3UT9B

Crystal structure of nucleosome core particle assembled with a palindromic widom '601' derivative (ncp-601l)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
79
structure length
79
Chain Sequence
DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title The mechanics behind DNA sequence-dependent properties of the nucleosome
pubmed doi rcsb
source organism Xenopus laevis
total genus 29
structure length 79
sequence length 79
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3ut9B00
4YM6D 3AZNB 3AV1D 1HQ3D 1P3MC 5B1MC 3A6ND 1F1EA 5B1MA 5AVCC 3WTPD 3AZFD 1P3LC 5AVCA 3LZ1B 1P3LA 5B2JD 1N1JA 5AV5A 3B6GB 3UTAB 5CPKB 3MGQD 3R45A 5CPID 4Z2MH 3W98C 5AY8B 4DRAA 1P3FB 3W98A 4X23B 3AFAC 3AFAA 3AZLA 3KWQC 5JRGC 4WNNB 3KWQA 5JRGA 1H3OA 5B1MB 4LD9C 5F99C 5AVCB 1P3LB 1N1JB 1F66D 5GSUD 5AV5B 3WA9D 3R45B 4R8PC 4EO5C 4R8PA 3LELC 3W98B 2YFWA 3LELA 5B0YC 3AFAB 3AZLB 2AROD 1KX3C 3AZHC 3KWQB 1KX3A 5JRGB 3AZHA 1H3OB 3VH5W 3C1CA 3X1UC 2F8NA 3W99C 3B6GD 3UTAD 3X1UA 3MGRC 3C1BC 5B31C 5DNNC 5AY8D 1P3FD 3C1BA 5B31A 4X23D 5DNNA 3MVDA 4R8PB 1U35C 3AN2C 5JA4A 4NFTA 4EO5B 2YFWB 5B32C 3LELB 1U35A 3AN2A 5B32A 4WZSB 1KX3B 3AZHB 3AV2A 3MNNC 1P3ID 5AVCD 2L5AA 3MNNA 1ULYA 5AV5D 2F8NB 3X1UB 5B1LC 5B1LA 3TU4C 3VH6W 3C1BB 3W98D 5B31B 3TU4A 5DNNB 3MVDB 5DNMC 3AFAD 3AZLD 5JA4B 4KUDA 1U35B 3AN2B 1P3KD 3KWQD 5B32B 3MGSC 5JRGD 3X1TC 3MGSA 4KHAA 3X1TA 3AV2B 3MNNB 3WTPC 1M18D 3AZEC 3B6FC 3WTPA 3AZKC 5B2JC 4WU8C 3AZEA 3B6FA 4WU8A 5B1LB 5B2JA 4J8XD 3AZKA 4R8PD 3TU4B 5CPIC 3LELD 4XZQA 2F8NK 4KUDB 2LY8A 4YS3A 1TZYD 1KX3D 4G92C 3MGSB 4KHAB 3C1CD 3X1TB 3REIC 3NQJA 3REIA 1AOIC 4Z66A 3WKJC 3WTPB 3V9RA 3C1BD 1AOIA 5B31D 1F66C 2YFVA 5GSUC 3MVDD 3AZEB 4WU8B 5B2JB 3REHA 3AZKB 1F66A 3B6FB 4J8UA 1U35D 4XZQB 5B32D 5CPIB 4YS3B 4H9NA 3REJD 2AROC 3W96C 3AV2D 4G92B 2AROA 3W96A 4DRBA 3MNND 3NQJB 3REIB 3B6GC 3UTAC 5B1LD 4Z66B 2BYKA 3V9RB 1AOIB 3WKJB 3TU4D 2YFVB 3X1SC 5AY8C 1F66B 3X1SA 4X23C 4KUDD 4J8UB 3MGSD 4H9NB 5GT3C 2PYOC 3X1TD 5GT3A 2PYOA 2AROB 3W96B 3WA9B 1P3IC 5AV5C 3AZED 1P3IA 3B6FD 3AZKD 4WU8D 2BYKB 3MGPC 5GXQC 3MGPA 4XZQD 5CP6C 3X1SB 5GXQA 5CP6A 4G91C 4YS3D 3AZLC 1P3KC 3O62A 1BH8A 1P3KA 5GT3B 2PYOB 3REID 1BH9A 4Z66D 3AYWC 1AOID 1M18C 3WKJD 1P3IB 4WU9C 3AYWA 3REHD 1M18A 4WU9A 5BNXA 4ZUXA 4J8XC 4J8UD 3MGPB 1KX5A 5GXQB 4CSRA 4J8XA 5AV9C 3RELA 2CWEA 3UTBD 5CP6B 2FJ7A 5AV9A 4G91B 2NQBC 5GT0A 2NQBA 1TZYC 3W96D 1BH8B 1P3KB 3WTPE 1TZYA 3C1CC 4XUJA 1BH9B 3AYWB 1M18B 3X1SD 3AZIC 5BNXB 4ZUXB 4WU9B 3MVDC 3AZIA 1KX5B 4J8XB 4CSRB 3RELB 2FJ7B 5AVBD 5AV9B 5GT3D 2PYOD 1BFMA 5GT0B 2NQBB 3REJC 1B67A 3AV2C 1TZYB 3REJA 3VH5A 4E45A 2CV5C 5B2IA 5B0ZD 3X1VC 3C1CB 2CV5A 5AY8A 3X1VA 1M1AC 4J8VA 3MGPD 1M1AA 5GXQD 5CP6D 3AZIB 4M6BA 4KUDC 3B0CT 4KGCA 3O62D 1P3OC 1KX4C 1P3OA 2BYMA 1KX4A 5KDMA 3REJB 3WKJA 5FUGA 1P3BA 5B2IB 3AYWD 1EQZC 2CV5B 4WU9D 4ZUXD 3X1VB 1EQZA 4J8VB 3VH6A 1P3PC 1M1AB 1KX5D 3RELD 4CAYA 1P3PA 2FJ7D 4XZQC 5AV9D 4H9RA 4KGCB 4YS3C 5GT0D 2NQBD 1M19A 2IO5C 4ZBJC 1P3OB 2BYMB 1KX4B 1KU5A 5KDMB 4XUJD 5FUGB 4Z66C 1P3BB 3LJAA 1EQZB 1P3GA 3REHC 1WWIA 3AZID 4H9SC 3LZ0C 4CAYB 4J8UC 1P3PB 4H9SA 3LZ0A 4H9RB 4NE3A 3UTBC 4J8WC 3UTBA 4J8WA 1M19B 2IO5B 4ZBJB 5B2ID 3KXBC 1ZLAD 2CV5D 4UUZA 3KXBA 3X1VD 5AV6A 4NE6A 4J8VD 1S32A 5BO0A 1M1AD 4QLCC 3LJAB 1P3GB 4QLCA 5B40D 1A7WA 3REHB 4KGCD 3LZ0B 2HIOA 5AVBC 3UTBB 1P3OD 4J8WB 1KX4D 5AVBA 1JFIA 4Z5TD 3VH5T 3AZNA 3AZMC 1P3BD 5BT1D 3KSYA 3AZMA 4UUZB 3KXBB 1EQZD 5AV6B 5B0ZC 1S32B 4JJNC 5BO0B 5B0ZA 5AV8C 4JJNA 3AZGD 2NZDC 1P3PD 4QLCB 5AV8A 3LZ1A 2NZDA 4E44A 1M19D 2HIOB 3O62C 1P34C 1TAFA 1JFIB 5AVBB 1P34A 2F8NG 2JSSA 4H9QA 4WNNA 3AZMB 3LJAD 1P3GD 3VH6T 5CPJD 1P3MA 5B31G 4ZUXC 5B0ZB 4JJNB 5B33C 3LZ0D 5AV8B 3KUYC 5B33A 1KX5C 2NZDB 3RELC 3KUYA 2FJ7C 5B32G 4J8WD 3AZJD 5GT0C 1TAFB 3O62B 1P34B 5BS7C 4H9QB 5BS7A 3KXBD 4XUJC 5AV6D 1S32D 3B0BA 4H9PA 4AWLC 4QLCD 1P3MB 3UT9D 1HTAA 4LD9A 5B33B 5F99A 3KUYB 2HIOD 4HGAC 3AZND 3AZMD 3REKC 1B6WA 5B0YA 5B2IC 1ZLAC 3REKA 5C3IC 4XUJB 1ZLAA 4JJND 4H9PB 1R4VA 4J8VC 1ID3C 5AV8D 3LZ1D 4AWLB 2NZDD 1ID3A 5CPKD 5B40C 3W99A 4LD9B 5B40A 5F99B 5G49A 4KGCC 3WAAC 3MGRA 3WAAA 5B24C 1P34D 5B24A 4HGAB 2HUEC 4Z5TC 5CHLB 3W97C 2F8NH 3B0DC 2RVQC 3W97A 4Z5TA 5B0YB 1P3BC 5BT1C 3REKB 1P3MD 5B1MD 1ZLAB 5C3IB 5E5AC 1P3LD 5B33D 1P3AC 5E5AA 3AZGC 1ID3B 3KUYD 1P3AA 3W99B 3AZGA 5B40B 5G49B 3MGRB 3WAAB 5BNVA 1M19C 5B24B 5DNMA 4H9OA 4YM6C 2HUEB 4YM6A 4Z5TB 3W97B 3B0DB 3AV1C 1HQ3C 3LJAC 3AV1A 1P3GC 3A6NC 1HQ3A 5CPJC 1Q9CA 4LD9D 5F99D 3A6NA 5E5AB 3AZFC 5CPJA 1P3AB 3AZFA 3AZGB 3MGQC 4Z2MG 3MGQA 5BNVB 3AZJC 5CPIA 4WV4B 3AZJA 5DNMB 4H9OB 5B0YD 3REKD 4YM6B 3AZHD 5AV6C 1S32C 2F8ND 1ID3D 3AV1B 1HQ3B 3X1UD 3W99D 3UT9C 3A6NB 5CPJB 3UT9A 3MGRD 3AZFB 3WAAD 5DNND 2HIOC 5GSUA 5B24D 3NQUA 3WA9C 3MGQB 3WA9A 3AN2D 3AZNC 3AZJB 3W97D 3B0CW 2RVQD 1WWSA 5E5AD 1P3AD 3LZ1C 5CPKC 3UT9B 3B6GA 4NE5A 3UTAA 5CPKA 5GSUB 1P3FC 3NQUB 5DNMD 1P3FA 4X23A
chains in the Genus database with same CATH superfamily
4YM6D 4UPKA 3AZNB 3AV1D 1HQ3D 1P3MC 5B1MC 3A6ND 1F1EA 5B1MA 5AVCC 3WTPD 3AZFD 1P3LC 2Y2KA 5AVCA 3LZ1B 1P3LA 5B2JD 1N1JA 5AV5A 3B6GB 3UTAB 5CPKB 3MGQD 3R45A 5CPID 4Z2MH 3W98C 5AY8B 4DRAA 1P3FB 3W98A 4X23B 3AFAC 3AFAA 3AZLA 3KWQC 5JRGC 4WNNB 3KWQA 5JRGA 1H3OA 3EPJA 5B1MB 4LD9C 5F99C 5AVCB 1P3LB 1N1JB 1F66D 5GSUD 5AV5B 3WA9D 3R45B 4R8PC 4EO5C 3H0RC 4R8PA 3LELC 3W98B 2YFWA 3LELA 5B0YC 3AFAB 3AZLB 3EPHA 2AROD 1KX3C 3AZHC 2Y2MA 3KWQB 1KX3A 5JRGB 3AZHA 1H3OB 3VH5W 3C1CA 3X1UC 2F8NA 3W99C 3B6GD 3UTAD 3X1UA 3MGRC 3C1BC 5B31C 5DNNC 5AY8D 1P3FD 3C1BA 5B31A 4X23D 5DNNA 2G5HC 3MVDA 4R8PB 1U35C 3AN2C 5JA4A 4NFTA 4EO5B 2YFWB 5B32C 3LELB 1U35A 3AN2A 5B32A 4WZSB 1KX3B 3AZHB 3AV2A 3MNNC 1P3ID 5AVCD 2L5AA 3MNNA 1ULYA 5AV5D 2F8NB 3X1UB 5B1LC 5B1LA 3TU4C 3VH6W 3C1BB 3W98D 5B31B 3TU4A 5DNNB 2RIQA 3MVDB 5DNMC 3AFAD 3AZLD 5JA4B 4KUDA 1U35B 3AN2B 1P3KD 3KWQD 5B32B 3MGSC 5JRGD 3X1TC 3MGSA 4KHAA 3X1TA 2ZY5A 3AV2B 3MNNB 3WTPC 2Y2HA 1M18D 3AZEC 3B6FC 3WTPA 3AZKC 5B2JC 4WU8C 3AZEA 3B6FA 4WU8A 5B1LB 5B2JA 4J8XD 3AZKA 4R8PD 3TU4B 5CPIC 3LELD 4XZQA 2F8NK 4KUDB 2LY8A 2FFFB 4YS3A 1TZYD 1KX3D 4G92C 3MGSB 4KHAB 3C1CD 3X1TB 3REIC 3NQJA 3REIA 1AOIC 4Z66A 3WKJC 3WTPB 3V9RA 3C1BD 1AOIA 5B31D 1F66C 2YFVA 5GSUC 3MVDD 3AZEB 4WU8B 5B2JB 3REHA 2J8PA 3AZKB 1F66A 3B6FB 4J8UA 1U35D 4XZQB 5B32D 5CPIB 4YS3B 4H9NA 2DQNC 3REJD 2AROC 3W96C 3AV2D 4G92B 2AROA 3W96A 4DRBA 3MNND 3NQJB 3REIB 3B6GC 3UTAC 5B1LD 4Z66B 2BYKA 3V9RB 1AOIB 3WKJB 3TU4D 2YFVB 3X1SC 5AY8C 1F66B 2UWXA 3X1SA 4X23C 4KUDD 1PZRA 4J8UB 3MGSD 4H9NB 5GT3C 2PYOC 3X1TD 5GT3A 2PYOA 2AROB 3W96B 3WA9B 1P3IC 2Y2OA 5AV5C 3AZED 1P3IA 3B6FD 3AZKD 4WU8D 2BYKB 3MGPC 5GXQC 3MGPA 4XZQD 5CP6C 3X1SB 5GXQA 2ZM5A 2JCHA 5CP6A 4G91C 4YS3D 3AZLC 1P3KC 3O62A 1BH8A 1P3KA 5GT3B 2PYOB 3REID 1BH9A 4Z66D 3AYWC 1AOID 1M18C 3WKJD 1P3IB 4WU9C 3AYWA 3REHD 3A1IA 1M18A 4WU9A 5BNXA 4ZUXA 4J8XC 4J8UD 3MGPB 2ZY2A 1KX5A 5GXQB 4CSRA 4J8XA 5AV9C 3RELA 2CWEA 3UTBD 5CP6B 2FJ7A 5AV9A 4G91B 2NQBC 5GT0A 2NQBA 1TZYC 3W96D 1BH8B 1P3KB 3WTPE 1TZYA 3C1CC 3EPLA 4XUJA 1BH9B 2G5IC 3AYWB 1M18B 3H0MC 3X1SD 3AZIC 5BNXB 4ZUXB 4WU9B 3MVDC 3AZIA 3KFUG 1KX5B 4J8XB 4CSRB 3RELB 2FJ7B 5AVBD 5AV9B 5GT3D 2PYOD 1BFMA 5GT0B 2NQBB 3REJC 1B67A 3AV2C 1T3UA 1TZYB 3REJA 3VH5A 4E45A 2CV5C 5B2IA 5B0ZD 3X1VC 3C1CB 4DQYB 2CV5A 5AY8A 3X1VA 1M1AC 4J8VA 3MGPD 1M1AA 5GXQD 2Y2PA 5CP6D 3AZIB 4M6BA 4KUDC 3B0CT 4KGCA 3O62D 1P3OC 1KX4C 1P3OA 2BYMA 1KX4A 5KDMA 3REJB 3WKJA 5FUGA 1P3BA 5B2IB 3AYWD 1EQZC 2CV5B 4WU9D 4ZUXD 3X1VB 1EQZA 4J8VB 3VH6A 1P3PC 1M1AB 1KX5D 3RELD 4CAYA 1P3PA 2FJ7D 4XZQC 5AV9D 4H9RA 4KGCB 4YS3C 5GT0D 2NQBD 1M19A 2IO5C 4ZBJC 1P3OB 2BYMB 1KX4B 1KU5A 5KDMB 4XUJD 5FUGB 3EG5B 4Z66C 1P3BB 3LJAA 1EQZB 1P3GA 3REHC 1WWIA 3AZID 4H9SC 3LZ0C 4CAYB 4J8UC 1P3PB 4H9SA 3LZ0A 4H9RB 4NE3A 3UTBC 4WJ3C 4J8WC 3UTBA 4J8WA 1M19B 2IO5B 4ZBJB 2JE5A 5B2ID 3KXBC 1ZLAD 2CV5D 4UUZA 3KXBA 3X1VD 5AV6A 4NE6A 4J8VD 1S32A 5BO0A 1M1AD 4QLCC 3LJAB 3AL0C 1P3GB 4QLCA 2XD1A 5B40D 1A7WA 3REHB 4KGCD 3LZ0B 2HIOA 5AVBC 3UTBB 1P3OD 4J8WB 1KX4D 5AVBA 1JFIA 4Z5TD 3VH5T 3AZNA 3AZMC 1P3BD 5BT1D 3KSYA 3AZMA 4UUZB 3KXBB 2Y2GA 1EQZD 5AV6B 5B0ZC 1S32B 4JJNC 5BO0B 5B0ZA 5AV8C 4JJNA 3AZGD 2NZDC 1P3PD 4QLCB 1W2EA 5AV8A 3LZ1A 2NZDA 4E44A 2BG1A 3P5JB 1M19D 2ZY3A 2Y2NA 2HIOB 3O62C 1P34C 1TAFA 1JFIB 5AVBB 1P34A 2F8NG 2JSSA 4H9QA 4WNNA 3AZMB 1Z2CB 3LJAD 1P3GD 3VH6T 5CPJD 1P3MA 5B31G 4ZUXC 5B0ZB 4JJNB 5B33C 3LZ0D 5AV8B 3KUYC 5B33A 1KX5C 2NZDB 3RELC 3KUYA 2FJ7C 5B32G 4J8WD 3AZJD 5GT0C 1TAFB 3O62B 1P34B 5BS7C 4H9QB 5BS7A 3KXBD 4XUJC 5AV6D 1S32D 3B0BA 4H9PA 4AWLC 4QLCD 2DF4C 1P3MB 3UT9D 1HTAA 4LD9A 5B33B 5F99A 3KUYB 2HIOD 4HGAC 3AZND 3AZMD 3REKC 1B6WA 5B0YA 5B2IC 1ZLAC 3REKA 5C3IC 4XUJB 1ZLAA 4JJND 4H9PB 1R4VA 4J8VC 1ID3C 5AV8D 3LZ1D 4AWLB 2NZDD 1ID3A 5CPKD 2W8SA 5B40C 3W99A 4LD9B 5B40A 5F99B 5G49A 4KGCC 3WAAC 3MGRA 3WAAA 2Y2IA 5B24C 1P34D 3FDDA 5B24A 4HGAB 2HUEC 2Y2QA 4Z5TC 5CHLB 3W97C 2F8NH 3B0DC 2RVQC 3W97A 4Z5TA 5B0YB 1P3BC 5BT1C 3REKB 1P3MD 5B1MD 1ZLAB 5C3IB 5E5AC 2Y2JA 1P3LD 5B33D 1P3AC 5E5AA 3AZGC 1ID3B 3KUYD 1P3AA 3W99B 3AZGA 5B40B 5G49B 3MGRB 3WAAB 5BNVA 1M19C 5B24B 5DNMA 4H9OA 4YM6C 2HUEB 4YM6A 4Z5TB 3W97B 2ZY4A 3B0DB 3AV1C 1HQ3C 3LJAC 3AV1A 1P3GC 3A6NC 1HQ3A 5CPJC 1Q9CA 4LD9D 5F99D 3A6NA 5E5AB 3AZFC 5CPJA 1P3AB 3AZFA 3AZGB 3A1KA 3MGQC 4Z2MG 3MGQA 5BNVB 3AZJC 3EPKA 5CPIA 4WV4B 3AZJA 5DNMB 4H9OB 5B0YD 3REKD 4YM6B 3AZHD 5AV6C 1S32C 3H0LC 2F8ND 1ID3D 3AV1B 1HQ3B 3X1UD 3W99D 2VQRA 3UT9C 3A6NB 3IP4C 5CPJB 3UT9A 3MGRD 3AZFB 3WAAD 5DNND 2HIOC 5GSUA 5B24D 3NQUA 3WA9C 3MGQB 3WA9A 3AN2D 3AZNC 3AZJB 3W97D 3B0CW 2RVQD 1WWSA 3F6TA 5E5AD 1P3AD 2Y2LA 3LZ1C 5CPKC 3UT9B 3B6GA 4NE5A 3UTAA 5CPKA 2F2AC 2XD5A 5GSUB 1P3FC 3NQUB 5DNMD 1P3FA 4X23A
chains in the Genus database with same CATH topology
4YM6D 4UPKA 3AZNB 3AV1D 1HQ3D 1P3MC 5B1MC 3A6ND 1F1EA 5B1MA 5AVCC 3WTPD 3AZFD 1P3LC 2Y2KA 5AVCA 3LZ1B 1P3LA 5B2JD 1N1JA 5AV5A 3B6GB 3UTAB 5CPKB 3MGQD 3R45A 5CPID 4Z2MH 3W98C 5AY8B 4DRAA 1P3FB 3W98A 4X23B 3AFAC 3AFAA 3AZLA 3KWQC 5JRGC 4WNNB 3KWQA 5JRGA 1H3OA 3EPJA 5B1MB 4LD9C 5F99C 5AVCB 1P3LB 1N1JB 1F66D 5GSUD 5AV5B 3WA9D 3R45B 4R8PC 4EO5C 3H0RC 4R8PA 3LELC 3W98B 2YFWA 3LELA 5B0YC 3AFAB 3AZLB 3EPHA 2AROD 1KX3C 3AZHC 2Y2MA 3KWQB 1KX3A 5JRGB 3AZHA 1H3OB 3VH5W 3C1CA 3X1UC 2F8NA 3W99C 3B6GD 3UTAD 3X1UA 3MGRC 3C1BC 5B31C 5DNNC 5AY8D 1P3FD 3C1BA 5B31A 4X23D 5DNNA 2G5HC 3MVDA 4R8PB 1U35C 3AN2C 5JA4A 4NFTA 4EO5B 2YFWB 5B32C 3LELB 1U35A 3AN2A 5B32A 4WZSB 1KX3B 3AZHB 3AV2A 3MNNC 1P3ID 5AVCD 2L5AA 3MNNA 1ULYA 5AV5D 2F8NB 3X1UB 5B1LC 5B1LA 3TU4C 3VH6W 3C1BB 3W98D 5B31B 3TU4A 5DNNB 2RIQA 3MVDB 5DNMC 3AFAD 3AZLD 5JA4B 4KUDA 1U35B 3AN2B 1P3KD 3KWQD 5B32B 3MGSC 5JRGD 3X1TC 3MGSA 4KHAA 3X1TA 2ZY5A 3AV2B 3MNNB 3WTPC 2Y2HA 1M18D 3AZEC 3B6FC 3WTPA 3AZKC 5B2JC 4WU8C 3AZEA 3B6FA 4WU8A 5B1LB 5B2JA 4J8XD 3AZKA 4R8PD 3TU4B 5CPIC 3LELD 4XZQA 2F8NK 4KUDB 2LY8A 2FFFB 4YS3A 1TZYD 1KX3D 4G92C 3MGSB 4KHAB 3C1CD 3X1TB 3REIC 3NQJA 3REIA 1AOIC 4Z66A 3WKJC 3WTPB 3V9RA 3C1BD 1AOIA 5B31D 1F66C 2YFVA 5GSUC 3MVDD 3AZEB 4WU8B 5B2JB 3REHA 2J8PA 3AZKB 1F66A 3B6FB 4J8UA 1U35D 4XZQB 5B32D 5CPIB 4YS3B 4H9NA 2DQNC 3REJD 2AROC 3W96C 3AV2D 4G92B 2AROA 3W96A 4DRBA 3MNND 3NQJB 3REIB 3B6GC 3UTAC 5B1LD 4Z66B 2BYKA 3V9RB 1AOIB 3WKJB 3TU4D 2YFVB 3X1SC 5AY8C 1F66B 2UWXA 3X1SA 4X23C 4KUDD 1PZRA 4J8UB 3MGSD 4H9NB 5GT3C 2PYOC 3X1TD 5GT3A 2PYOA 2AROB 3W96B 3WA9B 1P3IC 2Y2OA 5AV5C 3AZED 1P3IA 3B6FD 3AZKD 4WU8D 2BYKB 3MGPC 5GXQC 3MGPA 4XZQD 5CP6C 3X1SB 5GXQA 2ZM5A 2JCHA 5CP6A 4G91C 4YS3D 3AZLC 1P3KC 3O62A 1BH8A 1P3KA 5GT3B 2PYOB 3REID 1BH9A 4Z66D 3AYWC 1AOID 1M18C 3WKJD 1P3IB 4WU9C 3AYWA 3REHD 3A1IA 1M18A 4WU9A 5BNXA 4ZUXA 4J8XC 4J8UD 3MGPB 2ZY2A 1KX5A 5GXQB 4CSRA 4J8XA 5AV9C 3RELA 2CWEA 3UTBD 5CP6B 2FJ7A 5AV9A 4G91B 2NQBC 5GT0A 2NQBA 1TZYC 3W96D 1BH8B 1P3KB 3WTPE 1TZYA 3C1CC 3EPLA 4XUJA 1BH9B 2G5IC 3AYWB 1M18B 3H0MC 3X1SD 3AZIC 5BNXB 4ZUXB 4WU9B 3MVDC 3AZIA 3KFUG 1KX5B 4J8XB 4CSRB 3RELB 2FJ7B 5AVBD 5AV9B 5GT3D 2PYOD 1BFMA 5GT0B 2NQBB 3REJC 1B67A 3AV2C 1T3UA 1TZYB 3REJA 3VH5A 4E45A 2CV5C 5B2IA 5B0ZD 3X1VC 3C1CB 4DQYB 2CV5A 5AY8A 3X1VA 1M1AC 4J8VA 3MGPD 1M1AA 5GXQD 2Y2PA 5CP6D 3AZIB 4M6BA 4KUDC 3B0CT 4KGCA 3O62D 1P3OC 1KX4C 1P3OA 2BYMA 1KX4A 5KDMA 3REJB 3WKJA 5FUGA 1P3BA 5B2IB 3AYWD 1EQZC 2CV5B 4WU9D 4ZUXD 3X1VB 1EQZA 4J8VB 3VH6A 1P3PC 1M1AB 1KX5D 3RELD 4CAYA 1P3PA 2FJ7D 4XZQC 5AV9D 4H9RA 4KGCB 4YS3C 5GT0D 2NQBD 1M19A 2IO5C 4ZBJC 1P3OB 2BYMB 1KX4B 1KU5A 5KDMB 4XUJD 5FUGB 3EG5B 4Z66C 1P3BB 3LJAA 1EQZB 1P3GA 3REHC 1WWIA 3AZID 4H9SC 3LZ0C 4CAYB 4J8UC 1P3PB 4H9SA 3LZ0A 4H9RB 4NE3A 3UTBC 4WJ3C 4J8WC 3UTBA 4J8WA 1M19B 2IO5B 4ZBJB 2JE5A 5B2ID 3KXBC 1ZLAD 2CV5D 4UUZA 3KXBA 3X1VD 5AV6A 4NE6A 4J8VD 1S32A 5BO0A 1M1AD 4QLCC 3LJAB 3AL0C 1P3GB 4QLCA 2XD1A 5B40D 1A7WA 3REHB 4KGCD 3LZ0B 2HIOA 5AVBC 3UTBB 1P3OD 4J8WB 1KX4D 5AVBA 1JFIA 4Z5TD 3VH5T 3AZNA 3AZMC 1P3BD 5BT1D 3KSYA 3AZMA 4UUZB 3KXBB 2Y2GA 1EQZD 5AV6B 5B0ZC 1S32B 4JJNC 5BO0B 5B0ZA 5AV8C 4JJNA 3AZGD 2NZDC 1P3PD 4QLCB 1W2EA 5AV8A 3LZ1A 2NZDA 4E44A 2BG1A 3P5JB 1M19D 2ZY3A 2Y2NA 2HIOB 3O62C 1P34C 1TAFA 1JFIB 5AVBB 1P34A 2F8NG 2JSSA 4H9QA 4WNNA 3AZMB 1Z2CB 3LJAD 1P3GD 3VH6T 5CPJD 1P3MA 5B31G 4ZUXC 5B0ZB 4JJNB 5B33C 3LZ0D 5AV8B 3KUYC 5B33A 1KX5C 2NZDB 3RELC 3KUYA 2FJ7C 5B32G 4J8WD 3AZJD 5GT0C 1TAFB 3O62B 1P34B 5BS7C 4H9QB 5BS7A 3KXBD 4XUJC 5AV6D 1S32D 3B0BA 4H9PA 4AWLC 4QLCD 2DF4C 1P3MB 3UT9D 1HTAA 4LD9A 5B33B 5F99A 3KUYB 2HIOD 4HGAC 3AZND 3AZMD 3REKC 1B6WA 5B0YA 5B2IC 1ZLAC 3REKA 5C3IC 4XUJB 1ZLAA 4JJND 4H9PB 1R4VA 4J8VC 1ID3C 5AV8D 3LZ1D 4AWLB 2NZDD 1ID3A 5CPKD 2W8SA 5B40C 3W99A 4LD9B 5B40A 5F99B 5G49A 4KGCC 3WAAC 3MGRA 3WAAA 2Y2IA 5B24C 1P34D 3FDDA 5B24A 4HGAB 2HUEC 2Y2QA 4Z5TC 5CHLB 3W97C 2F8NH 3B0DC 2RVQC 3W97A 4Z5TA 5B0YB 1P3BC 5BT1C 3REKB 1P3MD 5B1MD 1ZLAB 5C3IB 5E5AC 2Y2JA 1P3LD 5B33D 1P3AC 5E5AA 3AZGC 1ID3B 3KUYD 1P3AA 3W99B 3AZGA 5B40B 5G49B 3MGRB 3WAAB 5BNVA 1M19C 5B24B 5DNMA 4H9OA 4YM6C 2HUEB 4YM6A 4Z5TB 3W97B 2ZY4A 3B0DB 3AV1C 1HQ3C 3LJAC 3AV1A 1P3GC 3A6NC 1HQ3A 5CPJC 1Q9CA 4LD9D 5F99D 3A6NA 5E5AB 3AZFC 5CPJA 1P3AB 3AZFA 3AZGB 3A1KA 3MGQC 4Z2MG 3MGQA 5BNVB 3AZJC 3EPKA 5CPIA 4WV4B 3AZJA 5DNMB 4H9OB 5B0YD 3REKD 4YM6B 3AZHD 5AV6C 1S32C 3H0LC 2F8ND 1ID3D 3AV1B 1HQ3B 3X1UD 3W99D 2VQRA 3UT9C 3A6NB 3IP4C 5CPJB 3UT9A 3MGRD 3AZFB 3WAAD 5DNND 2HIOC 5GSUA 5B24D 3NQUA 3WA9C 3MGQB 3WA9A 3AN2D 3AZNC 3AZJB 3W97D 3B0CW 2RVQD 1WWSA 3F6TA 5E5AD 1P3AD 2Y2LA 3LZ1C 5CPKC 3UT9B 3B6GA 4NE5A 3UTAA 5CPKA 2F2AC 2XD5A 5GSUB 1P3FC 3NQUB 5DNMD 1P3FA 4X23A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YM6 D;  3AZN B;  3AV1 D;  1HQ3 D;  1P3M C;  5B1M C;  3A6N D;  1F1E A;  5B1M A;  5AVC C;  3WTP D;  3AZF D;  1P3L C;  5AVC A;  3LZ1 B;  1P3L A;  5B2J D;  1N1J A;  5AV5 A;  3B6G B;  3UTA B;  5CPK B;  3MGQ D;  3R45 A;  5CPI D;  4Z2M H;  3W98 C;  5AY8 B;  4DRA A;  1P3F B;  3W98 A;  4X23 B;  3AFA C;  3AFA A;  3AZL A;  3KWQ C;  5JRG C;  4WNN B;  3KWQ A;  5JRG A;  1H3O A;  5B1M B;  4LD9 C;  5F99 C;  5AVC B;  1P3L B;  1N1J B;  1F66 D;  5GSU D;  5AV5 B;  3WA9 D;  3R45 B;  4R8P C;  4EO5 C;  4R8P A;  3LEL C;  3W98 B;  2YFW A;  3LEL A;  5B0Y C;  3AFA B;  3AZL B;  2ARO D;  1KX3 C;  3AZH C;  3KWQ B;  1KX3 A;  5JRG B;  3AZH A;  1H3O B;  3VH5 W;  3C1C A;  3X1U C;  2F8N A;  3W99 C;  3B6G D;  3UTA D;  3X1U A;  3MGR C;  3C1B C;  5B31 C;  5DNN C;  5AY8 D;  1P3F D;  3C1B A;  5B31 A;  4X23 D;  5DNN A;  3MVD A;  4R8P B;  1U35 C;  3AN2 C;  5JA4 A;  4NFT A;  4EO5 B;  2YFW B;  5B32 C;  3LEL B;  1U35 A;  3AN2 A;  5B32 A;  4WZS B;  1KX3 B;  3AZH B;  3AV2 A;  3MNN C;  1P3I D;  5AVC D;  2L5A A;  3MNN A;  1ULY A;  5AV5 D;  2F8N B;  3X1U B;  5B1L C;  5B1L A;  3TU4 C;  3VH6 W;  3C1B B;  3W98 D;  5B31 B;  3TU4 A;  5DNN B;  3MVD B;  5DNM C;  3AFA D;  3AZL D;  5JA4 B;  4KUD A;  1U35 B;  3AN2 B;  1P3K D;  3KWQ D;  5B32 B;  3MGS C;  5JRG D;  3X1T C;  3MGS A;  4KHA A;  3X1T A;  3AV2 B;  3MNN B;  3WTP C;  1M18 D;  3AZE C;  3B6F C;  3WTP A;  3AZK C;  5B2J C;  4WU8 C;  3AZE A;  3B6F A;  4WU8 A;  5B1L B;  5B2J A;  4J8X D;  3AZK A;  4R8P D;  3TU4 B;  5CPI C;  3LEL D;  4XZQ A;  2F8N K;  4KUD B;  2LY8 A;  4YS3 A;  1TZY D;  1KX3 D;  4G92 C;  3MGS B;  4KHA B;  3C1C D;  3X1T B;  3REI C;  3NQJ A;  3REI A;  1AOI C;  4Z66 A;  3WKJ C;  3WTP B;  3V9R A;  3C1B D;  1AOI A;  5B31 D;  1F66 C;  2YFV A;  5GSU C;  3MVD D;  3AZE B;  4WU8 B;  5B2J B;  3REH A;  3AZK B;  1F66 A;  3B6F B;  4J8U A;  1U35 D;  4XZQ B;  5B32 D;  5CPI B;  4YS3 B;  4H9N A;  3REJ D;  2ARO C;  3W96 C;  3AV2 D;  4G92 B;  2ARO A;  3W96 A;  4DRB A;  3MNN D;  3NQJ B;  3REI B;  3B6G C;  3UTA C;  5B1L D;  4Z66 B;  2BYK A;  3V9R B;  1AOI B;  3WKJ B;  3TU4 D;  2YFV B;  3X1S C;  5AY8 C;  1F66 B;  3X1S A;  4X23 C;  4KUD D;  4J8U B;  3MGS D;  4H9N B;  5GT3 C;  2PYO C;  3X1T D;  5GT3 A;  2PYO A;  2ARO B;  3W96 B;  3WA9 B;  1P3I C;  5AV5 C;  3AZE D;  1P3I A;  3B6F D;  3AZK D;  4WU8 D;  2BYK B;  3MGP C;  5GXQ C;  3MGP A;  4XZQ D;  5CP6 C;  3X1S B;  5GXQ A;  5CP6 A;  4G91 C;  4YS3 D;  3AZL C;  1P3K C;  3O62 A;  1BH8 A;  1P3K A;  5GT3 B;  2PYO B;  3REI D;  1BH9 A;  4Z66 D;  3AYW C;  1AOI D;  1M18 C;  3WKJ D;  1P3I B;  4WU9 C;  3AYW A;  3REH D;  1M18 A;  4WU9 A;  5BNX A;  4ZUX A;  4J8X C;  4J8U D;  3MGP B;  1KX5 A;  5GXQ B;  4CSR A;  4J8X A;  5AV9 C;  3REL A;  2CWE A;  3UTB D;  5CP6 B;  2FJ7 A;  5AV9 A;  4G91 B;  2NQB C;  5GT0 A;  2NQB A;  1TZY C;  3W96 D;  1BH8 B;  1P3K B;  3WTP E;  1TZY A;  3C1C C;  4XUJ A;  1BH9 B;  3AYW B;  1M18 B;  3X1S D;  3AZI C;  5BNX B;  4ZUX B;  4WU9 B;  3MVD C;  3AZI A;  1KX5 B;  4J8X B;  4CSR B;  3REL B;  2FJ7 B;  5AVB D;  5AV9 B;  5GT3 D;  2PYO D;  1BFM A;  5GT0 B;  2NQB B;  3REJ C;  1B67 A;  3AV2 C;  1TZY B;  3REJ A;  3VH5 A;  4E45 A;  2CV5 C;  5B2I A;  5B0Z D;  3X1V C;  3C1C B;  2CV5 A;  5AY8 A;  3X1V A;  1M1A C;  4J8V A;  3MGP D;  1M1A A;  5GXQ D;  5CP6 D;  3AZI B;  4M6B A;  4KUD C;  3B0C T;  4KGC A;  3O62 D;  1P3O C;  1KX4 C;  1P3O A;  2BYM A;  1KX4 A;  5KDM A;  3REJ B;  3WKJ A;  5FUG A;  1P3B A;  5B2I B;  3AYW D;  1EQZ C;  2CV5 B;  4WU9 D;  4ZUX D;  3X1V B;  1EQZ A;  4J8V B;  3VH6 A;  1P3P C;  1M1A B;  1KX5 D;  3REL D;  4CAY A;  1P3P A;  2FJ7 D;  4XZQ C;  5AV9 D;  4H9R A;  4KGC B;  4YS3 C;  5GT0 D;  2NQB D;  1M19 A;  2IO5 C;  4ZBJ C;  1P3O B;  2BYM B;  1KX4 B;  1KU5 A;  5KDM B;  4XUJ D;  5FUG B;  4Z66 C;  1P3B B;  3LJA A;  1EQZ B;  1P3G A;  3REH C;  1WWI A;  3AZI D;  4H9S C;  3LZ0 C;  4CAY B;  4J8U C;  1P3P B;  4H9S A;  3LZ0 A;  4H9R B;  4NE3 A;  3UTB C;  4J8W C;  3UTB A;  4J8W A;  1M19 B;  2IO5 B;  4ZBJ B;  5B2I D;  3KXB C;  1ZLA D;  2CV5 D;  4UUZ A;  3KXB A;  3X1V D;  5AV6 A;  4NE6 A;  4J8V D;  1S32 A;  5BO0 A;  1M1A D;  4QLC C;  3LJA B;  1P3G B;  4QLC A;  5B40 D;  1A7W A;  3REH B;  4KGC D;  3LZ0 B;  2HIO A;  5AVB C;  3UTB B;  1P3O D;  4J8W B;  1KX4 D;  5AVB A;  1JFI A;  4Z5T D;  3VH5 T;  3AZN A;  3AZM C;  1P3B D;  5BT1 D;  3KSY A;  3AZM A;  4UUZ B;  3KXB B;  1EQZ D;  5AV6 B;  5B0Z C;  1S32 B;  4JJN C;  5BO0 B;  5B0Z A;  5AV8 C;  4JJN A;  3AZG D;  2NZD C;  1P3P D;  4QLC B;  5AV8 A;  3LZ1 A;  2NZD A;  4E44 A;  1M19 D;  2HIO B;  3O62 C;  1P34 C;  1TAF A;  1JFI B;  5AVB B;  1P34 A;  2F8N G;  2JSS A;  4H9Q A;  4WNN A;  3AZM B;  3LJA D;  1P3G D;  3VH6 T;  5CPJ D;  1P3M A;  5B31 G;  4ZUX C;  5B0Z B;  4JJN B;  5B33 C;  3LZ0 D;  5AV8 B;  3KUY C;  5B33 A;  1KX5 C;  2NZD B;  3REL C;  3KUY A;  2FJ7 C;  5B32 G;  4J8W D;  3AZJ D;  5GT0 C;  1TAF B;  3O62 B;  1P34 B;  5BS7 C;  4H9Q B;  5BS7 A;  3KXB D;  4XUJ C;  5AV6 D;  1S32 D;  3B0B A;  4H9P A;  4AWL C;  4QLC D;  1P3M B;  3UT9 D;  1HTA A;  4LD9 A;  5B33 B;  5F99 A;  3KUY B;  2HIO D;  4HGA C;  3AZN D;  3AZM D;  3REK C;  1B6W A;  5B0Y A;  5B2I C;  1ZLA C;  3REK A;  5C3I C;  4XUJ B;  1ZLA A;  4JJN D;  4H9P B;  1R4V A;  4J8V C;  1ID3 C;  5AV8 D;  3LZ1 D;  4AWL B;  2NZD D;  1ID3 A;  5CPK D;  5B40 C;  3W99 A;  4LD9 B;  5B40 A;  5F99 B;  5G49 A;  4KGC C;  3WAA C;  3MGR A;  3WAA A;  5B24 C;  1P34 D;  5B24 A;  4HGA B;  2HUE C;  4Z5T C;  5CHL B;  3W97 C;  2F8N H;  3B0D C;  2RVQ C;  3W97 A;  4Z5T A;  5B0Y B;  1P3B C;  5BT1 C;  3REK B;  1P3M D;  5B1M D;  1ZLA B;  5C3I B;  5E5A C;  1P3L D;  5B33 D;  1P3A C;  5E5A A;  3AZG C;  1ID3 B;  3KUY D;  1P3A A;  3W99 B;  3AZG A;  5B40 B;  5G49 B;  3MGR B;  3WAA B;  5BNV A;  1M19 C;  5B24 B;  5DNM A;  4H9O A;  4YM6 C;  2HUE B;  4YM6 A;  4Z5T B;  3W97 B;  3B0D B;  3AV1 C;  1HQ3 C;  3LJA C;  3AV1 A;  1P3G C;  3A6N C;  1HQ3 A;  5CPJ C;  1Q9C A;  4LD9 D;  5F99 D;  3A6N A;  5E5A B;  3AZF C;  5CPJ A;  1P3A B;  3AZF A;  3AZG B;  3MGQ C;  4Z2M G;  3MGQ A;  5BNV B;  3AZJ C;  5CPI A;  4WV4 B;  3AZJ A;  5DNM B;  4H9O B;  5B0Y D;  3REK D;  4YM6 B;  3AZH D;  5AV6 C;  1S32 C;  2F8N D;  1ID3 D;  3AV1 B;  1HQ3 B;  3X1U D;  3W99 D;  3UT9 C;  3A6N B;  5CPJ B;  3UT9 A;  3MGR D;  3AZF B;  3WAA D;  5DNN D;  2HIO C;  5GSU A;  5B24 D;  3NQU A;  3WA9 C;  3MGQ B;  3WA9 A;  3AN2 D;  3AZN C;  3AZJ B;  3W97 D;  3B0C W;  2RVQ D;  1WWS A;  5E5A D;  1P3A D;  3LZ1 C;  5CPK C;  3UT9 B;  3B6G A;  4NE5 A;  3UTA A;  5CPK A;  5GSU B;  1P3F C;  3NQU B;  5DNM D;  1P3F A;  4X23 A; 
#chains in the Genus database with same CATH topology
 4YM6 D;  4UPK A;  3AZN B;  3AV1 D;  1HQ3 D;  1P3M C;  5B1M C;  3A6N D;  1F1E A;  5B1M A;  5AVC C;  3WTP D;  3AZF D;  1P3L C;  2Y2K A;  5AVC A;  3LZ1 B;  1P3L A;  5B2J D;  1N1J A;  5AV5 A;  3B6G B;  3UTA B;  5CPK B;  3MGQ D;  3R45 A;  5CPI D;  4Z2M H;  3W98 C;  5AY8 B;  4DRA A;  1P3F B;  3W98 A;  4X23 B;  3AFA C;  3AFA A;  3AZL A;  3KWQ C;  5JRG C;  4WNN B;  3KWQ A;  5JRG A;  1H3O A;  3EPJ A;  5B1M B;  4LD9 C;  5F99 C;  5AVC B;  1P3L B;  1N1J B;  1F66 D;  5GSU D;  5AV5 B;  3WA9 D;  3R45 B;  4R8P C;  4EO5 C;  3H0R C;  4R8P A;  3LEL C;  3W98 B;  2YFW A;  3LEL A;  5B0Y C;  3AFA B;  3AZL B;  3EPH A;  2ARO D;  1KX3 C;  3AZH C;  2Y2M A;  3KWQ B;  1KX3 A;  5JRG B;  3AZH A;  1H3O B;  3VH5 W;  3C1C A;  3X1U C;  2F8N A;  3W99 C;  3B6G D;  3UTA D;  3X1U A;  3MGR C;  3C1B C;  5B31 C;  5DNN C;  5AY8 D;  1P3F D;  3C1B A;  5B31 A;  4X23 D;  5DNN A;  2G5H C;  3MVD A;  4R8P B;  1U35 C;  3AN2 C;  5JA4 A;  4NFT A;  4EO5 B;  2YFW B;  5B32 C;  3LEL B;  1U35 A;  3AN2 A;  5B32 A;  4WZS B;  1KX3 B;  3AZH B;  3AV2 A;  3MNN C;  1P3I D;  5AVC D;  2L5A A;  3MNN A;  1ULY A;  5AV5 D;  2F8N B;  3X1U B;  5B1L C;  5B1L A;  3TU4 C;  3VH6 W;  3C1B B;  3W98 D;  5B31 B;  3TU4 A;  5DNN B;  2RIQ A;  3MVD B;  5DNM C;  3AFA D;  3AZL D;  5JA4 B;  4KUD A;  1U35 B;  3AN2 B;  1P3K D;  3KWQ D;  5B32 B;  3MGS C;  5JRG D;  3X1T C;  3MGS A;  4KHA A;  3X1T A;  2ZY5 A;  3AV2 B;  3MNN B;  3WTP C;  2Y2H A;  1M18 D;  3AZE C;  3B6F C;  3WTP A;  3AZK C;  5B2J C;  4WU8 C;  3AZE A;  3B6F A;  4WU8 A;  5B1L B;  5B2J A;  4J8X D;  3AZK A;  4R8P D;  3TU4 B;  5CPI C;  3LEL D;  4XZQ A;  2F8N K;  4KUD B;  2LY8 A;  2FFF B;  4YS3 A;  1TZY D;  1KX3 D;  4G92 C;  3MGS B;  4KHA B;  3C1C D;  3X1T B;  3REI C;  3NQJ A;  3REI A;  1AOI C;  4Z66 A;  3WKJ C;  3WTP B;  3V9R A;  3C1B D;  1AOI A;  5B31 D;  1F66 C;  2YFV A;  5GSU C;  3MVD D;  3AZE B;  4WU8 B;  5B2J B;  3REH A;  2J8P A;  3AZK B;  1F66 A;  3B6F B;  4J8U A;  1U35 D;  4XZQ B;  5B32 D;  5CPI B;  4YS3 B;  4H9N A;  2DQN C;  3REJ D;  2ARO C;  3W96 C;  3AV2 D;  4G92 B;  2ARO A;  3W96 A;  4DRB A;  3MNN D;  3NQJ B;  3REI B;  3B6G C;  3UTA C;  5B1L D;  4Z66 B;  2BYK A;  3V9R B;  1AOI B;  3WKJ B;  3TU4 D;  2YFV B;  3X1S C;  5AY8 C;  1F66 B;  2UWX A;  3X1S A;  4X23 C;  4KUD D;  1PZR A;  4J8U B;  3MGS D;  4H9N B;  5GT3 C;  2PYO C;  3X1T D;  5GT3 A;  2PYO A;  2ARO B;  3W96 B;  3WA9 B;  1P3I C;  2Y2O A;  5AV5 C;  3AZE D;  1P3I A;  3B6F D;  3AZK D;  4WU8 D;  2BYK B;  3MGP C;  5GXQ C;  3MGP A;  4XZQ D;  5CP6 C;  3X1S B;  5GXQ A;  2ZM5 A;  2JCH A;  5CP6 A;  4G91 C;  4YS3 D;  3AZL C;  1P3K C;  3O62 A;  1BH8 A;  1P3K A;  5GT3 B;  2PYO B;  3REI D;  1BH9 A;  4Z66 D;  3AYW C;  1AOI D;  1M18 C;  3WKJ D;  1P3I B;  4WU9 C;  3AYW A;  3REH D;  3A1I A;  1M18 A;  4WU9 A;  5BNX A;  4ZUX A;  4J8X C;  4J8U D;  3MGP B;  2ZY2 A;  1KX5 A;  5GXQ B;  4CSR A;  4J8X A;  5AV9 C;  3REL A;  2CWE A;  3UTB D;  5CP6 B;  2FJ7 A;  5AV9 A;  4G91 B;  2NQB C;  5GT0 A;  2NQB A;  1TZY C;  3W96 D;  1BH8 B;  1P3K B;  3WTP E;  1TZY A;  3C1C C;  3EPL A;  4XUJ A;  1BH9 B;  2G5I C;  3AYW B;  1M18 B;  3H0M C;  3X1S D;  3AZI C;  5BNX B;  4ZUX B;  4WU9 B;  3MVD C;  3AZI A;  3KFU G;  1KX5 B;  4J8X B;  4CSR B;  3REL B;  2FJ7 B;  5AVB D;  5AV9 B;  5GT3 D;  2PYO D;  1BFM A;  5GT0 B;  2NQB B;  3REJ C;  1B67 A;  3AV2 C;  1T3U A;  1TZY B;  3REJ A;  3VH5 A;  4E45 A;  2CV5 C;  5B2I A;  5B0Z D;  3X1V C;  3C1C B;  4DQY B;  2CV5 A;  5AY8 A;  3X1V A;  1M1A C;  4J8V A;  3MGP D;  1M1A A;  5GXQ D;  2Y2P A;  5CP6 D;  3AZI B;  4M6B A;  4KUD C;  3B0C T;  4KGC A;  3O62 D;  1P3O C;  1KX4 C;  1P3O A;  2BYM A;  1KX4 A;  5KDM A;  3REJ B;  3WKJ A;  5FUG A;  1P3B A;  5B2I B;  3AYW D;  1EQZ C;  2CV5 B;  4WU9 D;  4ZUX D;  3X1V B;  1EQZ A;  4J8V B;  3VH6 A;  1P3P C;  1M1A B;  1KX5 D;  3REL D;  4CAY A;  1P3P A;  2FJ7 D;  4XZQ C;  5AV9 D;  4H9R A;  4KGC B;  4YS3 C;  5GT0 D;  2NQB D;  1M19 A;  2IO5 C;  4ZBJ C;  1P3O B;  2BYM B;  1KX4 B;  1KU5 A;  5KDM B;  4XUJ D;  5FUG B;  3EG5 B;  4Z66 C;  1P3B B;  3LJA A;  1EQZ B;  1P3G A;  3REH C;  1WWI A;  3AZI D;  4H9S C;  3LZ0 C;  4CAY B;  4J8U C;  1P3P B;  4H9S A;  3LZ0 A;  4H9R B;  4NE3 A;  3UTB C;  4WJ3 C;  4J8W C;  3UTB A;  4J8W A;  1M19 B;  2IO5 B;  4ZBJ B;  2JE5 A;  5B2I D;  3KXB C;  1ZLA D;  2CV5 D;  4UUZ A;  3KXB A;  3X1V D;  5AV6 A;  4NE6 A;  4J8V D;  1S32 A;  5BO0 A;  1M1A D;  4QLC C;  3LJA B;  3AL0 C;  1P3G B;  4QLC A;  2XD1 A;  5B40 D;  1A7W A;  3REH B;  4KGC D;  3LZ0 B;  2HIO A;  5AVB C;  3UTB B;  1P3O D;  4J8W B;  1KX4 D;  5AVB A;  1JFI A;  4Z5T D;  3VH5 T;  3AZN A;  3AZM C;  1P3B D;  5BT1 D;  3KSY A;  3AZM A;  4UUZ B;  3KXB B;  2Y2G A;  1EQZ D;  5AV6 B;  5B0Z C;  1S32 B;  4JJN C;  5BO0 B;  5B0Z A;  5AV8 C;  4JJN A;  3AZG D;  2NZD C;  1P3P D;  4QLC B;  1W2E A;  5AV8 A;  3LZ1 A;  2NZD A;  4E44 A;  2BG1 A;  3P5J B;  1M19 D;  2ZY3 A;  2Y2N A;  2HIO B;  3O62 C;  1P34 C;  1TAF A;  1JFI B;  5AVB B;  1P34 A;  2F8N G;  2JSS A;  4H9Q A;  4WNN A;  3AZM B;  1Z2C B;  3LJA D;  1P3G D;  3VH6 T;  5CPJ D;  1P3M A;  5B31 G;  4ZUX C;  5B0Z B;  4JJN B;  5B33 C;  3LZ0 D;  5AV8 B;  3KUY C;  5B33 A;  1KX5 C;  2NZD B;  3REL C;  3KUY A;  2FJ7 C;  5B32 G;  4J8W D;  3AZJ D;  5GT0 C;  1TAF B;  3O62 B;  1P34 B;  5BS7 C;  4H9Q B;  5BS7 A;  3KXB D;  4XUJ C;  5AV6 D;  1S32 D;  3B0B A;  4H9P A;  4AWL C;  4QLC D;  2DF4 C;  1P3M B;  3UT9 D;  1HTA A;  4LD9 A;  5B33 B;  5F99 A;  3KUY B;  2HIO D;  4HGA C;  3AZN D;  3AZM D;  3REK C;  1B6W A;  5B0Y A;  5B2I C;  1ZLA C;  3REK A;  5C3I C;  4XUJ B;  1ZLA A;  4JJN D;  4H9P B;  1R4V A;  4J8V C;  1ID3 C;  5AV8 D;  3LZ1 D;  4AWL B;  2NZD D;  1ID3 A;  5CPK D;  2W8S A;  5B40 C;  3W99 A;  4LD9 B;  5B40 A;  5F99 B;  5G49 A;  4KGC C;  3WAA C;  3MGR A;  3WAA A;  2Y2I A;  5B24 C;  1P34 D;  3FDD A;  5B24 A;  4HGA B;  2HUE C;  2Y2Q A;  4Z5T C;  5CHL B;  3W97 C;  2F8N H;  3B0D C;  2RVQ C;  3W97 A;  4Z5T A;  5B0Y B;  1P3B C;  5BT1 C;  3REK B;  1P3M D;  5B1M D;  1ZLA B;  5C3I B;  5E5A C;  2Y2J A;  1P3L D;  5B33 D;  1P3A C;  5E5A A;  3AZG C;  1ID3 B;  3KUY D;  1P3A A;  3W99 B;  3AZG A;  5B40 B;  5G49 B;  3MGR B;  3WAA B;  5BNV A;  1M19 C;  5B24 B;  5DNM A;  4H9O A;  4YM6 C;  2HUE B;  4YM6 A;  4Z5T B;  3W97 B;  2ZY4 A;  3B0D B;  3AV1 C;  1HQ3 C;  3LJA C;  3AV1 A;  1P3G C;  3A6N C;  1HQ3 A;  5CPJ C;  1Q9C A;  4LD9 D;  5F99 D;  3A6N A;  5E5A B;  3AZF C;  5CPJ A;  1P3A B;  3AZF A;  3AZG B;  3A1K A;  3MGQ C;  4Z2M G;  3MGQ A;  5BNV B;  3AZJ C;  3EPK A;  5CPI A;  4WV4 B;  3AZJ A;  5DNM B;  4H9O B;  5B0Y D;  3REK D;  4YM6 B;  3AZH D;  5AV6 C;  1S32 C;  3H0L C;  2F8N D;  1ID3 D;  3AV1 B;  1HQ3 B;  3X1U D;  3W99 D;  2VQR A;  3UT9 C;  3A6N B;  3IP4 C;  5CPJ B;  3UT9 A;  3MGR D;  3AZF B;  3WAA D;  5DNN D;  2HIO C;  5GSU A;  5B24 D;  3NQU A;  3WA9 C;  3MGQ B;  3WA9 A;  3AN2 D;  3AZN C;  3AZJ B;  3W97 D;  3B0C W;  2RVQ D;  1WWS A;  3F6T A;  5E5A D;  1P3A D;  2Y2L A;  3LZ1 C;  5CPK C;  3UT9 B;  3B6G A;  4NE5 A;  3UTA A;  5CPK A;  2F2A C;  2XD5 A;  5GSU B;  1P3F C;  3NQU B;  5DNM D;  1P3F A;  4X23 A; 
#chains in the Genus database with same CATH homology
 4YM6 D;  4UPK A;  3AZN B;  3AV1 D;  1HQ3 D;  1P3M C;  5B1M C;  3A6N D;  1F1E A;  5B1M A;  5AVC C;  3WTP D;  3AZF D;  1P3L C;  2Y2K A;  5AVC A;  3LZ1 B;  1P3L A;  5B2J D;  1N1J A;  5AV5 A;  3B6G B;  3UTA B;  5CPK B;  3MGQ D;  3R45 A;  5CPI D;  4Z2M H;  3W98 C;  5AY8 B;  4DRA A;  1P3F B;  3W98 A;  4X23 B;  3AFA C;  3AFA A;  3AZL A;  3KWQ C;  5JRG C;  4WNN B;  3KWQ A;  5JRG A;  1H3O A;  3EPJ A;  5B1M B;  4LD9 C;  5F99 C;  5AVC B;  1P3L B;  1N1J B;  1F66 D;  5GSU D;  5AV5 B;  3WA9 D;  3R45 B;  4R8P C;  4EO5 C;  3H0R C;  4R8P A;  3LEL C;  3W98 B;  2YFW A;  3LEL A;  5B0Y C;  3AFA B;  3AZL B;  3EPH A;  2ARO D;  1KX3 C;  3AZH C;  2Y2M A;  3KWQ B;  1KX3 A;  5JRG B;  3AZH A;  1H3O B;  3VH5 W;  3C1C A;  3X1U C;  2F8N A;  3W99 C;  3B6G D;  3UTA D;  3X1U A;  3MGR C;  3C1B C;  5B31 C;  5DNN C;  5AY8 D;  1P3F D;  3C1B A;  5B31 A;  4X23 D;  5DNN A;  2G5H C;  3MVD A;  4R8P B;  1U35 C;  3AN2 C;  5JA4 A;  4NFT A;  4EO5 B;  2YFW B;  5B32 C;  3LEL B;  1U35 A;  3AN2 A;  5B32 A;  4WZS B;  1KX3 B;  3AZH B;  3AV2 A;  3MNN C;  1P3I D;  5AVC D;  2L5A A;  3MNN A;  1ULY A;  5AV5 D;  2F8N B;  3X1U B;  5B1L C;  5B1L A;  3TU4 C;  3VH6 W;  3C1B B;  3W98 D;  5B31 B;  3TU4 A;  5DNN B;  2RIQ A;  3MVD B;  5DNM C;  3AFA D;  3AZL D;  5JA4 B;  4KUD A;  1U35 B;  3AN2 B;  1P3K D;  3KWQ D;  5B32 B;  3MGS C;  5JRG D;  3X1T C;  3MGS A;  4KHA A;  3X1T A;  2ZY5 A;  3AV2 B;  3MNN B;  3WTP C;  2Y2H A;  1M18 D;  3AZE C;  3B6F C;  3WTP A;  3AZK C;  5B2J C;  4WU8 C;  3AZE A;  3B6F A;  4WU8 A;  5B1L B;  5B2J A;  4J8X D;  3AZK A;  4R8P D;  3TU4 B;  5CPI C;  3LEL D;  4XZQ A;  2F8N K;  4KUD B;  2LY8 A;  2FFF B;  4YS3 A;  1TZY D;  1KX3 D;  4G92 C;  3MGS B;  4KHA B;  3C1C D;  3X1T B;  3REI C;  3NQJ A;  3REI A;  1AOI C;  4Z66 A;  3WKJ C;  3WTP B;  3V9R A;  3C1B D;  1AOI A;  5B31 D;  1F66 C;  2YFV A;  5GSU C;  3MVD D;  3AZE B;  4WU8 B;  5B2J B;  3REH A;  2J8P A;  3AZK B;  1F66 A;  3B6F B;  4J8U A;  1U35 D;  4XZQ B;  5B32 D;  5CPI B;  4YS3 B;  4H9N A;  2DQN C;  3REJ D;  2ARO C;  3W96 C;  3AV2 D;  4G92 B;  2ARO A;  3W96 A;  4DRB A;  3MNN D;  3NQJ B;  3REI B;  3B6G C;  3UTA C;  5B1L D;  4Z66 B;  2BYK A;  3V9R B;  1AOI B;  3WKJ B;  3TU4 D;  2YFV B;  3X1S C;  5AY8 C;  1F66 B;  2UWX A;  3X1S A;  4X23 C;  4KUD D;  1PZR A;  4J8U B;  3MGS D;  4H9N B;  5GT3 C;  2PYO C;  3X1T D;  5GT3 A;  2PYO A;  2ARO B;  3W96 B;  3WA9 B;  1P3I C;  2Y2O A;  5AV5 C;  3AZE D;  1P3I A;  3B6F D;  3AZK D;  4WU8 D;  2BYK B;  3MGP C;  5GXQ C;  3MGP A;  4XZQ D;  5CP6 C;  3X1S B;  5GXQ A;  2ZM5 A;  2JCH A;  5CP6 A;  4G91 C;  4YS3 D;  3AZL C;  1P3K C;  3O62 A;  1BH8 A;  1P3K A;  5GT3 B;  2PYO B;  3REI D;  1BH9 A;  4Z66 D;  3AYW C;  1AOI D;  1M18 C;  3WKJ D;  1P3I B;  4WU9 C;  3AYW A;  3REH D;  3A1I A;  1M18 A;  4WU9 A;  5BNX A;  4ZUX A;  4J8X C;  4J8U D;  3MGP B;  2ZY2 A;  1KX5 A;  5GXQ B;  4CSR A;  4J8X A;  5AV9 C;  3REL A;  2CWE A;  3UTB D;  5CP6 B;  2FJ7 A;  5AV9 A;  4G91 B;  2NQB C;  5GT0 A;  2NQB A;  1TZY C;  3W96 D;  1BH8 B;  1P3K B;  3WTP E;  1TZY A;  3C1C C;  3EPL A;  4XUJ A;  1BH9 B;  2G5I C;  3AYW B;  1M18 B;  3H0M C;  3X1S D;  3AZI C;  5BNX B;  4ZUX B;  4WU9 B;  3MVD C;  3AZI A;  3KFU G;  1KX5 B;  4J8X B;  4CSR B;  3REL B;  2FJ7 B;  5AVB D;  5AV9 B;  5GT3 D;  2PYO D;  1BFM A;  5GT0 B;  2NQB B;  3REJ C;  1B67 A;  3AV2 C;  1T3U A;  1TZY B;  3REJ A;  3VH5 A;  4E45 A;  2CV5 C;  5B2I A;  5B0Z D;  3X1V C;  3C1C B;  4DQY B;  2CV5 A;  5AY8 A;  3X1V A;  1M1A C;  4J8V A;  3MGP D;  1M1A A;  5GXQ D;  2Y2P A;  5CP6 D;  3AZI B;  4M6B A;  4KUD C;  3B0C T;  4KGC A;  3O62 D;  1P3O C;  1KX4 C;  1P3O A;  2BYM A;  1KX4 A;  5KDM A;  3REJ B;  3WKJ A;  5FUG A;  1P3B A;  5B2I B;  3AYW D;  1EQZ C;  2CV5 B;  4WU9 D;  4ZUX D;  3X1V B;  1EQZ A;  4J8V B;  3VH6 A;  1P3P C;  1M1A B;  1KX5 D;  3REL D;  4CAY A;  1P3P A;  2FJ7 D;  4XZQ C;  5AV9 D;  4H9R A;  4KGC B;  4YS3 C;  5GT0 D;  2NQB D;  1M19 A;  2IO5 C;  4ZBJ C;  1P3O B;  2BYM B;  1KX4 B;  1KU5 A;  5KDM B;  4XUJ D;  5FUG B;  3EG5 B;  4Z66 C;  1P3B B;  3LJA A;  1EQZ B;  1P3G A;  3REH C;  1WWI A;  3AZI D;  4H9S C;  3LZ0 C;  4CAY B;  4J8U C;  1P3P B;  4H9S A;  3LZ0 A;  4H9R B;  4NE3 A;  3UTB C;  4WJ3 C;  4J8W C;  3UTB A;  4J8W A;  1M19 B;  2IO5 B;  4ZBJ B;  2JE5 A;  5B2I D;  3KXB C;  1ZLA D;  2CV5 D;  4UUZ A;  3KXB A;  3X1V D;  5AV6 A;  4NE6 A;  4J8V D;  1S32 A;  5BO0 A;  1M1A D;  4QLC C;  3LJA B;  3AL0 C;  1P3G B;  4QLC A;  2XD1 A;  5B40 D;  1A7W A;  3REH B;  4KGC D;  3LZ0 B;  2HIO A;  5AVB C;  3UTB B;  1P3O D;  4J8W B;  1KX4 D;  5AVB A;  1JFI A;  4Z5T D;  3VH5 T;  3AZN A;  3AZM C;  1P3B D;  5BT1 D;  3KSY A;  3AZM A;  4UUZ B;  3KXB B;  2Y2G A;  1EQZ D;  5AV6 B;  5B0Z C;  1S32 B;  4JJN C;  5BO0 B;  5B0Z A;  5AV8 C;  4JJN A;  3AZG D;  2NZD C;  1P3P D;  4QLC B;  1W2E A;  5AV8 A;  3LZ1 A;  2NZD A;  4E44 A;  2BG1 A;  3P5J B;  1M19 D;  2ZY3 A;  2Y2N A;  2HIO B;  3O62 C;  1P34 C;  1TAF A;  1JFI B;  5AVB B;  1P34 A;  2F8N G;  2JSS A;  4H9Q A;  4WNN A;  3AZM B;  1Z2C B;  3LJA D;  1P3G D;  3VH6 T;  5CPJ D;  1P3M A;  5B31 G;  4ZUX C;  5B0Z B;  4JJN B;  5B33 C;  3LZ0 D;  5AV8 B;  3KUY C;  5B33 A;  1KX5 C;  2NZD B;  3REL C;  3KUY A;  2FJ7 C;  5B32 G;  4J8W D;  3AZJ D;  5GT0 C;  1TAF B;  3O62 B;  1P34 B;  5BS7 C;  4H9Q B;  5BS7 A;  3KXB D;  4XUJ C;  5AV6 D;  1S32 D;  3B0B A;  4H9P A;  4AWL C;  4QLC D;  2DF4 C;  1P3M B;  3UT9 D;  1HTA A;  4LD9 A;  5B33 B;  5F99 A;  3KUY B;  2HIO D;  4HGA C;  3AZN D;  3AZM D;  3REK C;  1B6W A;  5B0Y A;  5B2I C;  1ZLA C;  3REK A;  5C3I C;  4XUJ B;  1ZLA A;  4JJN D;  4H9P B;  1R4V A;  4J8V C;  1ID3 C;  5AV8 D;  3LZ1 D;  4AWL B;  2NZD D;  1ID3 A;  5CPK D;  2W8S A;  5B40 C;  3W99 A;  4LD9 B;  5B40 A;  5F99 B;  5G49 A;  4KGC C;  3WAA C;  3MGR A;  3WAA A;  2Y2I A;  5B24 C;  1P34 D;  3FDD A;  5B24 A;  4HGA B;  2HUE C;  2Y2Q A;  4Z5T C;  5CHL B;  3W97 C;  2F8N H;  3B0D C;  2RVQ C;  3W97 A;  4Z5T A;  5B0Y B;  1P3B C;  5BT1 C;  3REK B;  1P3M D;  5B1M D;  1ZLA B;  5C3I B;  5E5A C;  2Y2J A;  1P3L D;  5B33 D;  1P3A C;  5E5A A;  3AZG C;  1ID3 B;  3KUY D;  1P3A A;  3W99 B;  3AZG A;  5B40 B;  5G49 B;  3MGR B;  3WAA B;  5BNV A;  1M19 C;  5B24 B;  5DNM A;  4H9O A;  4YM6 C;  2HUE B;  4YM6 A;  4Z5T B;  3W97 B;  2ZY4 A;  3B0D B;  3AV1 C;  1HQ3 C;  3LJA C;  3AV1 A;  1P3G C;  3A6N C;  1HQ3 A;  5CPJ C;  1Q9C A;  4LD9 D;  5F99 D;  3A6N A;  5E5A B;  3AZF C;  5CPJ A;  1P3A B;  3AZF A;  3AZG B;  3A1K A;  3MGQ C;  4Z2M G;  3MGQ A;  5BNV B;  3AZJ C;  3EPK A;  5CPI A;  4WV4 B;  3AZJ A;  5DNM B;  4H9O B;  5B0Y D;  3REK D;  4YM6 B;  3AZH D;  5AV6 C;  1S32 C;  3H0L C;  2F8N D;  1ID3 D;  3AV1 B;  1HQ3 B;  3X1U D;  3W99 D;  2VQR A;  3UT9 C;  3A6N B;  3IP4 C;  5CPJ B;  3UT9 A;  3MGR D;  3AZF B;  3WAA D;  5DNN D;  2HIO C;  5GSU A;  5B24 D;  3NQU A;  3WA9 C;  3MGQ B;  3WA9 A;  3AN2 D;  3AZN C;  3AZJ B;  3W97 D;  3B0C W;  2RVQ D;  1WWS A;  3F6T A;  5E5A D;  1P3A D;  2Y2L A;  3LZ1 C;  5CPK C;  3UT9 B;  3B6G A;  4NE5 A;  3UTA A;  5CPK A;  2F2A C;  2XD5 A;  5GSU B;  1P3F C;  3NQU B;  5DNM D;  1P3F A;  4X23 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...