3UT9B

Crystal structure of nucleosome core particle assembled with a palindromic widom '601' derivative (ncp-601l)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
79
structure length
79
Chain Sequence
DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title The mechanics behind DNA sequence-dependent properties of the nucleosome
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 29
structure length 79
sequence length 79
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3ut9B00
4NE3A 3X1SC 2NZDA 5AV9A 2FJ7B 3REID 3W96B 3X1VC 5C3IC 3AYWA 1HQ3A 3MGQC 4KUDA 5B33B 4KGCA 5BO0A 4H9OA 3WTPA 1P3FC 4WV4B 4R8PB 3C1CD 5GXQB 5B24B 3B6FC 1B67A 5B1LB 5AY8D 3LZ0A 1BFMA 4WU9D 3MNND 5CPIA 5B2JC 1TZYB 3W97C 3WA9D 5AV6C 1KX5D 3UT9A 5CP6B 3AZNB 1P3KA 4XZQC 3AZIC 3KXBD 3MGPA 5E5AD 4NE6A 5B1MD 4YS3B 3AZEA 5G49B 5AVBA 1JFIA 4J8UB 5FUGA 3AZFC 4H9PB 1P3IC 2CV5B 4EO5B 5GSUD 1R4VA 5DNND 2HIOA 5GT0D 3UTBA 3KUYD 2FJ7C 3REIA 3X1UD 1P3LC 5B33C 3A6NB 3B6GB 4XUJB 3AZJD 3LJAB 2AROD 4R8PC 3REJB 1M1AD 1M18B 5AV5D 1B6WA 3REKD 5B1LC 3C1CA 5B31A 5KDMB 5JRGD 4J8XD 5AY8A 3REHD 4H9NB 3V9RB 1S32D 1TZYC 3MNNA 4H9QA 3WA9A 3AV2D 1U35B 5CP6C 3AZNC 3AN2C 1KX5A 3VH5W 1P3GD 3VH5T 1P3AB 1P3MB 1EQZB 3KXBA 1KX4D 5E5AA 5B1MA 1H3OA 3LELB 2CV5C 4X23B 4EO5C 4WU8B 3W99D 3X1TD 2YFVA 1ULYA 1N1JA 3WAAD 5GSUA 5DNNA 4Z66D 3MGRD 3B0DB 5GT0A 3O62D 2RVQD 3KUYA 1F1EA 3NQJA 5AV8D 3B6GC 4XUJC 5F99B 3X1UA 3REJC 3AV1C 3AZJA 2AROA 3UTAB 1BH9B 5CPJB 5B2IB 1M1AA 3R45A 5AV5A 3W98C 3REKA 1P34B 3AZLC 1KX3D 5JRGA 2YFWA 3AZGD 5CPKD 4J8XA 4ZUXB 3REHA 5B32C 5C3IB 4ZBJB 1S32A 1U35C 5BS7C 1P3OB 3AV2A 1P3MC 4KGCC 3WTPC 1EQZC 1P3GA 1F66B 1KX4A 3LELC 5B2JB 5DNMB 5B31B 4J8VD 5AV6B 4Z5TB 4J8WB 3W99A 3X1TA 3WAAA 4JJND 3B0DC 5BNVA 4Z66A 3MGRA 1ID3B 5B0YD 3O62A 1P3BD 5F99C 5AV8A 4WZSB 5GT3D 3AFAD 5CPJC 5B2IC 5B40B 3MGPC 5JA4B 3AZEC 5AVBC 1P34C 4H9SA 1KX3A 4ZUXC 4YM6D 2YFVB 3AZGA 5CPKA 1P3LB 4ZBJC 3RELB 4CSRA 1ZLAD 3AZMB 1P3PB 3AZKB 1P3OC 3X1SD 2LY8A 3AZHD 4H9RB 4Z2MG 1TAFB 3X1VD 4WNNB 1F66C 3MGQD 5DNMC 1P3FD 3KWQB 5B31C 3C1BD 4NE5A 4Z5TC 4J8WC 3B6FD 3MGSB 4J8VA 3B0CW 3AN2B 3B0CT 2F8NB 5BNXB 4JJNA 4CAYA 2CWEA 1ID3C 3W97D 3MVDB 1P3BA 5B40C 5GT3A 4XZQD 3AFAA 3AZID 3LZ1B 5B1MC 5AVCB 4LD9D 3B0BA 4QLCB 2HUEC 3AZFD 3RELC 1AOID 5GSUC 1P3ID 2BYKA 3AZMC 1P3PC 1ZLAA 3AZKC 3AV1B 2NQBD 3WKJB 3W98B 3X1SA 2FJ7D 3AZHA 3AZLB 2PYOB 3W96D 3VH5A 2BYMA 4UUZA 5B33D 5B0ZB 2AROC 3X1VA 4WU9A 1M1AC 3KWQC 3MGQA 5B32B 1M19B 4R8PD 3TU4B 4Z2MH 5GXQD 1P3FA 5B24D 3MGSC 2NZDB 3C1BA 5AV9B 5B1LD 3B6FA 3KSYA 3REHC 3AYWB 1HQ3B 4KGCB 4KUDB 5BO0B 4H9OB 3WTPB 4AWLC 1TZYD 3NQUA 3MVDC 1BH8A 3W97A 5CP6D 3AZND 3LZ1C 3LZ0B 4KHAA 4XZQA 3AZIA 5CPIB 1KX4C 5AVCC 4YS3D 4J8UD 4QLCC 3W99C 4LD9A 3UT9B 2CV5D 3AZFA 1P3KB 1AOIA 1P3IA 3WKJC 3MGPB 2NQBA 3O62C 3AZEB 5AVBB 1JFIB 2PYOC 5FUGB 2FJ7A 3W96A 5B0ZC 3A6ND 4XUJD 4NFTA 3B6GD 1M19C 5B33A 3LJAD 3REJD 3TU4C 2HIOB 1M18D 2NZDC 5AV9C 4R8PA 3UTBB 1Q9CA 5GXQA 5B24A 5B1LA 3AZGC 3REIB 3AYWC 1HQ3C 4KUDC 4HGAC 4DRAA 1TZYA 4G92B 3C1CB 1U35D 3LZ0C 5CP6A 3AZNA 5AY8B 5CPIC 4M6BA 1P3AD 5B32G 1P3MD 1EQZD 3MNNB 4YS3A 4H9QB 5G49A 3UT9C 3WA9B 3LELD 4J8UA 4X23D 4WU8D 1P3KC 1KX5B 4H9PA 2CV5A 3KXBB 5BT1D 5E5AB 5B1MB 1H3OB 5F99D 1N1JB 3A6NA 2HUEB 4XUJA 3B6GA 2HIOC 1WWSA 5GSUB 3LJAA 5CPJD 5DNNB 3REJA 5B2ID 3UTAD 3UTBC 1M18A 5GT0B 1P34D 3KUYB 3NQJB 5KDMA 3REIC 4ZUXD 3X1UB 4H9NA 3V9RA 3WTPE 3AZJB 4DRBA 2AROB 4G92C 1M1AB 3VH6W 3C1CC 3VH6T 3R45B 5AV5B 1P3OD 3REKB 3AZHC 1U35A 5BS7A 5AY8C 5JRGB 2YFWB 4J8XB 4WU9C 3MNNC 3REHB 1P3AA 1P3MA 1S32B 1M19A 1EQZA 1F66D 3WA9C 3C1BC 4AWLB 5B2JD 5DNMD 1KX5C 5B31D 5B0YA 5AV6D 3AV2B 3LELA 4Z5TD 4X23A 4J8WD 4WU8A 3TU4A 2IO5B 3KXBC 1P3GB 5E5AC 5B31G 1KX4B 1ID3D 3W99B 5F99A 4YM6A 3X1TB 3WAAB 5DNNC 5B40D 5GT0C 1BH9A 4Z66B 5BNVB 5B2IA 3KUYC 3UTAA 3MGRB 5CPJA 4LD9C 1P34A 3O62B 4G91B 5AV8B 3X1UC 1AOIC 1A7WA 1P3LD 4ZUXA 3RELD 3AZJC 3AZMD 2NQBC 1P3PD 5AV5C 3AZKD 3REKC 5JRGC 1P3OA 3W96C 4J8XC 1KX3B 3AZGB 5CPKB 1S32C 4CSRB 4HGAB 3KWQD 5GXQC 1F66A 5B24C 3AV2C 2F8NK 5B2JA 5DNMA 3MGSD 5AV6A 2IO5C 3AN2D 4Z5TA 4J8WA 2F8ND 1P3GC 1ID3A 3MVDD 4J8VB 3X1TC 2F8NG 3WAAC 4JJNB 3LZ1D 4Z66C 4CAYB 5B40A 3MGRC 5JA4A 4YS3C 2RVQC 4G91C 4J8UC 5AV8C 5AVCD 5B0YB 4QLCD 1P3BB 1P3LA 5GT3B 3AFAB 3RELA 3AV1D 3WKJD 3AZMA 1P3PA 3AZKA 4H9SC 1KX3C 3W98D 1WWIA 3AZLD 5CPKC 2PYOD 4H9RA 3A6NC 5CHLB 4YM6B 1TAFA 2BYKB 5B0ZD 3LJAC 4WNNA 1ZLAB 5B32D 1M19D 1M18C 3TU4D 3KWQA 2NZDD 5AV9D 3X1SB 3MGSA 3AZHB 3AN2A 2L5AA 2F8NA 3AYWD 5BNXA 1HQ3D 2BYMB 4UUZB 3X1VB 4KUDD 4KGCD 3WTPD 4WU9B 3MGQB 1P3FB 4J8VC 3C1BB 3MVDA 3B6FB 4JJNC 3LZ0D 1P3AC 5CPID 3LZ1A 2F8NH 3NQUB 5B0YC 1KU5A 1P3BC 4X23C 1BH8B 5AVCA 4WU8C 3W97B 3UT9D 4E44A 4QLCA 2JSSA 1P3KD 5GT3C 3AFAC 4E45A 4KHAB 4XZQB 3AZIB 3VH6A 3MGPD 5BT1C 3AV1A 3WKJA 3AZED 5AVBD 3W98A 4LD9B 4YM6C 3AZLA 2PYOA 3AZFB 1AOIB 1ZLAC 1P3IB 5B0ZA 1HTAA 3UTAC 2HIOD 5B32A 2NQBB 3UTBD
chains in the Genus database with same CATH superfamily
4NE3A 3X1SC 2NZDA 5AV9A 2FJ7B 3REID 3W96B 3X1VC 5C3IC 3AYWA 1HQ3A 3MGQC 4KUDA 5B33B 4KGCA 5BO0A 4H9OA 3WTPA 1P3FC 4WV4B 4R8PB 3C1CD 5GXQB 5B24B 3B6FC 1B67A 5B1LB 5AY8D 3LZ0A 1BFMA 4WU9D 3MNND 5CPIA 5B2JC 1TZYB 3W97C 3WA9D 5AV6C 3H0RC 1KX5D 2W8SA 3UT9A 5CP6B 3AZNB 1P3KA 4XZQC 3AZIC 3KXBD 2Y2OA 3MGPA 5E5AD 4NE6A 5B1MD 4YS3B 3AZEA 5G49B 5AVBA 1JFIA 4J8UB 5FUGA 3AZFC 2BG1A 4H9PB 1P3IC 2CV5B 4EO5B 5GSUD 1R4VA 5DNND 2HIOA 5GT0D 3UTBA 3KUYD 2FJ7C 2Y2NA 3P5JB 3REIA 3X1UD 1P3LC 5B33C 4DQYB 3A6NB 3B6GB 4XUJB 3AZJD 3LJAB 2AROD 4R8PC 3REJB 1M1AD 1M18B 5AV5D 1B6WA 3REKD 5B1LC 3C1CA 5B31A 5KDMB 5JRGD 4J8XD 5AY8A 3REHD 4H9NB 3V9RB 1S32D 1TZYC 3MNNA 4H9QA 3WA9A 3AV2D 1U35B 5CP6C 3AZNC 3AN2C 1KX5A 3VH5W 1P3GD 3VH5T 1P3AB 1P3MB 1EQZB 3KXBA 1KX4D 5E5AA 5B1MA 1H3OA 3LELB 3EG5B 4X23B 2CV5C 4EO5C 3W99D 4WU8B 3X1TD 2YFVA 1ULYA 1N1JA 3WAAD 5GSUA 5DNNA 4Z66D 3MGRD 3B0DB 5GT0A 3O62D 2RVQD 3KUYA 1F1EA 3NQJA 5AV8D 3B6GC 4XUJC 5F99B 3X1UA 3REJC 3AV1C 3AZJA 2AROA 3UTAB 1BH9B 5CPJB 5B2IB 1M1AA 2ZY5A 3R45A 5AV5A 3REKA 3W98C 1P34B 3AZLC 1KX3D 5JRGA 2G5HC 2YFWA 3AZGD 5CPKD 4J8XA 4ZUXB 3REHA 5B32C 5C3IB 4ZBJB 1S32A 1U35C 5BS7C 1P3OB 3AV2A 1P3MC 4KGCC 3EPLA 3WTPC 1EQZC 1P3GA 2VQRA 1F66B 1KX4A 3LELC 5B2JB 5DNMB 5B31B 4J8VD 5AV6B 4Z5TB 4J8WB 3W99A 3X1TA 3WAAA 4JJND 3B0DC 5BNVA 4Z66A 3MGRA 1ID3B 5B0YD 3O62A 1P3BD 5F99C 5AV8A 4WZSB 5GT3D 3AFAD 5CPJC 5B2IC 5B40B 3MGPC 1W2EA 5JA4B 3AZEC 5AVBC 1P34C 4H9SA 1KX3A 4ZUXC 4YM6D 2YFVB 3AZGA 5CPKA 1P3LB 4ZBJC 3RELB 4CSRA 1ZLAD 3AZMB 1P3PB 3AZKB 1P3OC 2JE5A 1Z2CB 3X1SD 2LY8A 3AZHD 4H9RB 4Z2MG 2Y2KA 1TAFB 3X1VD 4WNNB 1F66C 3MGQD 5DNMC 1P3FD 3KWQB 5B31C 3C1BD 4NE5A 4Z5TC 4J8WC 1PZRA 3B6FD 3MGSB 4J8VA 3B0CW 3AN2B 3B0CT 2F8NB 5BNXB 3F6TA 4JJNA 4CAYA 2CWEA 1ID3C 3W97D 2ZY3A 3MVDB 1P3BA 5B40C 5GT3A 4XZQD 3AFAA 3AZID 3LZ1B 3FDDA 5B1MC 5AVCB 4LD9D 3B0BA 4QLCB 2HUEC 3AZFD 3RELC 1AOID 5GSUC 1P3ID 2BYKA 3AZMC 3H0LC 1P3PC 1ZLAA 3AZKC 3AV1B 2NQBD 3WKJB 3W98B 3X1SA 2FJ7D 3AZHA 3AZLB 2PYOB 3W96D 3VH5A 2BYMA 4UUZA 5B33D 5B0ZB 2AROC 3X1VA 4WU9A 1M1AC 3KWQC 3MGQA 5B32B 1M19B 4R8PD 3TU4B 4Z2MH 5GXQD 1P3FA 5B24D 3MGSC 2NZDB 3C1BA 5AV9B 2XD5A 5B1LD 2Y2MA 3B6FA 3KSYA 3REHC 3AYWB 1HQ3B 4KGCB 4KUDB 5BO0B 4H9OB 3WTPB 4AWLC 1TZYD 3NQUA 3MVDC 1BH8A 3W97A 5CP6D 3AZND 2Y2HA 3LZ1C 3LZ0B 3AL0C 4KHAA 4XZQA 3AZIA 5CPIB 1KX4C 5AVCC 4YS3D 4J8UD 4QLCC 3W99C 4LD9A 3UT9B 2CV5D 3AZFA 2DQNC 1P3KB 1AOIA 1P3IA 3WKJC 3MGPB 2NQBA 3O62C 3AZEB 3KFUG 5AVBB 1JFIB 2PYOC 5FUGB 2FJ7A 3W96A 5B0ZC 3A6ND 4XUJD 4NFTA 3B6GD 1M19C 5B33A 3LJAD 2F2AC 3REJD 3TU4C 2HIOB 1M18D 2NZDC 5AV9C 4R8PA 3UTBB 1Q9CA 5GXQA 5B24A 5B1LA 3AZGC 2UWXA 3REIB 3AYWC 1HQ3C 4KUDC 4HGAC 4DRAA 1TZYA 4G92B 3C1CB 1U35D 3LZ0C 5CP6A 3AZNA 5AY8B 5CPIC 2XD1A 4M6BA 1P3AD 5B32G 1P3MD 1EQZD 3MNNB 4YS3A 4H9QB 5G49A 3UT9C 3WA9B 3LELD 4J8UA 4X23D 4WU8D 1P3KC 1KX5B 4H9PA 2CV5A 3KXBB 5BT1D 5E5AB 5B1MB 1H3OB 2FFFB 5F99D 2RIQA 1N1JB 3A6NA 2HUEB 4XUJA 3B6GA 2HIOC 1WWSA 5GSUB 3LJAA 5CPJD 5DNNB 3REJA 5B2ID 3UTAD 3UTBC 1M18A 5GT0B 1P34D 3KUYB 3NQJB 5KDMA 3REIC 4ZUXD 3X1UB 4H9NA 3V9RA 3WTPE 3AZJB 4DRBA 2AROB 2ZY2A 4G92C 3VH6W 3C1CC 1M1AB 3VH6T 2Y2QA 3R45B 5AV5B 1P3OD 3REKB 3AZHC 1U35A 5BS7A 5AY8C 2Y2JA 5JRGB 2YFWB 4J8XB 4WU9C 3MNNC 3REHB 1P3AA 3A1IA 1P3MA 1S32B 1M19A 1EQZA 1F66D 3WA9C 3C1BC 4AWLB 5B2JD 5DNMD 1KX5C 5B31D 5B0YA 5AV6D 3AV2B 3LELA 4Z5TD 4X23A 4J8WD 4WU8A 3TU4A 2IO5B 2Y2PA 3KXBC 1P3GB 5E5AC 2Y2IA 5B31G 1KX4B 1ID3D 3W99B 5F99A 4YM6A 3EPKA 3X1TB 3WAAB 5DNNC 2ZM5A 5B40D 5GT0C 1BH9A 4Z66B 5BNVB 5B2IA 3KUYC 3UTAA 3MGRB 5CPJA 4LD9C 1P34A 3O62B 4G91B 5AV8B 3X1UC 1AOIC 1A7WA 1P3LD 4ZUXA 3RELD 3AZJC 3AZMD 2NQBC 1P3PD 5AV5C 3AZKD 3REKC 5JRGC 1P3OA 3W96C 4J8XC 1KX3B 3AZGB 5CPKB 1S32C 4CSRB 4HGAB 3KWQD 5GXQC 1F66A 5B24C 3AV2C 2F8NK 5B2JA 5DNMA 3MGSD 5AV6A 2IO5C 3AN2D 4Z5TA 4J8WA 2ZY4A 3IP4C 2F8ND 1P3GC 1ID3A 3MVDD 4J8VB 3X1TC 1T3UA 2F8NG 3WAAC 2G5IC 2DF4C 4JJNB 3LZ1D 4Z66C 4CAYB 5B40A 3MGRC 5JA4A 4YS3C 2RVQC 4G91C 4J8UC 5AV8C 5AVCD 5B0YB 2J8PA 4QLCD 1P3BB 1P3LA 4WJ3C 5GT3B 3AFAB 3RELA 3AV1D 3WKJD 3AZMA 1P3PA 3A1KA 3AZKA 4H9SC 1KX3C 3W98D 1WWIA 3AZLD 5CPKC 2PYOD 4H9RA 3A6NC 5CHLB 4YM6B 1TAFA 2BYKB 5B0ZD 3LJAC 4WNNA 1ZLAB 5B32D 1M19D 1M18C 3TU4D 3KWQA 2NZDD 2Y2GA 5AV9D 3X1SB 3MGSA 3AZHB 3AN2A 2L5AA 2F8NA 3AYWD 5BNXA 1HQ3D 2BYMB 4UUZB 3X1VB 4KUDD 4KGCD 4UPKA 3WTPD 4WU9B 3MGQB 3H0MC 1P3FB 4J8VC 3C1BB 3EPHA 3MVDA 3B6FB 4JJNC 3LZ0D 1P3AC 5CPID 3LZ1A 2F8NH 3NQUB 5B0YC 1KU5A 1P3BC 4X23C 1BH8B 5AVCA 4WU8C 3W97B 3UT9D 4E44A 4QLCA 2JSSA 1P3KD 5GT3C 3AFAC 4E45A 4XZQB 4KHAB 2Y2LA 3VH6A 3AZIB 3MGPD 5BT1C 3AV1A 3WKJA 3AZED 5AVBD 2JCHA 3W98A 4LD9B 3EPJA 4YM6C 3AZLA 2PYOA 3AZFB 1AOIB 1ZLAC 1P3IB 5B0ZA 1HTAA 3UTAC 2HIOD 5B32A 2NQBB 3UTBD
chains in the Genus database with same CATH topology
4NE3A 3X1SC 2NZDA 5AV9A 2FJ7B 3REID 3W96B 3X1VC 5C3IC 3AYWA 1HQ3A 3MGQC 4KUDA 5B33B 4KGCA 5BO0A 4H9OA 3WTPA 1P3FC 4WV4B 4R8PB 3C1CD 5GXQB 5B24B 3B6FC 1B67A 5B1LB 5AY8D 3LZ0A 1BFMA 4WU9D 3MNND 5CPIA 5B2JC 1TZYB 3W97C 3WA9D 5AV6C 3H0RC 1KX5D 2W8SA 3UT9A 5CP6B 3AZNB 1P3KA 4XZQC 3AZIC 3KXBD 2Y2OA 3MGPA 5E5AD 4NE6A 5B1MD 4YS3B 3AZEA 5G49B 5AVBA 1JFIA 4J8UB 5FUGA 3AZFC 2BG1A 4H9PB 1P3IC 2CV5B 4EO5B 5GSUD 1R4VA 5DNND 2HIOA 5GT0D 3UTBA 3KUYD 2FJ7C 2Y2NA 3P5JB 3REIA 3X1UD 1P3LC 5B33C 4DQYB 3A6NB 3B6GB 4XUJB 3AZJD 3LJAB 2AROD 4R8PC 3REJB 1M1AD 1M18B 5AV5D 1B6WA 3REKD 5B1LC 3C1CA 5B31A 5KDMB 5JRGD 4J8XD 5AY8A 3REHD 4H9NB 3V9RB 1S32D 1TZYC 3MNNA 4H9QA 3WA9A 3AV2D 1U35B 5CP6C 3AZNC 3AN2C 1KX5A 3VH5W 1P3GD 3VH5T 1P3AB 1P3MB 1EQZB 3KXBA 1KX4D 5E5AA 5B1MA 1H3OA 3LELB 3EG5B 4X23B 2CV5C 4EO5C 3W99D 4WU8B 3X1TD 2YFVA 1ULYA 1N1JA 3WAAD 5GSUA 5DNNA 4Z66D 3MGRD 3B0DB 5GT0A 3O62D 2RVQD 3KUYA 1F1EA 3NQJA 5AV8D 3B6GC 4XUJC 5F99B 3X1UA 3REJC 3AV1C 3AZJA 2AROA 3UTAB 1BH9B 5CPJB 5B2IB 1M1AA 2ZY5A 3R45A 5AV5A 3REKA 3W98C 1P34B 3AZLC 1KX3D 5JRGA 2G5HC 2YFWA 3AZGD 5CPKD 4J8XA 4ZUXB 3REHA 5B32C 5C3IB 4ZBJB 1S32A 1U35C 5BS7C 1P3OB 3AV2A 1P3MC 4KGCC 3EPLA 3WTPC 1EQZC 1P3GA 2VQRA 1F66B 1KX4A 3LELC 5B2JB 5DNMB 5B31B 4J8VD 5AV6B 4Z5TB 4J8WB 3W99A 3X1TA 3WAAA 4JJND 3B0DC 5BNVA 4Z66A 3MGRA 1ID3B 5B0YD 3O62A 1P3BD 5F99C 5AV8A 4WZSB 5GT3D 3AFAD 5CPJC 5B2IC 5B40B 3MGPC 1W2EA 5JA4B 3AZEC 5AVBC 1P34C 4H9SA 1KX3A 4ZUXC 4YM6D 2YFVB 3AZGA 5CPKA 1P3LB 4ZBJC 3RELB 4CSRA 1ZLAD 3AZMB 1P3PB 3AZKB 1P3OC 2JE5A 1Z2CB 3X1SD 2LY8A 3AZHD 4H9RB 4Z2MG 2Y2KA 1TAFB 3X1VD 4WNNB 1F66C 3MGQD 5DNMC 1P3FD 3KWQB 5B31C 3C1BD 4NE5A 4Z5TC 4J8WC 1PZRA 3B6FD 3MGSB 4J8VA 3B0CW 3AN2B 3B0CT 2F8NB 5BNXB 3F6TA 4JJNA 4CAYA 2CWEA 1ID3C 3W97D 2ZY3A 3MVDB 1P3BA 5B40C 5GT3A 4XZQD 3AFAA 3AZID 3LZ1B 3FDDA 5B1MC 5AVCB 4LD9D 3B0BA 4QLCB 2HUEC 3AZFD 3RELC 1AOID 5GSUC 1P3ID 2BYKA 3AZMC 3H0LC 1P3PC 1ZLAA 3AZKC 3AV1B 2NQBD 3WKJB 3W98B 3X1SA 2FJ7D 3AZHA 3AZLB 2PYOB 3W96D 3VH5A 2BYMA 4UUZA 5B33D 5B0ZB 2AROC 3X1VA 4WU9A 1M1AC 3KWQC 3MGQA 5B32B 1M19B 4R8PD 3TU4B 4Z2MH 5GXQD 1P3FA 5B24D 3MGSC 2NZDB 3C1BA 5AV9B 2XD5A 5B1LD 2Y2MA 3B6FA 3KSYA 3REHC 3AYWB 1HQ3B 4KGCB 4KUDB 5BO0B 4H9OB 3WTPB 4AWLC 1TZYD 3NQUA 3MVDC 1BH8A 3W97A 5CP6D 3AZND 2Y2HA 3LZ1C 3LZ0B 3AL0C 4KHAA 4XZQA 3AZIA 5CPIB 1KX4C 5AVCC 4YS3D 4J8UD 4QLCC 3W99C 4LD9A 3UT9B 2CV5D 3AZFA 2DQNC 1P3KB 1AOIA 1P3IA 3WKJC 3MGPB 2NQBA 3O62C 3AZEB 3KFUG 5AVBB 1JFIB 2PYOC 5FUGB 2FJ7A 3W96A 5B0ZC 3A6ND 4XUJD 4NFTA 3B6GD 1M19C 5B33A 3LJAD 2F2AC 3REJD 3TU4C 2HIOB 1M18D 2NZDC 5AV9C 4R8PA 3UTBB 1Q9CA 5GXQA 5B24A 5B1LA 3AZGC 2UWXA 3REIB 3AYWC 1HQ3C 4KUDC 4HGAC 4DRAA 1TZYA 4G92B 3C1CB 1U35D 3LZ0C 5CP6A 3AZNA 5AY8B 5CPIC 2XD1A 4M6BA 1P3AD 5B32G 1P3MD 1EQZD 3MNNB 4YS3A 4H9QB 5G49A 3UT9C 3WA9B 3LELD 4J8UA 4X23D 4WU8D 1P3KC 1KX5B 4H9PA 2CV5A 3KXBB 5BT1D 5E5AB 5B1MB 1H3OB 2FFFB 5F99D 2RIQA 1N1JB 3A6NA 2HUEB 4XUJA 3B6GA 2HIOC 1WWSA 5GSUB 3LJAA 5CPJD 5DNNB 3REJA 5B2ID 3UTAD 3UTBC 1M18A 5GT0B 1P34D 3KUYB 3NQJB 5KDMA 3REIC 4ZUXD 3X1UB 4H9NA 3V9RA 3WTPE 3AZJB 4DRBA 2AROB 2ZY2A 4G92C 3VH6W 3C1CC 1M1AB 3VH6T 2Y2QA 3R45B 5AV5B 1P3OD 3REKB 3AZHC 1U35A 5BS7A 5AY8C 2Y2JA 5JRGB 2YFWB 4J8XB 4WU9C 3MNNC 3REHB 1P3AA 3A1IA 1P3MA 1S32B 1M19A 1EQZA 1F66D 3WA9C 3C1BC 4AWLB 5B2JD 5DNMD 1KX5C 5B31D 5B0YA 5AV6D 3AV2B 3LELA 4Z5TD 4X23A 4J8WD 4WU8A 3TU4A 2IO5B 2Y2PA 3KXBC 1P3GB 5E5AC 2Y2IA 5B31G 1KX4B 1ID3D 3W99B 5F99A 4YM6A 3EPKA 3X1TB 3WAAB 5DNNC 2ZM5A 5B40D 5GT0C 1BH9A 4Z66B 5BNVB 5B2IA 3KUYC 3UTAA 3MGRB 5CPJA 4LD9C 1P34A 3O62B 4G91B 5AV8B 3X1UC 1AOIC 1A7WA 1P3LD 4ZUXA 3RELD 3AZJC 3AZMD 2NQBC 1P3PD 5AV5C 3AZKD 3REKC 5JRGC 1P3OA 3W96C 4J8XC 1KX3B 3AZGB 5CPKB 1S32C 4CSRB 4HGAB 3KWQD 5GXQC 1F66A 5B24C 3AV2C 2F8NK 5B2JA 5DNMA 3MGSD 5AV6A 2IO5C 3AN2D 4Z5TA 4J8WA 2ZY4A 3IP4C 2F8ND 1P3GC 1ID3A 3MVDD 4J8VB 3X1TC 1T3UA 2F8NG 3WAAC 2G5IC 2DF4C 4JJNB 3LZ1D 4Z66C 4CAYB 5B40A 3MGRC 5JA4A 4YS3C 2RVQC 4G91C 4J8UC 5AV8C 5AVCD 5B0YB 2J8PA 4QLCD 1P3BB 1P3LA 4WJ3C 5GT3B 3AFAB 3RELA 3AV1D 3WKJD 3AZMA 1P3PA 3A1KA 3AZKA 4H9SC 1KX3C 3W98D 1WWIA 3AZLD 5CPKC 2PYOD 4H9RA 3A6NC 5CHLB 4YM6B 1TAFA 2BYKB 5B0ZD 3LJAC 4WNNA 1ZLAB 5B32D 1M19D 1M18C 3TU4D 3KWQA 2NZDD 2Y2GA 5AV9D 3X1SB 3MGSA 3AZHB 3AN2A 2L5AA 2F8NA 3AYWD 5BNXA 1HQ3D 2BYMB 4UUZB 3X1VB 4KUDD 4KGCD 4UPKA 3WTPD 4WU9B 3MGQB 3H0MC 1P3FB 4J8VC 3C1BB 3EPHA 3MVDA 3B6FB 4JJNC 3LZ0D 1P3AC 5CPID 3LZ1A 2F8NH 3NQUB 5B0YC 1KU5A 1P3BC 4X23C 1BH8B 5AVCA 4WU8C 3W97B 3UT9D 4E44A 4QLCA 2JSSA 1P3KD 5GT3C 3AFAC 4E45A 4XZQB 4KHAB 2Y2LA 3VH6A 3AZIB 3MGPD 5BT1C 3AV1A 3WKJA 3AZED 5AVBD 2JCHA 3W98A 4LD9B 3EPJA 4YM6C 3AZLA 2PYOA 3AZFB 1AOIB 1ZLAC 1P3IB 5B0ZA 1HTAA 3UTAC 2HIOD 5B32A 2NQBB 3UTBD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NE3 A;  3X1S C;  2NZD A;  5AV9 A;  2FJ7 B;  3REI D;  3W96 B;  3X1V C;  5C3I C;  3AYW A;  1HQ3 A;  3MGQ C;  4KUD A;  5B33 B;  4KGC A;  5BO0 A;  4H9O A;  3WTP A;  1P3F C;  4WV4 B;  4R8P B;  3C1C D;  5GXQ B;  5B24 B;  3B6F C;  1B67 A;  5B1L B;  5AY8 D;  3LZ0 A;  1BFM A;  4WU9 D;  3MNN D;  5CPI A;  5B2J C;  1TZY B;  3W97 C;  3WA9 D;  5AV6 C;  1KX5 D;  3UT9 A;  5CP6 B;  3AZN B;  1P3K A;  4XZQ C;  3AZI C;  3KXB D;  3MGP A;  5E5A D;  4NE6 A;  5B1M D;  4YS3 B;  3AZE A;  5G49 B;  5AVB A;  1JFI A;  4J8U B;  5FUG A;  3AZF C;  4H9P B;  1P3I C;  2CV5 B;  4EO5 B;  5GSU D;  1R4V A;  5DNN D;  2HIO A;  5GT0 D;  3UTB A;  3KUY D;  2FJ7 C;  3REI A;  3X1U D;  1P3L C;  5B33 C;  3A6N B;  3B6G B;  4XUJ B;  3AZJ D;  3LJA B;  2ARO D;  4R8P C;  3REJ B;  1M1A D;  1M18 B;  5AV5 D;  1B6W A;  3REK D;  5B1L C;  3C1C A;  5B31 A;  5KDM B;  5JRG D;  4J8X D;  5AY8 A;  3REH D;  4H9N B;  3V9R B;  1S32 D;  1TZY C;  3MNN A;  4H9Q A;  3WA9 A;  3AV2 D;  1U35 B;  5CP6 C;  3AZN C;  3AN2 C;  1KX5 A;  3VH5 W;  1P3G D;  3VH5 T;  1P3A B;  1P3M B;  1EQZ B;  3KXB A;  1KX4 D;  5E5A A;  5B1M A;  1H3O A;  3LEL B;  2CV5 C;  4X23 B;  4EO5 C;  4WU8 B;  3W99 D;  3X1T D;  2YFV A;  1ULY A;  1N1J A;  3WAA D;  5GSU A;  5DNN A;  4Z66 D;  3MGR D;  3B0D B;  5GT0 A;  3O62 D;  2RVQ D;  3KUY A;  1F1E A;  3NQJ A;  5AV8 D;  3B6G C;  4XUJ C;  5F99 B;  3X1U A;  3REJ C;  3AV1 C;  3AZJ A;  2ARO A;  3UTA B;  1BH9 B;  5CPJ B;  5B2I B;  1M1A A;  3R45 A;  5AV5 A;  3W98 C;  3REK A;  1P34 B;  3AZL C;  1KX3 D;  5JRG A;  2YFW A;  3AZG D;  5CPK D;  4J8X A;  4ZUX B;  3REH A;  5B32 C;  5C3I B;  4ZBJ B;  1S32 A;  1U35 C;  5BS7 C;  1P3O B;  3AV2 A;  1P3M C;  4KGC C;  3WTP C;  1EQZ C;  1P3G A;  1F66 B;  1KX4 A;  3LEL C;  5B2J B;  5DNM B;  5B31 B;  4J8V D;  5AV6 B;  4Z5T B;  4J8W B;  3W99 A;  3X1T A;  3WAA A;  4JJN D;  3B0D C;  5BNV A;  4Z66 A;  3MGR A;  1ID3 B;  5B0Y D;  3O62 A;  1P3B D;  5F99 C;  5AV8 A;  4WZS B;  5GT3 D;  3AFA D;  5CPJ C;  5B2I C;  5B40 B;  3MGP C;  5JA4 B;  3AZE C;  5AVB C;  1P34 C;  4H9S A;  1KX3 A;  4ZUX C;  4YM6 D;  2YFV B;  3AZG A;  5CPK A;  1P3L B;  4ZBJ C;  3REL B;  4CSR A;  1ZLA D;  3AZM B;  1P3P B;  3AZK B;  1P3O C;  3X1S D;  2LY8 A;  3AZH D;  4H9R B;  4Z2M G;  1TAF B;  3X1V D;  4WNN B;  1F66 C;  3MGQ D;  5DNM C;  1P3F D;  3KWQ B;  5B31 C;  3C1B D;  4NE5 A;  4Z5T C;  4J8W C;  3B6F D;  3MGS B;  4J8V A;  3B0C W;  3AN2 B;  3B0C T;  2F8N B;  5BNX B;  4JJN A;  4CAY A;  2CWE A;  1ID3 C;  3W97 D;  3MVD B;  1P3B A;  5B40 C;  5GT3 A;  4XZQ D;  3AFA A;  3AZI D;  3LZ1 B;  5B1M C;  5AVC B;  4LD9 D;  3B0B A;  4QLC B;  2HUE C;  3AZF D;  3REL C;  1AOI D;  5GSU C;  1P3I D;  2BYK A;  3AZM C;  1P3P C;  1ZLA A;  3AZK C;  3AV1 B;  2NQB D;  3WKJ B;  3W98 B;  3X1S A;  2FJ7 D;  3AZH A;  3AZL B;  2PYO B;  3W96 D;  3VH5 A;  2BYM A;  4UUZ A;  5B33 D;  5B0Z B;  2ARO C;  3X1V A;  4WU9 A;  1M1A C;  3KWQ C;  3MGQ A;  5B32 B;  1M19 B;  4R8P D;  3TU4 B;  4Z2M H;  5GXQ D;  1P3F A;  5B24 D;  3MGS C;  2NZD B;  3C1B A;  5AV9 B;  5B1L D;  3B6F A;  3KSY A;  3REH C;  3AYW B;  1HQ3 B;  4KGC B;  4KUD B;  5BO0 B;  4H9O B;  3WTP B;  4AWL C;  1TZY D;  3NQU A;  3MVD C;  1BH8 A;  3W97 A;  5CP6 D;  3AZN D;  3LZ1 C;  3LZ0 B;  4KHA A;  4XZQ A;  3AZI A;  5CPI B;  1KX4 C;  5AVC C;  4YS3 D;  4J8U D;  4QLC C;  3W99 C;  4LD9 A;  3UT9 B;  2CV5 D;  3AZF A;  1P3K B;  1AOI A;  1P3I A;  3WKJ C;  3MGP B;  2NQB A;  3O62 C;  3AZE B;  5AVB B;  1JFI B;  2PYO C;  5FUG B;  2FJ7 A;  3W96 A;  5B0Z C;  3A6N D;  4XUJ D;  4NFT A;  3B6G D;  1M19 C;  5B33 A;  3LJA D;  3REJ D;  3TU4 C;  2HIO B;  1M18 D;  2NZD C;  5AV9 C;  4R8P A;  3UTB B;  1Q9C A;  5GXQ A;  5B24 A;  5B1L A;  3AZG C;  3REI B;  3AYW C;  1HQ3 C;  4KUD C;  4HGA C;  4DRA A;  1TZY A;  4G92 B;  3C1C B;  1U35 D;  3LZ0 C;  5CP6 A;  3AZN A;  5AY8 B;  5CPI C;  4M6B A;  1P3A D;  5B32 G;  1P3M D;  1EQZ D;  3MNN B;  4YS3 A;  4H9Q B;  5G49 A;  3UT9 C;  3WA9 B;  3LEL D;  4J8U A;  4X23 D;  4WU8 D;  1P3K C;  1KX5 B;  4H9P A;  2CV5 A;  3KXB B;  5BT1 D;  5E5A B;  5B1M B;  1H3O B;  5F99 D;  1N1J B;  3A6N A;  2HUE B;  4XUJ A;  3B6G A;  2HIO C;  1WWS A;  5GSU B;  3LJA A;  5CPJ D;  5DNN B;  3REJ A;  5B2I D;  3UTA D;  3UTB C;  1M18 A;  5GT0 B;  1P34 D;  3KUY B;  3NQJ B;  5KDM A;  3REI C;  4ZUX D;  3X1U B;  4H9N A;  3V9R A;  3WTP E;  3AZJ B;  4DRB A;  2ARO B;  4G92 C;  1M1A B;  3VH6 W;  3C1C C;  3VH6 T;  3R45 B;  5AV5 B;  1P3O D;  3REK B;  3AZH C;  1U35 A;  5BS7 A;  5AY8 C;  5JRG B;  2YFW B;  4J8X B;  4WU9 C;  3MNN C;  3REH B;  1P3A A;  1P3M A;  1S32 B;  1M19 A;  1EQZ A;  1F66 D;  3WA9 C;  3C1B C;  4AWL B;  5B2J D;  5DNM D;  1KX5 C;  5B31 D;  5B0Y A;  5AV6 D;  3AV2 B;  3LEL A;  4Z5T D;  4X23 A;  4J8W D;  4WU8 A;  3TU4 A;  2IO5 B;  3KXB C;  1P3G B;  5E5A C;  5B31 G;  1KX4 B;  1ID3 D;  3W99 B;  5F99 A;  4YM6 A;  3X1T B;  3WAA B;  5DNN C;  5B40 D;  5GT0 C;  1BH9 A;  4Z66 B;  5BNV B;  5B2I A;  3KUY C;  3UTA A;  3MGR B;  5CPJ A;  4LD9 C;  1P34 A;  3O62 B;  4G91 B;  5AV8 B;  3X1U C;  1AOI C;  1A7W A;  1P3L D;  4ZUX A;  3REL D;  3AZJ C;  3AZM D;  2NQB C;  1P3P D;  5AV5 C;  3AZK D;  3REK C;  5JRG C;  1P3O A;  3W96 C;  4J8X C;  1KX3 B;  3AZG B;  5CPK B;  1S32 C;  4CSR B;  4HGA B;  3KWQ D;  5GXQ C;  1F66 A;  5B24 C;  3AV2 C;  2F8N K;  5B2J A;  5DNM A;  3MGS D;  5AV6 A;  2IO5 C;  3AN2 D;  4Z5T A;  4J8W A;  2F8N D;  1P3G C;  1ID3 A;  3MVD D;  4J8V B;  3X1T C;  2F8N G;  3WAA C;  4JJN B;  3LZ1 D;  4Z66 C;  4CAY B;  5B40 A;  3MGR C;  5JA4 A;  4YS3 C;  2RVQ C;  4G91 C;  4J8U C;  5AV8 C;  5AVC D;  5B0Y B;  4QLC D;  1P3B B;  1P3L A;  5GT3 B;  3AFA B;  3REL A;  3AV1 D;  3WKJ D;  3AZM A;  1P3P A;  3AZK A;  4H9S C;  1KX3 C;  3W98 D;  1WWI A;  3AZL D;  5CPK C;  2PYO D;  4H9R A;  3A6N C;  5CHL B;  4YM6 B;  1TAF A;  2BYK B;  5B0Z D;  3LJA C;  4WNN A;  1ZLA B;  5B32 D;  1M19 D;  1M18 C;  3TU4 D;  3KWQ A;  2NZD D;  5AV9 D;  3X1S B;  3MGS A;  3AZH B;  3AN2 A;  2L5A A;  2F8N A;  3AYW D;  5BNX A;  1HQ3 D;  2BYM B;  4UUZ B;  3X1V B;  4KUD D;  4KGC D;  3WTP D;  4WU9 B;  3MGQ B;  1P3F B;  4J8V C;  3C1B B;  3MVD A;  3B6F B;  4JJN C;  3LZ0 D;  1P3A C;  5CPI D;  3LZ1 A;  2F8N H;  3NQU B;  5B0Y C;  1KU5 A;  1P3B C;  4X23 C;  1BH8 B;  5AVC A;  4WU8 C;  3W97 B;  3UT9 D;  4E44 A;  4QLC A;  2JSS A;  1P3K D;  5GT3 C;  3AFA C;  4E45 A;  4KHA B;  4XZQ B;  3AZI B;  3VH6 A;  3MGP D;  5BT1 C;  3AV1 A;  3WKJ A;  3AZE D;  5AVB D;  3W98 A;  4LD9 B;  4YM6 C;  3AZL A;  2PYO A;  3AZF B;  1AOI B;  1ZLA C;  1P3I B;  5B0Z A;  1HTA A;  3UTA C;  2HIO D;  5B32 A;  2NQB B;  3UTB D; 
#chains in the Genus database with same CATH topology
 4NE3 A;  3X1S C;  2NZD A;  5AV9 A;  2FJ7 B;  3REI D;  3W96 B;  3X1V C;  5C3I C;  3AYW A;  1HQ3 A;  3MGQ C;  4KUD A;  5B33 B;  4KGC A;  5BO0 A;  4H9O A;  3WTP A;  1P3F C;  4WV4 B;  4R8P B;  3C1C D;  5GXQ B;  5B24 B;  3B6F C;  1B67 A;  5B1L B;  5AY8 D;  3LZ0 A;  1BFM A;  4WU9 D;  3MNN D;  5CPI A;  5B2J C;  1TZY B;  3W97 C;  3WA9 D;  5AV6 C;  3H0R C;  1KX5 D;  2W8S A;  3UT9 A;  5CP6 B;  3AZN B;  1P3K A;  4XZQ C;  3AZI C;  3KXB D;  2Y2O A;  3MGP A;  5E5A D;  4NE6 A;  5B1M D;  4YS3 B;  3AZE A;  5G49 B;  5AVB A;  1JFI A;  4J8U B;  5FUG A;  3AZF C;  2BG1 A;  4H9P B;  1P3I C;  2CV5 B;  4EO5 B;  5GSU D;  1R4V A;  5DNN D;  2HIO A;  5GT0 D;  3UTB A;  3KUY D;  2FJ7 C;  2Y2N A;  3P5J B;  3REI A;  3X1U D;  1P3L C;  5B33 C;  4DQY B;  3A6N B;  3B6G B;  4XUJ B;  3AZJ D;  3LJA B;  2ARO D;  4R8P C;  3REJ B;  1M1A D;  1M18 B;  5AV5 D;  1B6W A;  3REK D;  5B1L C;  3C1C A;  5B31 A;  5KDM B;  5JRG D;  4J8X D;  5AY8 A;  3REH D;  4H9N B;  3V9R B;  1S32 D;  1TZY C;  3MNN A;  4H9Q A;  3WA9 A;  3AV2 D;  1U35 B;  5CP6 C;  3AZN C;  3AN2 C;  1KX5 A;  3VH5 W;  1P3G D;  3VH5 T;  1P3A B;  1P3M B;  1EQZ B;  3KXB A;  1KX4 D;  5E5A A;  5B1M A;  1H3O A;  3LEL B;  3EG5 B;  4X23 B;  2CV5 C;  4EO5 C;  3W99 D;  4WU8 B;  3X1T D;  2YFV A;  1ULY A;  1N1J A;  3WAA D;  5GSU A;  5DNN A;  4Z66 D;  3MGR D;  3B0D B;  5GT0 A;  3O62 D;  2RVQ D;  3KUY A;  1F1E A;  3NQJ A;  5AV8 D;  3B6G C;  4XUJ C;  5F99 B;  3X1U A;  3REJ C;  3AV1 C;  3AZJ A;  2ARO A;  3UTA B;  1BH9 B;  5CPJ B;  5B2I B;  1M1A A;  2ZY5 A;  3R45 A;  5AV5 A;  3REK A;  3W98 C;  1P34 B;  3AZL C;  1KX3 D;  5JRG A;  2G5H C;  2YFW A;  3AZG D;  5CPK D;  4J8X A;  4ZUX B;  3REH A;  5B32 C;  5C3I B;  4ZBJ B;  1S32 A;  1U35 C;  5BS7 C;  1P3O B;  3AV2 A;  1P3M C;  4KGC C;  3EPL A;  3WTP C;  1EQZ C;  1P3G A;  2VQR A;  1F66 B;  1KX4 A;  3LEL C;  5B2J B;  5DNM B;  5B31 B;  4J8V D;  5AV6 B;  4Z5T B;  4J8W B;  3W99 A;  3X1T A;  3WAA A;  4JJN D;  3B0D C;  5BNV A;  4Z66 A;  3MGR A;  1ID3 B;  5B0Y D;  3O62 A;  1P3B D;  5F99 C;  5AV8 A;  4WZS B;  5GT3 D;  3AFA D;  5CPJ C;  5B2I C;  5B40 B;  3MGP C;  1W2E A;  5JA4 B;  3AZE C;  5AVB C;  1P34 C;  4H9S A;  1KX3 A;  4ZUX C;  4YM6 D;  2YFV B;  3AZG A;  5CPK A;  1P3L B;  4ZBJ C;  3REL B;  4CSR A;  1ZLA D;  3AZM B;  1P3P B;  3AZK B;  1P3O C;  2JE5 A;  1Z2C B;  3X1S D;  2LY8 A;  3AZH D;  4H9R B;  4Z2M G;  2Y2K A;  1TAF B;  3X1V D;  4WNN B;  1F66 C;  3MGQ D;  5DNM C;  1P3F D;  3KWQ B;  5B31 C;  3C1B D;  4NE5 A;  4Z5T C;  4J8W C;  1PZR A;  3B6F D;  3MGS B;  4J8V A;  3B0C W;  3AN2 B;  3B0C T;  2F8N B;  5BNX B;  3F6T A;  4JJN A;  4CAY A;  2CWE A;  1ID3 C;  3W97 D;  2ZY3 A;  3MVD B;  1P3B A;  5B40 C;  5GT3 A;  4XZQ D;  3AFA A;  3AZI D;  3LZ1 B;  3FDD A;  5B1M C;  5AVC B;  4LD9 D;  3B0B A;  4QLC B;  2HUE C;  3AZF D;  3REL C;  1AOI D;  5GSU C;  1P3I D;  2BYK A;  3AZM C;  3H0L C;  1P3P C;  1ZLA A;  3AZK C;  3AV1 B;  2NQB D;  3WKJ B;  3W98 B;  3X1S A;  2FJ7 D;  3AZH A;  3AZL B;  2PYO B;  3W96 D;  3VH5 A;  2BYM A;  4UUZ A;  5B33 D;  5B0Z B;  2ARO C;  3X1V A;  4WU9 A;  1M1A C;  3KWQ C;  3MGQ A;  5B32 B;  1M19 B;  4R8P D;  3TU4 B;  4Z2M H;  5GXQ D;  1P3F A;  5B24 D;  3MGS C;  2NZD B;  3C1B A;  5AV9 B;  2XD5 A;  5B1L D;  2Y2M A;  3B6F A;  3KSY A;  3REH C;  3AYW B;  1HQ3 B;  4KGC B;  4KUD B;  5BO0 B;  4H9O B;  3WTP B;  4AWL C;  1TZY D;  3NQU A;  3MVD C;  1BH8 A;  3W97 A;  5CP6 D;  3AZN D;  2Y2H A;  3LZ1 C;  3LZ0 B;  3AL0 C;  4KHA A;  4XZQ A;  3AZI A;  5CPI B;  1KX4 C;  5AVC C;  4YS3 D;  4J8U D;  4QLC C;  3W99 C;  4LD9 A;  3UT9 B;  2CV5 D;  3AZF A;  2DQN C;  1P3K B;  1AOI A;  1P3I A;  3WKJ C;  3MGP B;  2NQB A;  3O62 C;  3AZE B;  3KFU G;  5AVB B;  1JFI B;  2PYO C;  5FUG B;  2FJ7 A;  3W96 A;  5B0Z C;  3A6N D;  4XUJ D;  4NFT A;  3B6G D;  1M19 C;  5B33 A;  3LJA D;  2F2A C;  3REJ D;  3TU4 C;  2HIO B;  1M18 D;  2NZD C;  5AV9 C;  4R8P A;  3UTB B;  1Q9C A;  5GXQ A;  5B24 A;  5B1L A;  3AZG C;  2UWX A;  3REI B;  3AYW C;  1HQ3 C;  4KUD C;  4HGA C;  4DRA A;  1TZY A;  4G92 B;  3C1C B;  1U35 D;  3LZ0 C;  5CP6 A;  3AZN A;  5AY8 B;  5CPI C;  2XD1 A;  4M6B A;  1P3A D;  5B32 G;  1P3M D;  1EQZ D;  3MNN B;  4YS3 A;  4H9Q B;  5G49 A;  3UT9 C;  3WA9 B;  3LEL D;  4J8U A;  4X23 D;  4WU8 D;  1P3K C;  1KX5 B;  4H9P A;  2CV5 A;  3KXB B;  5BT1 D;  5E5A B;  5B1M B;  1H3O B;  2FFF B;  5F99 D;  2RIQ A;  1N1J B;  3A6N A;  2HUE B;  4XUJ A;  3B6G A;  2HIO C;  1WWS A;  5GSU B;  3LJA A;  5CPJ D;  5DNN B;  3REJ A;  5B2I D;  3UTA D;  3UTB C;  1M18 A;  5GT0 B;  1P34 D;  3KUY B;  3NQJ B;  5KDM A;  3REI C;  4ZUX D;  3X1U B;  4H9N A;  3V9R A;  3WTP E;  3AZJ B;  4DRB A;  2ARO B;  2ZY2 A;  4G92 C;  3VH6 W;  3C1C C;  1M1A B;  3VH6 T;  2Y2Q A;  3R45 B;  5AV5 B;  1P3O D;  3REK B;  3AZH C;  1U35 A;  5BS7 A;  5AY8 C;  2Y2J A;  5JRG B;  2YFW B;  4J8X B;  4WU9 C;  3MNN C;  3REH B;  1P3A A;  3A1I A;  1P3M A;  1S32 B;  1M19 A;  1EQZ A;  1F66 D;  3WA9 C;  3C1B C;  4AWL B;  5B2J D;  5DNM D;  1KX5 C;  5B31 D;  5B0Y A;  5AV6 D;  3AV2 B;  3LEL A;  4Z5T D;  4X23 A;  4J8W D;  4WU8 A;  3TU4 A;  2IO5 B;  2Y2P A;  3KXB C;  1P3G B;  5E5A C;  2Y2I A;  5B31 G;  1KX4 B;  1ID3 D;  3W99 B;  5F99 A;  4YM6 A;  3EPK A;  3X1T B;  3WAA B;  5DNN C;  2ZM5 A;  5B40 D;  5GT0 C;  1BH9 A;  4Z66 B;  5BNV B;  5B2I A;  3KUY C;  3UTA A;  3MGR B;  5CPJ A;  4LD9 C;  1P34 A;  3O62 B;  4G91 B;  5AV8 B;  3X1U C;  1AOI C;  1A7W A;  1P3L D;  4ZUX A;  3REL D;  3AZJ C;  3AZM D;  2NQB C;  1P3P D;  5AV5 C;  3AZK D;  3REK C;  5JRG C;  1P3O A;  3W96 C;  4J8X C;  1KX3 B;  3AZG B;  5CPK B;  1S32 C;  4CSR B;  4HGA B;  3KWQ D;  5GXQ C;  1F66 A;  5B24 C;  3AV2 C;  2F8N K;  5B2J A;  5DNM A;  3MGS D;  5AV6 A;  2IO5 C;  3AN2 D;  4Z5T A;  4J8W A;  2ZY4 A;  3IP4 C;  2F8N D;  1P3G C;  1ID3 A;  3MVD D;  4J8V B;  3X1T C;  1T3U A;  2F8N G;  3WAA C;  2G5I C;  2DF4 C;  4JJN B;  3LZ1 D;  4Z66 C;  4CAY B;  5B40 A;  3MGR C;  5JA4 A;  4YS3 C;  2RVQ C;  4G91 C;  4J8U C;  5AV8 C;  5AVC D;  5B0Y B;  2J8P A;  4QLC D;  1P3B B;  1P3L A;  4WJ3 C;  5GT3 B;  3AFA B;  3REL A;  3AV1 D;  3WKJ D;  3AZM A;  1P3P A;  3A1K A;  3AZK A;  4H9S C;  1KX3 C;  3W98 D;  1WWI A;  3AZL D;  5CPK C;  2PYO D;  4H9R A;  3A6N C;  5CHL B;  4YM6 B;  1TAF A;  2BYK B;  5B0Z D;  3LJA C;  4WNN A;  1ZLA B;  5B32 D;  1M19 D;  1M18 C;  3TU4 D;  3KWQ A;  2NZD D;  2Y2G A;  5AV9 D;  3X1S B;  3MGS A;  3AZH B;  3AN2 A;  2L5A A;  2F8N A;  3AYW D;  5BNX A;  1HQ3 D;  2BYM B;  4UUZ B;  3X1V B;  4KUD D;  4KGC D;  4UPK A;  3WTP D;  4WU9 B;  3MGQ B;  3H0M C;  1P3F B;  4J8V C;  3C1B B;  3EPH A;  3MVD A;  3B6F B;  4JJN C;  3LZ0 D;  1P3A C;  5CPI D;  3LZ1 A;  2F8N H;  3NQU B;  5B0Y C;  1KU5 A;  1P3B C;  4X23 C;  1BH8 B;  5AVC A;  4WU8 C;  3W97 B;  3UT9 D;  4E44 A;  4QLC A;  2JSS A;  1P3K D;  5GT3 C;  3AFA C;  4E45 A;  4XZQ B;  4KHA B;  2Y2L A;  3VH6 A;  3AZI B;  3MGP D;  5BT1 C;  3AV1 A;  3WKJ A;  3AZE D;  5AVB D;  2JCH A;  3W98 A;  4LD9 B;  3EPJ A;  4YM6 C;  3AZL A;  2PYO A;  3AZF B;  1AOI B;  1ZLA C;  1P3I B;  5B0Z A;  1HTA A;  3UTA C;  2HIO D;  5B32 A;  2NQB B;  3UTB D; 
#chains in the Genus database with same CATH homology
 4NE3 A;  3X1S C;  2NZD A;  5AV9 A;  2FJ7 B;  3REI D;  3W96 B;  3X1V C;  5C3I C;  3AYW A;  1HQ3 A;  3MGQ C;  4KUD A;  5B33 B;  4KGC A;  5BO0 A;  4H9O A;  3WTP A;  1P3F C;  4WV4 B;  4R8P B;  3C1C D;  5GXQ B;  5B24 B;  3B6F C;  1B67 A;  5B1L B;  5AY8 D;  3LZ0 A;  1BFM A;  4WU9 D;  3MNN D;  5CPI A;  5B2J C;  1TZY B;  3W97 C;  3WA9 D;  5AV6 C;  3H0R C;  1KX5 D;  2W8S A;  3UT9 A;  5CP6 B;  3AZN B;  1P3K A;  4XZQ C;  3AZI C;  3KXB D;  2Y2O A;  3MGP A;  5E5A D;  4NE6 A;  5B1M D;  4YS3 B;  3AZE A;  5G49 B;  5AVB A;  1JFI A;  4J8U B;  5FUG A;  3AZF C;  2BG1 A;  4H9P B;  1P3I C;  2CV5 B;  4EO5 B;  5GSU D;  1R4V A;  5DNN D;  2HIO A;  5GT0 D;  3UTB A;  3KUY D;  2FJ7 C;  2Y2N A;  3P5J B;  3REI A;  3X1U D;  1P3L C;  5B33 C;  4DQY B;  3A6N B;  3B6G B;  4XUJ B;  3AZJ D;  3LJA B;  2ARO D;  4R8P C;  3REJ B;  1M1A D;  1M18 B;  5AV5 D;  1B6W A;  3REK D;  5B1L C;  3C1C A;  5B31 A;  5KDM B;  5JRG D;  4J8X D;  5AY8 A;  3REH D;  4H9N B;  3V9R B;  1S32 D;  1TZY C;  3MNN A;  4H9Q A;  3WA9 A;  3AV2 D;  1U35 B;  5CP6 C;  3AZN C;  3AN2 C;  1KX5 A;  3VH5 W;  1P3G D;  3VH5 T;  1P3A B;  1P3M B;  1EQZ B;  3KXB A;  1KX4 D;  5E5A A;  5B1M A;  1H3O A;  3LEL B;  3EG5 B;  4X23 B;  2CV5 C;  4EO5 C;  3W99 D;  4WU8 B;  3X1T D;  2YFV A;  1ULY A;  1N1J A;  3WAA D;  5GSU A;  5DNN A;  4Z66 D;  3MGR D;  3B0D B;  5GT0 A;  3O62 D;  2RVQ D;  3KUY A;  1F1E A;  3NQJ A;  5AV8 D;  3B6G C;  4XUJ C;  5F99 B;  3X1U A;  3REJ C;  3AV1 C;  3AZJ A;  2ARO A;  3UTA B;  1BH9 B;  5CPJ B;  5B2I B;  1M1A A;  2ZY5 A;  3R45 A;  5AV5 A;  3REK A;  3W98 C;  1P34 B;  3AZL C;  1KX3 D;  5JRG A;  2G5H C;  2YFW A;  3AZG D;  5CPK D;  4J8X A;  4ZUX B;  3REH A;  5B32 C;  5C3I B;  4ZBJ B;  1S32 A;  1U35 C;  5BS7 C;  1P3O B;  3AV2 A;  1P3M C;  4KGC C;  3EPL A;  3WTP C;  1EQZ C;  1P3G A;  2VQR A;  1F66 B;  1KX4 A;  3LEL C;  5B2J B;  5DNM B;  5B31 B;  4J8V D;  5AV6 B;  4Z5T B;  4J8W B;  3W99 A;  3X1T A;  3WAA A;  4JJN D;  3B0D C;  5BNV A;  4Z66 A;  3MGR A;  1ID3 B;  5B0Y D;  3O62 A;  1P3B D;  5F99 C;  5AV8 A;  4WZS B;  5GT3 D;  3AFA D;  5CPJ C;  5B2I C;  5B40 B;  3MGP C;  1W2E A;  5JA4 B;  3AZE C;  5AVB C;  1P34 C;  4H9S A;  1KX3 A;  4ZUX C;  4YM6 D;  2YFV B;  3AZG A;  5CPK A;  1P3L B;  4ZBJ C;  3REL B;  4CSR A;  1ZLA D;  3AZM B;  1P3P B;  3AZK B;  1P3O C;  2JE5 A;  1Z2C B;  3X1S D;  2LY8 A;  3AZH D;  4H9R B;  4Z2M G;  2Y2K A;  1TAF B;  3X1V D;  4WNN B;  1F66 C;  3MGQ D;  5DNM C;  1P3F D;  3KWQ B;  5B31 C;  3C1B D;  4NE5 A;  4Z5T C;  4J8W C;  1PZR A;  3B6F D;  3MGS B;  4J8V A;  3B0C W;  3AN2 B;  3B0C T;  2F8N B;  5BNX B;  3F6T A;  4JJN A;  4CAY A;  2CWE A;  1ID3 C;  3W97 D;  2ZY3 A;  3MVD B;  1P3B A;  5B40 C;  5GT3 A;  4XZQ D;  3AFA A;  3AZI D;  3LZ1 B;  3FDD A;  5B1M C;  5AVC B;  4LD9 D;  3B0B A;  4QLC B;  2HUE C;  3AZF D;  3REL C;  1AOI D;  5GSU C;  1P3I D;  2BYK A;  3AZM C;  3H0L C;  1P3P C;  1ZLA A;  3AZK C;  3AV1 B;  2NQB D;  3WKJ B;  3W98 B;  3X1S A;  2FJ7 D;  3AZH A;  3AZL B;  2PYO B;  3W96 D;  3VH5 A;  2BYM A;  4UUZ A;  5B33 D;  5B0Z B;  2ARO C;  3X1V A;  4WU9 A;  1M1A C;  3KWQ C;  3MGQ A;  5B32 B;  1M19 B;  4R8P D;  3TU4 B;  4Z2M H;  5GXQ D;  1P3F A;  5B24 D;  3MGS C;  2NZD B;  3C1B A;  5AV9 B;  2XD5 A;  5B1L D;  2Y2M A;  3B6F A;  3KSY A;  3REH C;  3AYW B;  1HQ3 B;  4KGC B;  4KUD B;  5BO0 B;  4H9O B;  3WTP B;  4AWL C;  1TZY D;  3NQU A;  3MVD C;  1BH8 A;  3W97 A;  5CP6 D;  3AZN D;  2Y2H A;  3LZ1 C;  3LZ0 B;  3AL0 C;  4KHA A;  4XZQ A;  3AZI A;  5CPI B;  1KX4 C;  5AVC C;  4YS3 D;  4J8U D;  4QLC C;  3W99 C;  4LD9 A;  3UT9 B;  2CV5 D;  3AZF A;  2DQN C;  1P3K B;  1AOI A;  1P3I A;  3WKJ C;  3MGP B;  2NQB A;  3O62 C;  3AZE B;  3KFU G;  5AVB B;  1JFI B;  2PYO C;  5FUG B;  2FJ7 A;  3W96 A;  5B0Z C;  3A6N D;  4XUJ D;  4NFT A;  3B6G D;  1M19 C;  5B33 A;  3LJA D;  2F2A C;  3REJ D;  3TU4 C;  2HIO B;  1M18 D;  2NZD C;  5AV9 C;  4R8P A;  3UTB B;  1Q9C A;  5GXQ A;  5B24 A;  5B1L A;  3AZG C;  2UWX A;  3REI B;  3AYW C;  1HQ3 C;  4KUD C;  4HGA C;  4DRA A;  1TZY A;  4G92 B;  3C1C B;  1U35 D;  3LZ0 C;  5CP6 A;  3AZN A;  5AY8 B;  5CPI C;  2XD1 A;  4M6B A;  1P3A D;  5B32 G;  1P3M D;  1EQZ D;  3MNN B;  4YS3 A;  4H9Q B;  5G49 A;  3UT9 C;  3WA9 B;  3LEL D;  4J8U A;  4X23 D;  4WU8 D;  1P3K C;  1KX5 B;  4H9P A;  2CV5 A;  3KXB B;  5BT1 D;  5E5A B;  5B1M B;  1H3O B;  2FFF B;  5F99 D;  2RIQ A;  1N1J B;  3A6N A;  2HUE B;  4XUJ A;  3B6G A;  2HIO C;  1WWS A;  5GSU B;  3LJA A;  5CPJ D;  5DNN B;  3REJ A;  5B2I D;  3UTA D;  3UTB C;  1M18 A;  5GT0 B;  1P34 D;  3KUY B;  3NQJ B;  5KDM A;  3REI C;  4ZUX D;  3X1U B;  4H9N A;  3V9R A;  3WTP E;  3AZJ B;  4DRB A;  2ARO B;  2ZY2 A;  4G92 C;  3VH6 W;  3C1C C;  1M1A B;  3VH6 T;  2Y2Q A;  3R45 B;  5AV5 B;  1P3O D;  3REK B;  3AZH C;  1U35 A;  5BS7 A;  5AY8 C;  2Y2J A;  5JRG B;  2YFW B;  4J8X B;  4WU9 C;  3MNN C;  3REH B;  1P3A A;  3A1I A;  1P3M A;  1S32 B;  1M19 A;  1EQZ A;  1F66 D;  3WA9 C;  3C1B C;  4AWL B;  5B2J D;  5DNM D;  1KX5 C;  5B31 D;  5B0Y A;  5AV6 D;  3AV2 B;  3LEL A;  4Z5T D;  4X23 A;  4J8W D;  4WU8 A;  3TU4 A;  2IO5 B;  2Y2P A;  3KXB C;  1P3G B;  5E5A C;  2Y2I A;  5B31 G;  1KX4 B;  1ID3 D;  3W99 B;  5F99 A;  4YM6 A;  3EPK A;  3X1T B;  3WAA B;  5DNN C;  2ZM5 A;  5B40 D;  5GT0 C;  1BH9 A;  4Z66 B;  5BNV B;  5B2I A;  3KUY C;  3UTA A;  3MGR B;  5CPJ A;  4LD9 C;  1P34 A;  3O62 B;  4G91 B;  5AV8 B;  3X1U C;  1AOI C;  1A7W A;  1P3L D;  4ZUX A;  3REL D;  3AZJ C;  3AZM D;  2NQB C;  1P3P D;  5AV5 C;  3AZK D;  3REK C;  5JRG C;  1P3O A;  3W96 C;  4J8X C;  1KX3 B;  3AZG B;  5CPK B;  1S32 C;  4CSR B;  4HGA B;  3KWQ D;  5GXQ C;  1F66 A;  5B24 C;  3AV2 C;  2F8N K;  5B2J A;  5DNM A;  3MGS D;  5AV6 A;  2IO5 C;  3AN2 D;  4Z5T A;  4J8W A;  2ZY4 A;  3IP4 C;  2F8N D;  1P3G C;  1ID3 A;  3MVD D;  4J8V B;  3X1T C;  1T3U A;  2F8N G;  3WAA C;  2G5I C;  2DF4 C;  4JJN B;  3LZ1 D;  4Z66 C;  4CAY B;  5B40 A;  3MGR C;  5JA4 A;  4YS3 C;  2RVQ C;  4G91 C;  4J8U C;  5AV8 C;  5AVC D;  5B0Y B;  2J8P A;  4QLC D;  1P3B B;  1P3L A;  4WJ3 C;  5GT3 B;  3AFA B;  3REL A;  3AV1 D;  3WKJ D;  3AZM A;  1P3P A;  3A1K A;  3AZK A;  4H9S C;  1KX3 C;  3W98 D;  1WWI A;  3AZL D;  5CPK C;  2PYO D;  4H9R A;  3A6N C;  5CHL B;  4YM6 B;  1TAF A;  2BYK B;  5B0Z D;  3LJA C;  4WNN A;  1ZLA B;  5B32 D;  1M19 D;  1M18 C;  3TU4 D;  3KWQ A;  2NZD D;  2Y2G A;  5AV9 D;  3X1S B;  3MGS A;  3AZH B;  3AN2 A;  2L5A A;  2F8N A;  3AYW D;  5BNX A;  1HQ3 D;  2BYM B;  4UUZ B;  3X1V B;  4KUD D;  4KGC D;  4UPK A;  3WTP D;  4WU9 B;  3MGQ B;  3H0M C;  1P3F B;  4J8V C;  3C1B B;  3EPH A;  3MVD A;  3B6F B;  4JJN C;  3LZ0 D;  1P3A C;  5CPI D;  3LZ1 A;  2F8N H;  3NQU B;  5B0Y C;  1KU5 A;  1P3B C;  4X23 C;  1BH8 B;  5AVC A;  4WU8 C;  3W97 B;  3UT9 D;  4E44 A;  4QLC A;  2JSS A;  1P3K D;  5GT3 C;  3AFA C;  4E45 A;  4XZQ B;  4KHA B;  2Y2L A;  3VH6 A;  3AZI B;  3MGP D;  5BT1 C;  3AV1 A;  3WKJ A;  3AZE D;  5AVB D;  2JCH A;  3W98 A;  4LD9 B;  3EPJ A;  4YM6 C;  3AZL A;  2PYO A;  3AZF B;  1AOI B;  1ZLA C;  1P3I B;  5B0Z A;  1HTA A;  3UTA C;  2HIO D;  5B32 A;  2NQB B;  3UTB D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...