A;  1ULY A;  1TZY D;  5JRG A;  1U35 A;  3H0R C;  1KU5 A;  4M6B A;  4Z5T D;  3MVD B;  2CV5 B;  3MVD A;  5B0Z D;  1U35 D;  3LZ1 C;  2CV5 A;  5JRG D;  1P3L B;  1P3L A;  1BFM A;  1P3F B;  2UWX A;  1P3F A;  3AZH B;  5AY8 C;  3AZH A;  2L5A A;  3B6F C;  1M1A B;  4Z66 C;  1M1A A;  3MGP D;  2LY8 A;  3REJ D;  3AZM B;  2DF4 C;  3AZM A;  4J8U C;  3AFA D;  5E5A D;  4WNN B;  4WNN A;  4Z2M H;  1EQZ C;  2BG1 A;  2G5I C;  4X23 C;  1P3A C;  1M18 C;  2Y2J A;  5B2I D;  4R8P D;  5AV6 B;  5AV6 A;  1B6W A;  2BYK B;  5BNX B;  5BNX A;  2BYK A;  5B0Y D;  3MGQ A;  3MGQ B;  3B0D B;  5CPK D;  1P3I A;  1P3I B;  1KX5 C;  1A7W A;  5BT1 D;  2Y2M A;  3REK B;  5B1L C;  3P5J B;  5AV9 B;  3REK A;  3O62 C;  1P3G B;  1P3G A;  4KGC D;  3AZK C;  1P3G D;  3LZ1 B;  3LZ1 A;  5B31 C;  2Y2I A;  4J8V B;  2Y2G A;  4J8V A;  4ZUX C;  5AVB B;  5AVB A;  3AZN C;  1M19 D;  3VH5 T;  1P3K B;  1P3K A;  3B6F B;  5GT0 B;  3B6F A;  5GT0 A;  3WAA B;  3WAA A;  1P3O C;  2ZM5 A;  4H9P B;  4H9P A;  5GXQ B;  4AWL C;  5GXQ A;  5AY8 D;  5CP6 C;  3B6F D;  4YM6 C;  4Z66 D;  4X23 B;  3AV1 B;  1R4V A;  5B40 B;  2VQR A;  5B40 A;  4X23 A;  4NE5 A;  3AZL C;  3C1C C;  4J8U D;  2Y2K A;  3AZF B;  5B33 B;  3AZF A;  1EQZ D;  4H9R B;  5B33 A;  4H9R A;  3EPL A;  3MGR C;  4X23 D;  1B67 A;  1P3A D;  1M18 D;  4KHA B;  4G91 C;  1BH8 B;  1BH8 A;  1F1E A;  4UUZ B;  1KX5 D;  3UTA C;  5C3I C;  2NZD C;  1W2E A;  4CSR B;  4CSR A;  3VH5 W;  5B1L D;  5DNN B;  3O62 D;  5DNN A;  4XUJ B;  3H0M C;  3AZK D;  4XUJ A;  5B31 B;  5B31 A;  1H3O B;  2Y2O A;  1H3O A;  1ZLA B;  1ZLA A;  2W8S A;  2HIO B;  4G92 B;  3TU4 B;  2HIO A;  2ZY4 A;  1Q9C A;  3TU4 A;  3AYW B;  3AN2 C;  3UTB B;  5B31 D;  3UTB A;  3AZG C;  4NFT A;  1P3O B;  1P3O A;  1P3P C;  4ZUX D;  2Y2P A;  3AZN D;  1S32 B;  1S32 A;  1P3L C;  2CV5 C;  4YS3 C;  2FJ7 B;  4JJN B;  2FJ7 A;  4JJN A;  4J8X D;  1P3F C;  5CP6 D;  2JSS A;  3AZH C;  3MGR B;  4YM6 D;  3MGR A;  1HQ3 C;  4E45 A;  3AZL D;  1M1A C;  3C1C D;  4G91 B;  3AZM C;  3MGR D;  3EG5 B;  5F99 D;  5AV6 C;  2IO5 B;  3UTA D;  3MGQ C;  1P3I C;  2NZD D;  3B0D C;  5BNV B;  2J8P A;  3VH6 T;  3REK C;  5AV9 C;  1P3M B;  1P3M A;  3VH5 A;  1P3P B;  3B0C T;  1P3P A;  3AN2 D;  3KWQ B;  3KWQ A;  4CAY B;  4CAY A;  4YS3 B;  3AZG D;  4YS3 A;  3AZI B;  5AV8 C;  3AZI A;  1P3P D;  4J8V C;  5B31 G;  3W97 B;  3W97 A;  5AVB C;  3AV2 B;  3MVD D;  1P3L D;  2CV5 D;  4YS3 D;  5CPJ B;  3B0B A;  3V9R B;  5BS7 A;  3V9R A;  5CPJ A;  1HQ3 B;  1P3K C;  1HQ3 A;  5GT0 C;  3WAA C;  2ZY5 A;  1P3B B;  5B32 G;  1P3B A;  5GXQ C;  1P3F D;  3AZH D;  2CWE A;  5G49 B;  5G49 A;  1HQ3 D;  3VH6 W;  1M1A D;  3WTP B;  4WU8 B;  3EPJ A;  3WTP A;  4WU8 A;  5B40 C;  3AV1 C;  3AZM D;  3REL B;  3REL A;  3B0C W;  3AZF C;  5B33 C;  5B2J B;  5B2J A;  2NQB B;  2NQB A;  2JE5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...