3UT9B

Crystal structure of nucleosome core particle assembled with a palindromic widom '601' derivative (ncp-601l)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
79
structure length
79
Chain Sequence
DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title The mechanics behind DNA sequence-dependent properties of the nucleosome
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 29
structure length 79
sequence length 79
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3ut9B00
2L5AA 1TZYC 5B33C 1P3OA 5B24D 3W96D 5G49A 5B1LA 4H9QB 1P3KC 1P3ID 3B6GD 4DRBA 1KX3A 1M1AB 1P3LC 3MGQB 1ZLAA 5B32D 4JJNB 1M1AC 1HQ3B 1P34A 4CAYA 3MGQC 3W99B 4QLCB 5E5AA 4JJNC 2FJ7B 3W99C 4QLCC 2AROD 5CPIB 2CV5B 3AZLA 4ZUXA 2FJ7C 5CPIC 2CV5C 3AZEA 3MGSB 3UT9B 3AN2B 4J8XA 4R8PA 5B31D 1ULYA 3UT9C 3AN2C 3KWQA 1KX4A 5AY8C 5B2IA 2YFVA 5DNMA 1M18A 3MVDD 5GXQD 4WZSB 3REKB 5B32G 3LJAB 4LD9B 3LZ0D 3REHA 2F8ND 3C1BD 1P3MB 5JRGA 4LD9C 3X1VA 5B2JD 4XZQD 5C3IB 2NQBA 3UTAB 5B0ZC 1TAFB 5B40D 5C3IC 1S32D 1P3PB 1P3FD 3LZ1B 3UTAC 3LELB 5B31G 1P3PC 5F99A 3LELC 5AVCD 5BNXA 1P3GC 3X1SA 5BNXB 3AV2D 4NE6A 3AZGA 2PYOB 3REIC 4Z5TD 4WU9D 3TU4D 1WWSA 4KUDA 2YFWA 2F8NG 3B6GB 1AOIA 5B24C 3W96C 1AOIB 3MGRA 3B6GC 1P3IC 5CPJA 1N1JA 1ID3A 3AZJA 1JFIB 3AZNA 1R4VA 5GT3D 5AV6D 3AFAA 5GT0D 5B32C 5AV5D 5DNND 5CPKD 2AROB 3WA9A 3WTPA 3AZFA 5BNVA 3WTPB 2AROC 4HGAB 1H3OA 3X1UB 4J8UD 5B31B 2BYKA 4YM6D 5B31C 3WAAA 3W97A 1U35A 5BT1D 3MVDB 5GXQB 1P3AA 3AZKA 4J8WB 4XUJD 1P34D 3LZ0B 3MVDC 5GXQC 2F8NB 1P3BD 5AV8A 4G92C 4H9OB 3LZ0C 3C1BC 5B2JB 3AZLD 4X23A 4CSRA 3MNNA 5B2JC 1S32B 5B40B 3MGPA 1P3FB 4R8PD 1S32C 5B40C 5FUGB 1B67A 3KUYA 3C1CD 1EQZB 5BO0A 1P3FC 1M19D 4J8VD 1TZYA 5DNMD 5GSUD 3AV2B 3W98A 5B33B 4Z5TB 1P3KA 5CP6D 4WU9B 3AV2C 1P3KB 2JSSA 4H9QA 4Z5TC 4WU9C 3B0CW 3TU4C 1P3LA 4WU8D 1P3LB 1M1AA 3O62D 3UTBB 3KSYA 3MGQA 3KXBD 5GT3B 4JJNA 5AV6B 1HQ3A 3UTBC 2RVQD 3W99A 4QLCA 5GT3C 1KX5D 5AV6C 5AV5B 3REJD 5DNNB 2FJ7A 5F99D 5CPKB 5GT0C 5CPIA 4AWLB 2CV5A 5AV5C 5DNNC 4YS3D 5CPKC 5B0YD 5BS7C 4AWLC 3A6ND 4J8UB 4KUDD 3MGSA 3UT9A 3AN2A 3AZMD 3WKJD 4J8UC 5AY8B 3W98B 4YM6C 5KDMB 3AZND 3REKA 4XUJB 5BT1C 4LD9A 3LJAA 1P3BB 1P3MA 4XUJC 1P34C 1P3BC 5B0ZA 3B6FD 3AZID 5B0ZB 3UTAA 1F66B 4KGCD 1TAFA 4WNNB 1P3PA 3LZ1A 1F66C 3LELA 3C1CB 3AYWD 4E44A 1P3GB 1M19B 4R8PC 4J8VB 3AV1D 3VH5A 3REIB 3W97D 5GSUB 3C1CC 3V9RB 2PYOA 1M19C 4J8VC 5DNMC 5CP6B 5GSUC 3R45B 5B24B 3W96B 3B6GA 5CP6C 5AV8D 2HIOD 4H9SA 1P3IB 1F1EA 3VH5T 4WU8B 5AV9D 5AVBD 3MNND 3O62B 4WU8C 3RELD 2NZDD 3KXBB 1JFIA 1HTAA 3O62C 5B32B 3AZHD 1BH8B 3KXBC 3KUYD 3REJB 2RVQC 4H9RB 5B1MD 4DRAA 2AROA 1KX5C 3REJC 3X1TD 1BFMA 5F99C 5B0YB 3W98D 4Z66D 3A6NB 3X1UA 4YS3C 5B0YC 3AZMB 1P3OD 3WKJB 3A6NC 5B1LD 5B31A 4KUDC 3AZMC 3WKJC 4Z2MG 1BH9B 3VH6A 3MVDA 5GXQA 1KX3D 4J8WA 1ZLAD 3NQJB 1HQ3D 3LZ0A 4G92B 2F8NA 3C1BA 3AZNC 3C1BB 4H9OA 2BYMB 5E5AD 5B2JA 3VH6T 1Q9CA 4XZQB 3B6FB 3AZIB 4ZUXD 4KGCB 1S32A 5B40A 4XZQC 3B6FC 3AZIC 3MGSD 3AZED 1P3FA 4KGCC 5FUGA 4J8XD 3AYWB 1EQZA 3AV1B 4WV4B 4KHAB 3KWQD 5AVCB 3AYWC 4E45A 3AV2A 5B2ID 1KX4D 5B33A 3AV1C 4Z5TA 3W97C 1M18D 5AVCC 3REKD 3TU4A 4WU9A 3LJAD 3TU4B 4G91B 1P3MD 2HIOB 4H9PB 3REHD 5JRGD 4G91C 5AV9B 5AV8C 2HIOC 3X1VD 5AVBB 5AV9C 3RELB 3UTBA 2NQBD 5AVBC 5GT3A 4Z2MH 5AV6A 3MNNC 4UUZB 3RELC 3AZHB 3LZ1D 2NZDC 5GT0A 4NE3A 5GT0B 5AV5A 5DNNA 5B1MB 3AZHC 5JA4B 5BS7A 5CPKA 3KUYC 3X1TB 2PYOD 5B1MC 3X1SD 4Z66B 3AZGD 1B6WA 3X1TC 4J8UA 3W98C 1P3OB 4Z66C 5G49B 5B1LB 4YM6A 5AY8A 1P3OC 1AOID 4YM6B 5B1LC 3MGRD 3B0DB 5KDMA 5CPJD 1KX3B 1ID3D 1ZLAB 3B0DC 4XUJA 3AZJD 1KX3C 1P34B 1P3BA 4CAYB 3AFAD 1ZLAC 1HQ3C 5E5AB 3WA9D 5E5AC 1WWIA 3WTPD 3AZLB 3AZFD 4ZUXB 1F66A 4WNNA 3X1UD 3AZLC 3AZEB 4ZUXC 3WTPE 4J8XB 1A7WA 4R8PB 3MGSC 3C1CA 3AZEC 1P3GA 1M19A 4J8VA 4J8XC 3KWQB 1KX4B 3REIA 5GSUA 5B2IB 3V9RA 2YFVB 5DNMB 3WAAD 1U35D 3KWQC 5CP6A 1M18B 1KX4C 4J8WD 5B2IC 1P3AD 3AZKD 3R45A 5B24A 3W96A 1M18C 3REHB 3REKC 3LJAC 1P3IA 5JRGB 4WU8A 1P3MC 3REHC 4NE5A 3X1VB 2F8NK 5JRGC 3O62A 4X23D 2NQBB 3X1VC 3KXBA 5B32A 2NQBC 1BH8A 3MGPD 1KX5A 3REJA 1EQZD 4H9RA 3LZ1C 5CHLB 1KX5B 5F99B 1TZYD 3X1SB 5B0YA 5B33D 4YS3A 3AZGB 3B0BA 4YS3B 3A6NA 2PYOC 1P3KD 3X1SC 4EO5B 3AZMA 3WKJA 3AZGC 4KUDB 2YFWB 4EO5C 2HUEB 2LY8A 3MGRB 4H9SC 1P3LD 1BH9A 1AOIC 4M6BA 5CPJB 3UTBD 2HUEC 1N1JB 3VH5W 3MGRC 1M1AD 1ID3B 3MGQD 3AZJB 3NQJA 3AZNB 5CPJC 4JJND 3AFAB 1ID3C 3W99D 3AZJC 4QLCD 2BYMA 3AFAC 2FJ7D 3WA9B 3B6FA 4XZQA 5CPID 3AZFB 3AZIA 2CV5D 5BNVB 2IO5B 4KGCA 3WA9C 3WTPC 3AZFC 1H3OB 2IO5C 4HGAC 4H9NA 3UT9D 3AN2D 3X1UC 4H9NB 5AY8D 3AYWA 2BYKB 3AV1A 4NFTA 4KHAA 5AVCA 3WAAB 3W97B 1U35B 3B0CT 1P3AB 3AZKB 3WAAC 1U35C 4LD9D 4J8WC 2HIOA 4H9PA 1P3AC 3AZKC 4ZBJB 5AV8B 5AV9A 5AVBA 1KU5A 4ZBJC 2F8NH 5B0ZD 4X23B 3RELA 2NZDA 4CSRB 3MNNB 1F66D 3NQUA 2NZDB 3UTAD 3NQUB 3VH6W 4UUZA 4X23C 3AZHA 3MGPB 1P3PD 3LELD 5B1MA 3KUYB 5JA4A 1P3GD 3MGPC 5BO0B 3REID 3X1TA 1EQZC 1TZYB 4Z66A 2CWEA
chains in the Genus database with same CATH superfamily
2L5AA 1TZYC 5B33C 1P3OA 5B24D 3W96D 5G49A 5B1LA 4H9QB 1P3KC 1P3ID 3B6GD 4DRBA 1KX3A 1M1AB 1P3LC 3MGQB 1ZLAA 3EPKA 5B32D 4JJNB 1M1AC 3A1IA 1HQ3B 1P34A 4CAYA 2G5HC 3MGQC 3W99B 4QLCB 2FFFB 5E5AA 4JJNC 2FJ7B 3W99C 4QLCC 2AROD 5CPIB 2CV5B 2Y2JA 3AZLA 4ZUXA 2FJ7C 5CPIC 2CV5C 2F2AC 3AZEA 3MGSB 3UT9B 3AN2B 4J8XA 4R8PA 5B31D 1ULYA 3UT9C 3AN2C 3KWQA 1KX4A 5AY8C 5B2IA 2YFVA 5DNMA 1M18A 3MVDD 5GXQD 4WZSB 3REKB 5B32G 3LJAB 4LD9B 3LZ0D 3REHA 2F8ND 3C1BD 1P3MB 2Y2NA 5JRGA 4LD9C 3X1VA 5B2JD 4XZQD 3H0RC 5C3IB 2NQBA 3UTAB 2Y2KA 1TAFB 5B40D 5C3IC 5B0ZC 1S32D 1P3PB 1P3FD 3LZ1B 3UTAC 3LELB 5B31G 1P3PC 5F99A 3LELC 5AVCD 5BNXA 1P3GC 3X1SA 5BNXB 3AV2D 4NE6A 3AZGA 2PYOB 2UWXA 3REIC 4Z5TD 4WU9D 3TU4D 1WWSA 4KUDA 2Y2IA 1Z2CB 2YFWA 2F8NG 3B6GB 1AOIA 5B24C 3W96C 1AOIB 3MGRA 3B6GC 1P3IC 5CPJA 1N1JA 1ID3A 3AZJA 1JFIB 3AZNA 1R4VA 5GT3D 5AV6D 2ZY4A 3AFAA 5GT0D 2DF4C 5B32C 5AV5D 5DNND 5CPKD 2AROB 3WA9A 3WTPA 3AZFA 3FDDA 3AL0C 5BNVA 3WTPB 2AROC 2Y2GA 4HGAB 1H3OA 3X1UB 4J8UD 5B31B 2BYKA 4YM6D 5B31C 3WAAA 3W97A 1U35A 5BT1D 3MVDB 5GXQB 1P3AA 3AZKA 4J8WB 4XUJD 1P34D 3LZ0B 3MVDC 5GXQC 2F8NB 1P3BD 5AV8A 4G92C 4H9OB 3LZ0C 3C1BC 5B2JB 3AZLD 4X23A 4CSRA 3MNNA 2ZY2A 5B2JC 1S32B 5B40B 4DQYB 2JCHA 3MGPA 1P3FB 4R8PD 1S32C 5B40C 5FUGB 1B67A 3KUYA 3C1CD 1EQZB 5BO0A 1P3FC 1M19D 4J8VD 1TZYA 5DNMD 5GSUD 3AV2B 3W98A 5B33B 4Z5TB 1P3KA 5CP6D 4WU9B 3AV2C 1P3KB 2JSSA 4H9QA 4Z5TC 4WU9C 3B0CW 3TU4C 1P3LA 4WU8D 1P3LB 2ZM5A 1M1AA 3O62D 3UTBB 3KSYA 3MGQA 3KXBD 5GT3B 4JJNA 5AV6B 1HQ3A 3UTBC 2RVQD 3W99A 4QLCA 5GT3C 1KX5D 5AV6C 5AV5B 3REJD 5DNNB 2FJ7A 5F99D 5CPKB 2XD5A 5GT0C 5CPIA 4AWLB 2CV5A 5AV5C 5DNNC 4YS3D 5CPKC 5B0YD 5BS7C 4AWLC 3A6ND 4J8UB 4KUDD 3MGSA 3UT9A 3AN2A 3AZMD 3WKJD 4J8UC 5AY8B 3W98B 4YM6C 5KDMB 3AZND 3REKA 4XUJB 5BT1C 4LD9A 3LJAA 1P3BB 1P3MA 4XUJC 1P34C 1P3BC 5B0ZA 3B6FD 2J8PA 3AZID 5B0ZB 3UTAA 1F66B 4KGCD 4WJ3C 1TAFA 4WNNB 2VQRA 1P3PA 3LZ1A 1F66C 3LELA 3C1CB 3AYWD 4E44A 1P3GB 1M19B 4R8PC 4J8VB 3AV1D 3VH5A 3REIB 3W97D 5GSUB 2Y2HA 3C1CC 3V9RB 2PYOA 1M19C 3EPHA 4J8VC 3A1KA 5CP6B 5DNMC 5GSUC 3R45B 5B24B 3W96B 3B6GA 5CP6C 5AV8D 2HIOD 4H9SA 1P3IB 1F1EA 3VH5T 4WU8B 5AV9D 5AVBD 3MNND 3O62B 4WU8C 3RELD 2NZDD 3KXBB 1JFIA 3F6TA 1HTAA 3O62C 5B32B 3AZHD 1BH8B 3KXBC 2XD1A 3KUYD 3REJB 2RVQC 4H9RB 5B1MD 4DRAA 2AROA 1KX5C 3REJC 3X1TD 1BFMA 5F99C 5B0YB 3W98D 4Z66D 3A6NB 3X1UA 4YS3C 5B0YC 3AZMB 1P3OD 3WKJB 3A6NC 5B1LD 5B31A 4KUDC 3AZMC 3WKJC 4Z2MG 1BH9B 3VH6A 3MVDA 5GXQA 1KX3D 4J8WA 1ZLAD 3NQJB 1HQ3D 3LZ0A 4G92B 2F8NA 3C1BA 3AZNC 2Y2LA 3C1BB 4H9OA 2BYMB 5E5AD 3EPLA 5B2JA 2Y2OA 3VH6T 1Q9CA 4XZQB 3B6FB 3AZIB 4ZUXD 4KGCB 1S32A 5B40A 4XZQC 3B6FC 3AZIC 3MGSD 3AZED 1P3FA 4KGCC 2RIQA 3P5JB 5FUGA 4J8XD 3AYWB 1EQZA 2Y2QA 1PZRA 4WV4B 3AV1B 4KHAB 3KWQD 5AVCB 3AYWC 4E45A 3AV2A 5B2ID 1KX4D 5B33A 3AV1C 4Z5TA 3W97C 1M18D 5AVCC 3REKD 3TU4A 4WU9A 3LJAD 3TU4B 4G91B 1P3MD 2HIOB 4H9PB 3REHD 5JRGD 4G91C 4UPKA 5AV9B 5AV8C 2HIOC 3X1VD 5AVBB 5AV9C 3RELB 3UTBA 2NQBD 5AVBC 5GT3A 4Z2MH 5AV6A 3MNNC 4UUZB 3RELC 3AZHB 3LZ1D 2NZDC 5GT0A 4NE3A 5GT0B 5AV5A 5DNNA 5B1MB 3AZHC 5JA4B 5BS7A 5CPKA 3KUYC 3X1TB 2PYOD 5B1MC 3X1SD 4Z66B 2ZY5A 3AZGD 1B6WA 3X1TC 4J8UA 3W98C 1P3OB 4Z66C 5G49B 5B1LB 4YM6A 5AY8A 1P3OC 1AOID 4YM6B 5B1LC 3MGRD 3B0DB 5KDMA 5CPJD 1KX3B 1ID3D 1ZLAB 3B0DC 4XUJA 3AZJD 1KX3C 1P34B 1P3BA 4CAYB 3AFAD 1ZLAC 1HQ3C 5E5AB 3WA9D 5E5AC 1WWIA 3WTPD 3AZLB 3AZFD 4ZUXB 1F66A 2W8SA 4WNNA 3X1UD 3AZLC 3AZEB 4ZUXC 3WTPE 4J8XB 1A7WA 4R8PB 3MGSC 3C1CA 3AZEC 1P3GA 1M19A 4J8VA 4J8XC 3KWQB 1KX4B 3REIA 5GSUA 3IP4C 5B2IB 2DQNC 2YFVB 3V9RA 5DNMB 3WAAD 1U35D 3KWQC 5CP6A 1M18B 1KX4C 2BG1A 4J8WD 5B2IC 1P3AD 3AZKD 3H0LC 3R45A 5B24A 3W96A 1M18C 3REHB 3REKC 3LJAC 1P3IA 5JRGB 4WU8A 2ZY3A 1P3MC 3REHC 4NE5A 3X1VB 2F8NK 1T3UA 5JRGC 3O62A 4X23D 2NQBB 3X1VC 3KXBA 5B32A 2NQBC 1BH8A 3MGPD 1KX5A 3REJA 3KFUG 1EQZD 4H9RA 3LZ1C 5CHLB 1KX5B 5F99B 1TZYD 3X1SB 5B0YA 5B33D 4YS3A 3AZGB 3B0BA 4YS3B 3A6NA 2PYOC 1P3KD 3X1SC 4EO5B 3AZMA 3WKJA 3AZGC 4KUDB 2YFWB 4EO5C 2HUEB 2LY8A 3MGRB 4H9SC 1P3LD 1BH9A 1AOIC 4M6BA 5CPJB 3UTBD 2HUEC 1N1JB 3VH5W 3MGRC 1M1AD 1ID3B 3MGQD 3AZJB 3NQJA 3AZNB 5CPJC 4JJND 3AFAB 1ID3C 3W99D 3AZJC 4QLCD 2BYMA 1W2EA 2Y2MA 3AFAC 2FJ7D 3WA9B 3B6FA 4XZQA 5CPID 3AZFB 3AZIA 2CV5D 2G5IC 5BNVB 2IO5B 4KGCA 3WA9C 3WTPC 3AZFC 1H3OB 2IO5C 4HGAC 4H9NA 3UT9D 3AN2D 3X1UC 4H9NB 5AY8D 3AYWA 2BYKB 3AV1A 2JE5A 4NFTA 4KHAA 5AVCA 3WAAB 3W97B 1U35B 3B0CT 1P3AB 3AZKB 3WAAC 1U35C 4LD9D 3EG5B 3EPJA 2HIOA 4H9PA 4J8WC 1P3AC 3AZKC 4ZBJB 3H0MC 5AV8B 5AV9A 5AVBA 1KU5A 4ZBJC 2F8NH 5B0ZD 4X23B 3RELA 2NZDA 4CSRB 3MNNB 1F66D 2Y2PA 3NQUA 2NZDB 3UTAD 3NQUB 3VH6W 4UUZA 4X23C 3AZHA 3MGPB 1P3PD 3LELD 5B1MA 3KUYB 5JA4A 1P3GD 3MGPC 5BO0B 3REID 3X1TA 1EQZC 1TZYB 4Z66A 2CWEA
chains in the Genus database with same CATH topology
2L5AA 1TZYC 5B33C 1P3OA 5B24D 3W96D 5G49A 5B1LA 4H9QB 1P3KC 1P3ID 3B6GD 4DRBA 1KX3A 1M1AB 1P3LC 3MGQB 1ZLAA 3EPKA 5B32D 4JJNB 1M1AC 3A1IA 1HQ3B 1P34A 4CAYA 2G5HC 3MGQC 3W99B 4QLCB 2FFFB 5E5AA 4JJNC 2FJ7B 3W99C 4QLCC 2AROD 5CPIB 2CV5B 2Y2JA 3AZLA 4ZUXA 2FJ7C 5CPIC 2CV5C 2F2AC 3AZEA 3MGSB 3UT9B 3AN2B 4J8XA 4R8PA 5B31D 1ULYA 3UT9C 3AN2C 3KWQA 1KX4A 5AY8C 5B2IA 2YFVA 5DNMA 1M18A 3MVDD 5GXQD 4WZSB 3REKB 5B32G 3LJAB 4LD9B 3LZ0D 3REHA 2F8ND 3C1BD 1P3MB 2Y2NA 5JRGA 4LD9C 3X1VA 5B2JD 4XZQD 3H0RC 5C3IB 2NQBA 3UTAB 2Y2KA 1TAFB 5B40D 5C3IC 5B0ZC 1S32D 1P3PB 1P3FD 3LZ1B 3UTAC 3LELB 5B31G 1P3PC 5F99A 3LELC 5AVCD 5BNXA 1P3GC 3X1SA 5BNXB 3AV2D 4NE6A 3AZGA 2PYOB 2UWXA 3REIC 4Z5TD 4WU9D 3TU4D 1WWSA 4KUDA 2Y2IA 1Z2CB 2YFWA 2F8NG 3B6GB 1AOIA 5B24C 3W96C 1AOIB 3MGRA 3B6GC 1P3IC 5CPJA 1N1JA 1ID3A 3AZJA 1JFIB 3AZNA 1R4VA 5GT3D 5AV6D 2ZY4A 3AFAA 5GT0D 2DF4C 5B32C 5AV5D 5DNND 5CPKD 2AROB 3WA9A 3WTPA 3AZFA 3FDDA 3AL0C 5BNVA 3WTPB 2AROC 2Y2GA 4HGAB 1H3OA 3X1UB 4J8UD 5B31B 2BYKA 4YM6D 5B31C 3WAAA 3W97A 1U35A 5BT1D 3MVDB 5GXQB 1P3AA 3AZKA 4J8WB 4XUJD 1P34D 3LZ0B 3MVDC 5GXQC 2F8NB 1P3BD 5AV8A 4G92C 4H9OB 3LZ0C 3C1BC 5B2JB 3AZLD 4X23A 4CSRA 3MNNA 2ZY2A 5B2JC 1S32B 5B40B 4DQYB 2JCHA 3MGPA 1P3FB 4R8PD 1S32C 5B40C 5FUGB 1B67A 3KUYA 3C1CD 1EQZB 5BO0A 1P3FC 1M19D 4J8VD 1TZYA 5DNMD 5GSUD 3AV2B 3W98A 5B33B 4Z5TB 1P3KA 5CP6D 4WU9B 3AV2C 1P3KB 2JSSA 4H9QA 4Z5TC 4WU9C 3B0CW 3TU4C 1P3LA 4WU8D 1P3LB 2ZM5A 1M1AA 3O62D 3UTBB 3KSYA 3MGQA 3KXBD 5GT3B 4JJNA 5AV6B 1HQ3A 3UTBC 2RVQD 3W99A 4QLCA 5GT3C 1KX5D 5AV6C 5AV5B 3REJD 5DNNB 2FJ7A 5F99D 5CPKB 2XD5A 5GT0C 5CPIA 4AWLB 2CV5A 5AV5C 5DNNC 4YS3D 5CPKC 5B0YD 5BS7C 4AWLC 3A6ND 4J8UB 4KUDD 3MGSA 3UT9A 3AN2A 3AZMD 3WKJD 4J8UC 5AY8B 3W98B 4YM6C 5KDMB 3AZND 3REKA 4XUJB 5BT1C 4LD9A 3LJAA 1P3BB 1P3MA 4XUJC 1P34C 1P3BC 5B0ZA 3B6FD 2J8PA 3AZID 5B0ZB 3UTAA 1F66B 4KGCD 4WJ3C 1TAFA 4WNNB 2VQRA 1P3PA 3LZ1A 1F66C 3LELA 3C1CB 3AYWD 4E44A 1P3GB 1M19B 4R8PC 4J8VB 3AV1D 3VH5A 3REIB 3W97D 5GSUB 2Y2HA 3C1CC 3V9RB 2PYOA 1M19C 3EPHA 4J8VC 3A1KA 5CP6B 5DNMC 5GSUC 3R45B 5B24B 3W96B 3B6GA 5CP6C 5AV8D 2HIOD 4H9SA 1P3IB 1F1EA 3VH5T 4WU8B 5AV9D 5AVBD 3MNND 3O62B 4WU8C 3RELD 2NZDD 3KXBB 1JFIA 3F6TA 1HTAA 3O62C 5B32B 3AZHD 1BH8B 3KXBC 2XD1A 3KUYD 3REJB 2RVQC 4H9RB 5B1MD 4DRAA 2AROA 1KX5C 3REJC 3X1TD 1BFMA 5F99C 5B0YB 3W98D 4Z66D 3A6NB 3X1UA 4YS3C 5B0YC 3AZMB 1P3OD 3WKJB 3A6NC 5B1LD 5B31A 4KUDC 3AZMC 3WKJC 4Z2MG 1BH9B 3VH6A 3MVDA 5GXQA 1KX3D 4J8WA 1ZLAD 3NQJB 1HQ3D 3LZ0A 4G92B 2F8NA 3C1BA 3AZNC 2Y2LA 3C1BB 4H9OA 2BYMB 5E5AD 3EPLA 5B2JA 2Y2OA 3VH6T 1Q9CA 4XZQB 3B6FB 3AZIB 4ZUXD 4KGCB 1S32A 5B40A 4XZQC 3B6FC 3AZIC 3MGSD 3AZED 1P3FA 4KGCC 2RIQA 3P5JB 5FUGA 4J8XD 3AYWB 1EQZA 2Y2QA 1PZRA 4WV4B 3AV1B 4KHAB 3KWQD 5AVCB 3AYWC 4E45A 3AV2A 5B2ID 1KX4D 5B33A 3AV1C 4Z5TA 3W97C 1M18D 5AVCC 3REKD 3TU4A 4WU9A 3LJAD 3TU4B 4G91B 1P3MD 2HIOB 4H9PB 3REHD 5JRGD 4G91C 4UPKA 5AV9B 5AV8C 2HIOC 3X1VD 5AVBB 5AV9C 3RELB 3UTBA 2NQBD 5AVBC 5GT3A 4Z2MH 5AV6A 3MNNC 4UUZB 3RELC 3AZHB 3LZ1D 2NZDC 5GT0A 4NE3A 5GT0B 5AV5A 5DNNA 5B1MB 3AZHC 5JA4B 5BS7A 5CPKA 3KUYC 3X1TB 2PYOD 5B1MC 3X1SD 4Z66B 2ZY5A 3AZGD 1B6WA 3X1TC 4J8UA 3W98C 1P3OB 4Z66C 5G49B 5B1LB 4YM6A 5AY8A 1P3OC 1AOID 4YM6B 5B1LC 3MGRD 3B0DB 5KDMA 5CPJD 1KX3B 1ID3D 1ZLAB 3B0DC 4XUJA 3AZJD 1KX3C 1P34B 1P3BA 4CAYB 3AFAD 1ZLAC 1HQ3C 5E5AB 3WA9D 5E5AC 1WWIA 3WTPD 3AZLB 3AZFD 4ZUXB 1F66A 2W8SA 4WNNA 3X1UD 3AZLC 3AZEB 4ZUXC 3WTPE 4J8XB 1A7WA 4R8PB 3MGSC 3C1CA 3AZEC 1P3GA 1M19A 4J8VA 4J8XC 3KWQB 1KX4B 3REIA 5GSUA 3IP4C 5B2IB 2DQNC 2YFVB 3V9RA 5DNMB 3WAAD 1U35D 3KWQC 5CP6A 1M18B 1KX4C 2BG1A 4J8WD 5B2IC 1P3AD 3AZKD 3H0LC 3R45A 5B24A 3W96A 1M18C 3REHB 3REKC 3LJAC 1P3IA 5JRGB 4WU8A 2ZY3A 1P3MC 3REHC 4NE5A 3X1VB 2F8NK 1T3UA 5JRGC 3O62A 4X23D 2NQBB 3X1VC 3KXBA 5B32A 2NQBC 1BH8A 3MGPD 1KX5A 3REJA 3KFUG 1EQZD 4H9RA 3LZ1C 5CHLB 1KX5B 5F99B 1TZYD 3X1SB 5B0YA 5B33D 4YS3A 3AZGB 3B0BA 4YS3B 3A6NA 2PYOC 1P3KD 3X1SC 4EO5B 3AZMA 3WKJA 3AZGC 4KUDB 2YFWB 4EO5C 2HUEB 2LY8A 3MGRB 4H9SC 1P3LD 1BH9A 1AOIC 4M6BA 5CPJB 3UTBD 2HUEC 1N1JB 3VH5W 3MGRC 1M1AD 1ID3B 3MGQD 3AZJB 3NQJA 3AZNB 5CPJC 4JJND 3AFAB 1ID3C 3W99D 3AZJC 4QLCD 2BYMA 1W2EA 2Y2MA 3AFAC 2FJ7D 3WA9B 3B6FA 4XZQA 5CPID 3AZFB 3AZIA 2CV5D 2G5IC 5BNVB 2IO5B 4KGCA 3WA9C 3WTPC 3AZFC 1H3OB 2IO5C 4HGAC 4H9NA 3UT9D 3AN2D 3X1UC 4H9NB 5AY8D 3AYWA 2BYKB 3AV1A 2JE5A 4NFTA 4KHAA 5AVCA 3WAAB 3W97B 1U35B 3B0CT 1P3AB 3AZKB 3WAAC 1U35C 4LD9D 3EG5B 3EPJA 2HIOA 4H9PA 4J8WC 1P3AC 3AZKC 4ZBJB 3H0MC 5AV8B 5AV9A 5AVBA 1KU5A 4ZBJC 2F8NH 5B0ZD 4X23B 3RELA 2NZDA 4CSRB 3MNNB 1F66D 2Y2PA 3NQUA 2NZDB 3UTAD 3NQUB 3VH6W 4UUZA 4X23C 3AZHA 3MGPB 1P3PD 3LELD 5B1MA 3KUYB 5JA4A 1P3GD 3MGPC 5BO0B 3REID 3X1TA 1EQZC 1TZYB 4Z66A 2CWEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L5A A;  1TZY C;  5B33 C;  1P3O A;  5B24 D;  3W96 D;  5G49 A;  5B1L A;  4H9Q B;  1P3K C;  1P3I D;  3B6G D;  4DRB A;  1KX3 A;  1M1A B;  1P3L C;  3MGQ B;  1ZLA A;  5B32 D;  4JJN B;  1M1A C;  1HQ3 B;  1P34 A;  4CAY A;  3MGQ C;  3W99 B;  4QLC B;  5E5A A;  4JJN C;  2FJ7 B;  3W99 C;  4QLC C;  2ARO D;  5CPI B;  2CV5 B;  3AZL A;  4ZUX A;  2FJ7 C;  5CPI C;  2CV5 C;  3AZE A;  3MGS B;  3UT9 B;  3AN2 B;  4J8X A;  4R8P A;  5B31 D;  1ULY A;  3UT9 C;  3AN2 C;  3KWQ A;  1KX4 A;  5AY8 C;  5B2I A;  2YFV A;  5DNM A;  1M18 A;  3MVD D;  5GXQ D;  4WZS B;  3REK B;  5B32 G;  3LJA B;  4LD9 B;  3LZ0 D;  3REH A;  2F8N D;  3C1B D;  1P3M B;  5JRG A;  4LD9 C;  3X1V A;  5B2J D;  4XZQ D;  5C3I B;  2NQB A;  3UTA B;  5B0Z C;  1TAF B;  5B40 D;  5C3I C;  1S32 D;  1P3P B;  1P3F D;  3LZ1 B;  3UTA C;  3LEL B;  5B31 G;  1P3P C;  5F99 A;  3LEL C;  5AVC D;  5BNX A;  1P3G C;  3X1S A;  5BNX B;  3AV2 D;  4NE6 A;  3AZG A;  2PYO B;  3REI C;  4Z5T D;  4WU9 D;  3TU4 D;  1WWS A;  4KUD A;  2YFW A;  2F8N G;  3B6G B;  1AOI A;  5B24 C;  3W96 C;  1AOI B;  3MGR A;  3B6G C;  1P3I C;  5CPJ A;  1N1J A;  1ID3 A;  3AZJ A;  1JFI B;  3AZN A;  1R4V A;  5GT3 D;  5AV6 D;  3AFA A;  5GT0 D;  5B32 C;  5AV5 D;  5DNN D;  5CPK D;  2ARO B;  3WA9 A;  3WTP A;  3AZF A;  5BNV A;  3WTP B;  2ARO C;  4HGA B;  1H3O A;  3X1U B;  4J8U D;  5B31 B;  2BYK A;  4YM6 D;  5B31 C;  3WAA A;  3W97 A;  1U35 A;  5BT1 D;  3MVD B;  5GXQ B;  1P3A A;  3AZK A;  4J8W B;  4XUJ D;  1P34 D;  3LZ0 B;  3MVD C;  5GXQ C;  2F8N B;  1P3B D;  5AV8 A;  4G92 C;  4H9O B;  3LZ0 C;  3C1B C;  5B2J B;  3AZL D;  4X23 A;  4CSR A;  3MNN A;  5B2J C;  1S32 B;  5B40 B;  3MGP A;  1P3F B;  4R8P D;  1S32 C;  5B40 C;  5FUG B;  1B67 A;  3KUY A;  3C1C D;  1EQZ B;  5BO0 A;  1P3F C;  1M19 D;  4J8V D;  1TZY A;  5DNM D;  5GSU D;  3AV2 B;  3W98 A;  5B33 B;  4Z5T B;  1P3K A;  5CP6 D;  4WU9 B;  3AV2 C;  1P3K B;  2JSS A;  4H9Q A;  4Z5T C;  4WU9 C;  3B0C W;  3TU4 C;  1P3L A;  4WU8 D;  1P3L B;  1M1A A;  3O62 D;  3UTB B;  3KSY A;  3MGQ A;  3KXB D;  5GT3 B;  4JJN A;  5AV6 B;  1HQ3 A;  3UTB C;  2RVQ D;  3W99 A;  4QLC A;  5GT3 C;  1KX5 D;  5AV6 C;  5AV5 B;  3REJ D;  5DNN B;  2FJ7 A;  5F99 D;  5CPK B;  5GT0 C;  5CPI A;  4AWL B;  2CV5 A;  5AV5 C;  5DNN C;  4YS3 D;  5CPK C;  5B0Y D;  5BS7 C;  4AWL C;  3A6N D;  4J8U B;  4KUD D;  3MGS A;  3UT9 A;  3AN2 A;  3AZM D;  3WKJ D;  4J8U C;  5AY8 B;  3W98 B;  4YM6 C;  5KDM B;  3AZN D;  3REK A;  4XUJ B;  5BT1 C;  4LD9 A;  3LJA A;  1P3B B;  1P3M A;  4XUJ C;  1P34 C;  1P3B C;  5B0Z A;  3B6F D;  3AZI D;  5B0Z B;  3UTA A;  1F66 B;  4KGC D;  1TAF A;  4WNN B;  1P3P A;  3LZ1 A;  1F66 C;  3LEL A;  3C1C B;  3AYW D;  4E44 A;  1P3G B;  1M19 B;  4R8P C;  4J8V B;  3AV1 D;  3VH5 A;  3REI B;  3W97 D;  5GSU B;  3C1C C;  3V9R B;  2PYO A;  1M19 C;  4J8V C;  5DNM C;  5CP6 B;  5GSU C;  3R45 B;  5B24 B;  3W96 B;  3B6G A;  5CP6 C;  5AV8 D;  2HIO D;  4H9S A;  1P3I B;  1F1E A;  3VH5 T;  4WU8 B;  5AV9 D;  5AVB D;  3MNN D;  3O62 B;  4WU8 C;  3REL D;  2NZD D;  3KXB B;  1JFI A;  1HTA A;  3O62 C;  5B32 B;  3AZH D;  1BH8 B;  3KXB C;  3KUY D;  3REJ B;  2RVQ C;  4H9R B;  5B1M D;  4DRA A;  2ARO A;  1KX5 C;  3REJ C;  3X1T D;  1BFM A;  5F99 C;  5B0Y B;  3W98 D;  4Z66 D;  3A6N B;  3X1U A;  4YS3 C;  5B0Y C;  3AZM B;  1P3O D;  3WKJ B;  3A6N C;  5B1L D;  5B31 A;  4KUD C;  3AZM C;  3WKJ C;  4Z2M G;  1BH9 B;  3VH6 A;  3MVD A;  5GXQ A;  1KX3 D;  4J8W A;  1ZLA D;  3NQJ B;  1HQ3 D;  3LZ0 A;  4G92 B;  2F8N A;  3C1B A;  3AZN C;  3C1B B;  4H9O A;  2BYM B;  5E5A D;  5B2J A;  3VH6 T;  1Q9C A;  4XZQ B;  3B6F B;  3AZI B;  4ZUX D;  4KGC B;  1S32 A;  5B40 A;  4XZQ C;  3B6F C;  3AZI C;  3MGS D;  3AZE D;  1P3F A;  4KGC C;  5FUG A;  4J8X D;  3AYW B;  1EQZ A;  3AV1 B;  4WV4 B;  4KHA B;  3KWQ D;  5AVC B;  3AYW C;  4E45 A;  3AV2 A;  5B2I D;  1KX4 D;  5B33 A;  3AV1 C;  4Z5T A;  3W97 C;  1M18 D;  5AVC C;  3REK D;  3TU4 A;  4WU9 A;  3LJA D;  3TU4 B;  4G91 B;  1P3M D;  2HIO B;  4H9P B;  3REH D;  5JRG D;  4G91 C;  5AV9 B;  5AV8 C;  2HIO C;  3X1V D;  5AVB B;  5AV9 C;  3REL B;  3UTB A;  2NQB D;  5AVB C;  5GT3 A;  4Z2M H;  5AV6 A;  3MNN C;  4UUZ B;  3REL C;  3AZH B;  3LZ1 D;  2NZD C;  5GT0 A;  4NE3 A;  5GT0 B;  5AV5 A;  5DNN A;  5B1M B;  3AZH C;  5JA4 B;  5BS7 A;  5CPK A;  3KUY C;  3X1T B;  2PYO D;  5B1M C;  3X1S D;  4Z66 B;  3AZG D;  1B6W A;  3X1T C;  4J8U A;  3W98 C;  1P3O B;  4Z66 C;  5G49 B;  5B1L B;  4YM6 A;  5AY8 A;  1P3O C;  1AOI D;  4YM6 B;  5B1L C;  3MGR D;  3B0D B;  5KDM A;  5CPJ D;  1KX3 B;  1ID3 D;  1ZLA B;  3B0D C;  4XUJ A;  3AZJ D;  1KX3 C;  1P34 B;  1P3B A;  4CAY B;  3AFA D;  1ZLA C;  1HQ3 C;  5E5A B;  3WA9 D;  5E5A C;  1WWI A;  3WTP D;  3AZL B;  3AZF D;  4ZUX B;  1F66 A;  4WNN A;  3X1U D;  3AZL C;  3AZE B;  4ZUX C;  3WTP E;  4J8X B;  1A7W A;  4R8P B;  3MGS C;  3C1C A;  3AZE C;  1P3G A;  1M19 A;  4J8V A;  4J8X C;  3KWQ B;  1KX4 B;  3REI A;  5GSU A;  5B2I B;  3V9R A;  2YFV B;  5DNM B;  3WAA D;  1U35 D;  3KWQ C;  5CP6 A;  1M18 B;  1KX4 C;  4J8W D;  5B2I C;  1P3A D;  3AZK D;  3R45 A;  5B24 A;  3W96 A;  1M18 C;  3REH B;  3REK C;  3LJA C;  1P3I A;  5JRG B;  4WU8 A;  1P3M C;  3REH C;  4NE5 A;  3X1V B;  2F8N K;  5JRG C;  3O62 A;  4X23 D;  2NQB B;  3X1V C;  3KXB A;  5B32 A;  2NQB C;  1BH8 A;  3MGP D;  1KX5 A;  3REJ A;  1EQZ D;  4H9R A;  3LZ1 C;  5CHL B;  1KX5 B;  5F99 B;  1TZY D;  3X1S B;  5B0Y A;  5B33 D;  4YS3 A;  3AZG B;  3B0B A;  4YS3 B;  3A6N A;  2PYO C;  1P3K D;  3X1S C;  4EO5 B;  3AZM A;  3WKJ A;  3AZG C;  4KUD B;  2YFW B;  4EO5 C;  2HUE B;  2LY8 A;  3MGR B;  4H9S C;  1P3L D;  1BH9 A;  1AOI C;  4M6B A;  5CPJ B;  3UTB D;  2HUE C;  1N1J B;  3VH5 W;  3MGR C;  1M1A D;  1ID3 B;  3MGQ D;  3AZJ B;  3NQJ A;  3AZN B;  5CPJ C;  4JJN D;  3AFA B;  1ID3 C;  3W99 D;  3AZJ C;  4QLC D;  2BYM A;  3AFA C;  2FJ7 D;  3WA9 B;  3B6F A;  4XZQ A;  5CPI D;  3AZF B;  3AZI A;  2CV5 D;  5BNV B;  2IO5 B;  4KGC A;  3WA9 C;  3WTP C;  3AZF C;  1H3O B;  2IO5 C;  4HGA C;  4H9N A;  3UT9 D;  3AN2 D;  3X1U C;  4H9N B;  5AY8 D;  3AYW A;  2BYK B;  3AV1 A;  4NFT A;  4KHA A;  5AVC A;  3WAA B;  3W97 B;  1U35 B;  3B0C T;  1P3A B;  3AZK B;  3WAA C;  1U35 C;  4LD9 D;  4J8W C;  2HIO A;  4H9P A;  1P3A C;  3AZK C;  4ZBJ B;  5AV8 B;  5AV9 A;  5AVB A;  1KU5 A;  4ZBJ C;  2F8N H;  5B0Z D;  4X23 B;  3REL A;  2NZD A;  4CSR B;  3MNN B;  1F66 D;  3NQU A;  2NZD B;  3UTA D;  3NQU B;  3VH6 W;  4UUZ A;  4X23 C;  3AZH A;  3MGP B;  1P3P D;  3LEL D;  5B1M A;  3KUY B;  5JA4 A;  1P3G D;  3MGP C;  5BO0 B;  3REI D;  3X1T A;  1EQZ C;  1TZY B;  4Z66 A;  2CWE A; 
#chains in the Genus database with same CATH topology
 2L5A A;  1TZY C;  5B33 C;  1P3O A;  5B24 D;  3W96 D;  5G49 A;  5B1L A;  4H9Q B;  1P3K C;  1P3I D;  3B6G D;  4DRB A;  1KX3 A;  1M1A B;  1P3L C;  3MGQ B;  1ZLA A;  3EPK A;  5B32 D;  4JJN B;  1M1A C;  3A1I A;  1HQ3 B;  1P34 A;  4CAY A;  2G5H C;  3MGQ C;  3W99 B;  4QLC B;  2FFF B;  5E5A A;  4JJN C;  2FJ7 B;  3W99 C;  4QLC C;  2ARO D;  5CPI B;  2CV5 B;  2Y2J A;  3AZL A;  4ZUX A;  2FJ7 C;  5CPI C;  2CV5 C;  2F2A C;  3AZE A;  3MGS B;  3UT9 B;  3AN2 B;  4J8X A;  4R8P A;  5B31 D;  1ULY A;  3UT9 C;  3AN2 C;  3KWQ A;  1KX4 A;  5AY8 C;  5B2I A;  2YFV A;  5DNM A;  1M18 A;  3MVD D;  5GXQ D;  4WZS B;  3REK B;  5B32 G;  3LJA B;  4LD9 B;  3LZ0 D;  3REH A;  2F8N D;  3C1B D;  1P3M B;  2Y2N A;  5JRG A;  4LD9 C;  3X1V A;  5B2J D;  4XZQ D;  3H0R C;  5C3I B;  2NQB A;  3UTA B;  2Y2K A;  1TAF B;  5B40 D;  5C3I C;  5B0Z C;  1S32 D;  1P3P B;  1P3F D;  3LZ1 B;  3UTA C;  3LEL B;  5B31 G;  1P3P C;  5F99 A;  3LEL C;  5AVC D;  5BNX A;  1P3G C;  3X1S A;  5BNX B;  3AV2 D;  4NE6 A;  3AZG A;  2PYO B;  2UWX A;  3REI C;  4Z5T D;  4WU9 D;  3TU4 D;  1WWS A;  4KUD A;  2Y2I A;  1Z2C B;  2YFW A;  2F8N G;  3B6G B;  1AOI A;  5B24 C;  3W96 C;  1AOI B;  3MGR A;  3B6G C;  1P3I C;  5CPJ A;  1N1J A;  1ID3 A;  3AZJ A;  1JFI B;  3AZN A;  1R4V A;  5GT3 D;  5AV6 D;  2ZY4 A;  3AFA A;  5GT0 D;  2DF4 C;  5B32 C;  5AV5 D;  5DNN D;  5CPK D;  2ARO B;  3WA9 A;  3WTP A;  3AZF A;  3FDD A;  3AL0 C;  5BNV A;  3WTP B;  2ARO C;  2Y2G A;  4HGA B;  1H3O A;  3X1U B;  4J8U D;  5B31 B;  2BYK A;  4YM6 D;  5B31 C;  3WAA A;  3W97 A;  1U35 A;  5BT1 D;  3MVD B;  5GXQ B;  1P3A A;  3AZK A;  4J8W B;  4XUJ D;  1P34 D;  3LZ0 B;  3MVD C;  5GXQ C;  2F8N B;  1P3B D;  5AV8 A;  4G92 C;  4H9O B;  3LZ0 C;  3C1B C;  5B2J B;  3AZL D;  4X23 A;  4CSR A;  3MNN A;  2ZY2 A;  5B2J C;  1S32 B;  5B40 B;  4DQY B;  2JCH A;  3MGP A;  1P3F B;  4R8P D;  1S32 C;  5B40 C;  5FUG B;  1B67 A;  3KUY A;  3C1C D;  1EQZ B;  5BO0 A;  1P3F C;  1M19 D;  4J8V D;  1TZY A;  5DNM D;  5GSU D;  3AV2 B;  3W98 A;  5B33 B;  4Z5T B;  1P3K A;  5CP6 D;  4WU9 B;  3AV2 C;  1P3K B;  2JSS A;  4H9Q A;  4Z5T C;  4WU9 C;  3B0C W;  3TU4 C;  1P3L A;  4WU8 D;  1P3L B;  2ZM5 A;  1M1A A;  3O62 D;  3UTB B;  3KSY A;  3MGQ A;  3KXB D;  5GT3 B;  4JJN A;  5AV6 B;  1HQ3 A;  3UTB C;  2RVQ D;  3W99 A;  4QLC A;  5GT3 C;  1KX5 D;  5AV6 C;  5AV5 B;  3REJ D;  5DNN B;  2FJ7 A;  5F99 D;  5CPK B;  2XD5 A;  5GT0 C;  5CPI A;  4AWL B;  2CV5 A;  5AV5 C;  5DNN C;  4YS3 D;  5CPK C;  5B0Y D;  5BS7 C;  4AWL C;  3A6N D;  4J8U B;  4KUD D;  3MGS A;  3UT9 A;  3AN2 A;  3AZM D;  3WKJ D;  4J8U C;  5AY8 B;  3W98 B;  4YM6 C;  5KDM B;  3AZN D;  3REK A;  4XUJ B;  5BT1 C;  4LD9 A;  3LJA A;  1P3B B;  1P3M A;  4XUJ C;  1P34 C;  1P3B C;  5B0Z A;  3B6F D;  2J8P A;  3AZI D;  5B0Z B;  3UTA A;  1F66 B;  4KGC D;  4WJ3 C;  1TAF A;  4WNN B;  2VQR A;  1P3P A;  3LZ1 A;  1F66 C;  3LEL A;  3C1C B;  3AYW D;  4E44 A;  1P3G B;  1M19 B;  4R8P C;  4J8V B;  3AV1 D;  3VH5 A;  3REI B;  3W97 D;  5GSU B;  2Y2H A;  3C1C C;  3V9R B;  2PYO A;  1M19 C;  3EPH A;  4J8V C;  3A1K A;  5CP6 B;  5DNM C;  5GSU C;  3R45 B;  5B24 B;  3W96 B;  3B6G A;  5CP6 C;  5AV8 D;  2HIO D;  4H9S A;  1P3I B;  1F1E A;  3VH5 T;  4WU8 B;  5AV9 D;  5AVB D;  3MNN D;  3O62 B;  4WU8 C;  3REL D;  2NZD D;  3KXB B;  1JFI A;  3F6T A;  1HTA A;  3O62 C;  5B32 B;  3AZH D;  1BH8 B;  3KXB C;  2XD1 A;  3KUY D;  3REJ B;  2RVQ C;  4H9R B;  5B1M D;  4DRA A;  2ARO A;  1KX5 C;  3REJ C;  3X1T D;  1BFM A;  5F99 C;  5B0Y B;  3W98 D;  4Z66 D;  3A6N B;  3X1U A;  4YS3 C;  5B0Y C;  3AZM B;  1P3O D;  3WKJ B;  3A6N C;  5B1L D;  5B31 A;  4KUD C;  3AZM C;  3WKJ C;  4Z2M G;  1BH9 B;  3VH6 A;  3MVD A;  5GXQ A;  1KX3 D;  4J8W A;  1ZLA D;  3NQJ B;  1HQ3 D;  3LZ0 A;  4G92 B;  2F8N A;  3C1B A;  3AZN C;  2Y2L A;  3C1B B;  4H9O A;  2BYM B;  5E5A D;  3EPL A;  5B2J A;  2Y2O A;  3VH6 T;  1Q9C A;  4XZQ B;  3B6F B;  3AZI B;  4ZUX D;  4KGC B;  1S32 A;  5B40 A;  4XZQ C;  3B6F C;  3AZI C;  3MGS D;  3AZE D;  1P3F A;  4KGC C;  2RIQ A;  3P5J B;  5FUG A;  4J8X D;  3AYW B;  1EQZ A;  2Y2Q A;  1PZR A;  4WV4 B;  3AV1 B;  4KHA B;  3KWQ D;  5AVC B;  3AYW C;  4E45 A;  3AV2 A;  5B2I D;  1KX4 D;  5B33 A;  3AV1 C;  4Z5T A;  3W97 C;  1M18 D;  5AVC C;  3REK D;  3TU4 A;  4WU9 A;  3LJA D;  3TU4 B;  4G91 B;  1P3M D;  2HIO B;  4H9P B;  3REH D;  5JRG D;  4G91 C;  4UPK A;  5AV9 B;  5AV8 C;  2HIO C;  3X1V D;  5AVB B;  5AV9 C;  3REL B;  3UTB A;  2NQB D;  5AVB C;  5GT3 A;  4Z2M H;  5AV6 A;  3MNN C;  4UUZ B;  3REL C;  3AZH B;  3LZ1 D;  2NZD C;  5GT0 A;  4NE3 A;  5GT0 B;  5AV5 A;  5DNN A;  5B1M B;  3AZH C;  5JA4 B;  5BS7 A;  5CPK A;  3KUY C;  3X1T B;  2PYO D;  5B1M C;  3X1S D;  4Z66 B;  2ZY5 A;  3AZG D;  1B6W A;  3X1T C;  4J8U A;  3W98 C;  1P3O B;  4Z66 C;  5G49 B;  5B1L B;  4YM6 A;  5AY8 A;  1P3O C;  1AOI D;  4YM6 B;  5B1L C;  3MGR D;  3B0D B;  5KDM A;  5CPJ D;  1KX3 B;  1ID3 D;  1ZLA B;  3B0D C;  4XUJ A;  3AZJ D;  1KX3 C;  1P34 B;  1P3B A;  4CAY B;  3AFA D;  1ZLA C;  1HQ3 C;  5E5A B;  3WA9 D;  5E5A C;  1WWI A;  3WTP D;  3AZL B;  3AZF D;  4ZUX B;  1F66 A;  2W8S A;  4WNN A;  3X1U D;  3AZL C;  3AZE B;  4ZUX C;  3WTP E;  4J8X B;  1A7W A;  4R8P B;  3MGS C;  3C1C A;  3AZE C;  1P3G A;  1M19 A;  4J8V A;  4J8X C;  3KWQ B;  1KX4 B;  3REI A;  5GSU A;  3IP4 C;  5B2I B;  2DQN C;  2YFV B;  3V9R A;  5DNM B;  3WAA D;  1U35 D;  3KWQ C;  5CP6 A;  1M18 B;  1KX4 C;  2BG1 A;  4J8W D;  5B2I C;  1P3A D;  3AZK D;  3H0L C;  3R45 A;  5B24 A;  3W96 A;  1M18 C;  3REH B;  3REK C;  3LJA C;  1P3I A;  5JRG B;  4WU8 A;  2ZY3 A;  1P3M C;  3REH C;  4NE5 A;  3X1V B;  2F8N K;  1T3U A;  5JRG C;  3O62 A;  4X23 D;  2NQB B;  3X1V C;  3KXB A;  5B32 A;  2NQB C;  1BH8 A;  3MGP D;  1KX5 A;  3REJ A;  3KFU G;  1EQZ D;  4H9R A;  3LZ1 C;  5CHL B;  1KX5 B;  5F99 B;  1TZY D;  3X1S B;  5B0Y A;  5B33 D;  4YS3 A;  3AZG B;  3B0B A;  4YS3 B;  3A6N A;  2PYO C;  1P3K D;  3X1S C;  4EO5 B;  3AZM A;  3WKJ A;  3AZG C;  4KUD B;  2YFW B;  4EO5 C;  2HUE B;  2LY8 A;  3MGR B;  4H9S C;  1P3L D;  1BH9 A;  1AOI C;  4M6B A;  5CPJ B;  3UTB D;  2HUE C;  1N1J B;  3VH5 W;  3MGR C;  1M1A D;  1ID3 B;  3MGQ D;  3AZJ B;  3NQJ A;  3AZN B;  5CPJ C;  4JJN D;  3AFA B;  1ID3 C;  3W99 D;  3AZJ C;  4QLC D;  2BYM A;  1W2E A;  2Y2M A;  3AFA C;  2FJ7 D;  3WA9 B;  3B6F A;  4XZQ A;  5CPI D;  3AZF B;  3AZI A;  2CV5 D;  2G5I C;  5BNV B;  2IO5 B;  4KGC A;  3WA9 C;  3WTP C;  3AZF C;  1H3O B;  2IO5 C;  4HGA C;  4H9N A;  3UT9 D;  3AN2 D;  3X1U C;  4H9N B;  5AY8 D;  3AYW A;  2BYK B;  3AV1 A;  2JE5 A;  4NFT A;  4KHA A;  5AVC A;  3WAA B;  3W97 B;  1U35 B;  3B0C T;  1P3A B;  3AZK B;  3WAA C;  1U35 C;  4LD9 D;  3EG5 B;  3EPJ A;  2HIO A;  4H9P A;  4J8W C;  1P3A C;  3AZK C;  4ZBJ B;  3H0M C;  5AV8 B;  5AV9 A;  5AVB A;  1KU5 A;  4ZBJ C;  2F8N H;  5B0Z D;  4X23 B;  3REL A;  2NZD A;  4CSR B;  3MNN B;  1F66 D;  2Y2P A;  3NQU A;  2NZD B;  3UTA D;  3NQU B;  3VH6 W;  4UUZ A;  4X23 C;  3AZH A;  3MGP B;  1P3P D;  3LEL D;  5B1M A;  3KUY B;  5JA4 A;  1P3G D;  3MGP C;  5BO0 B;  3REI D;  3X1T A;  1EQZ C;  1TZY B;  4Z66 A;  2CWE A; 
#chains in the Genus database with same CATH homology
 2L5A A;  1TZY C;  5B33 C;  1P3O A;  5B24 D;  3W96 D;  5G49 A;  5B1L A;  4H9Q B;  1P3K C;  1P3I D;  3B6G D;  4DRB A;  1KX3 A;  1M1A B;  1P3L C;  3MGQ B;  1ZLA A;  3EPK A;  5B32 D;  4JJN B;  1M1A C;  3A1I A;  1HQ3 B;  1P34 A;  4CAY A;  2G5H C;  3MGQ C;  3W99 B;  4QLC B;  2FFF B;  5E5A A;  4JJN C;  2FJ7 B;  3W99 C;  4QLC C;  2ARO D;  5CPI B;  2CV5 B;  2Y2J A;  3AZL A;  4ZUX A;  2FJ7 C;  5CPI C;  2CV5 C;  2F2A C;  3AZE A;  3MGS B;  3UT9 B;  3AN2 B;  4J8X A;  4R8P A;  5B31 D;  1ULY A;  3UT9 C;  3AN2 C;  3KWQ A;  1KX4 A;  5AY8 C;  5B2I A;  2YFV A;  5DNM A;  1M18 A;  3MVD D;  5GXQ D;  4WZS B;  3REK B;  5B32 G;  3LJA B;  4LD9 B;  3LZ0 D;  3REH A;  2F8N D;  3C1B D;  1P3M B;  2Y2N A;  5JRG A;  4LD9 C;  3X1V A;  5B2J D;  4XZQ D;  3H0R C;  5C3I B;  2NQB A;  3UTA B;  2Y2K A;  1TAF B;  5B40 D;  5C3I C;  5B0Z C;  1S32 D;  1P3P B;  1P3F D;  3LZ1 B;  3UTA C;  3LEL B;  5B31 G;  1P3P C;  5F99 A;  3LEL C;  5AVC D;  5BNX A;  1P3G C;  3X1S A;  5BNX B;  3AV2 D;  4NE6 A;  3AZG A;  2PYO B;  2UWX A;  3REI C;  4Z5T D;  4WU9 D;  3TU4 D;  1WWS A;  4KUD A;  2Y2I A;  1Z2C B;  2YFW A;  2F8N G;  3B6G B;  1AOI A;  5B24 C;  3W96 C;  1AOI B;  3MGR A;  3B6G C;  1P3I C;  5CPJ A;  1N1J A;  1ID3 A;  3AZJ A;  1JFI B;  3AZN A;  1R4V A;  5GT3 D;  5AV6 D;  2ZY4 A;  3AFA A;  5GT0 D;  2DF4 C;  5B32 C;  5AV5 D;  5DNN D;  5CPK D;  2ARO B;  3WA9 A;  3WTP A;  3AZF A;  3FDD A;  3AL0 C;  5BNV A;  3WTP B;  2ARO C;  2Y2G A;  4HGA B;  1H3O A;  3X1U B;  4J8U D;  5B31 B;  2BYK A;  4YM6 D;  5B31 C;  3WAA A;  3W97 A;  1U35 A;  5BT1 D;  3MVD B;  5GXQ B;  1P3A A;  3AZK A;  4J8W B;  4XUJ D;  1P34 D;  3LZ0 B;  3MVD C;  5GXQ C;  2F8N B;  1P3B D;  5AV8 A;  4G92 C;  4H9O B;  3LZ0 C;  3C1B C;  5B2J B;  3AZL D;  4X23 A;  4CSR A;  3MNN A;  2ZY2 A;  5B2J C;  1S32 B;  5B40 B;  4DQY B;  2JCH A;  3MGP A;  1P3F B;  4R8P D;  1S32 C;  5B40 C;  5FUG B;  1B67 A;  3KUY A;  3C1C D;  1EQZ B;  5BO0 A;  1P3F C;  1M19 D;  4J8V D;  1TZY A;  5DNM D;  5GSU D;  3AV2 B;  3W98 A;  5B33 B;  4Z5T B;  1P3K A;  5CP6 D;  4WU9 B;  3AV2 C;  1P3K B;  2JSS A;  4H9Q A;  4Z5T C;  4WU9 C;  3B0C W;  3TU4 C;  1P3L A;  4WU8 D;  1P3L B;  2ZM5 A;  1M1A A;  3O62 D;  3UTB B;  3KSY A;  3MGQ A;  3KXB D;  5GT3 B;  4JJN A;  5AV6 B;  1HQ3 A;  3UTB C;  2RVQ D;  3W99 A;  4QLC A;  5GT3 C;  1KX5 D;  5AV6 C;  5AV5 B;  3REJ D;  5DNN B;  2FJ7 A;  5F99 D;  5CPK B;  2XD5 A;  5GT0 C;  5CPI A;  4AWL B;  2CV5 A;  5AV5 C;  5DNN C;  4YS3 D;  5CPK C;  5B0Y D;  5BS7 C;  4AWL C;  3A6N D;  4J8U B;  4KUD D;  3MGS A;  3UT9 A;  3AN2 A;  3AZM D;  3WKJ D;  4J8U C;  5AY8 B;  3W98 B;  4YM6 C;  5KDM B;  3AZN D;  3REK A;  4XUJ B;  5BT1 C;  4LD9 A;  3LJA A;  1P3B B;  1P3M A;  4XUJ C;  1P34 C;  1P3B C;  5B0Z A;  3B6F D;  2J8P A;  3AZI D;  5B0Z B;  3UTA A;  1F66 B;  4KGC D;  4WJ3 C;  1TAF A;  4WNN B;  2VQR A;  1P3P A;  3LZ1 A;  1F66 C;  3LEL A;  3C1C B;  3AYW D;  4E44 A;  1P3G B;  1M19 B;  4R8P C;  4J8V B;  3AV1 D;  3VH5 A;  3REI B;  3W97 D;  5GSU B;  2Y2H A;  3C1C C;  3V9R B;  2PYO A;  1M19 C;  3EPH A;  4J8V C;  3A1K A;  5CP6 B;  5DNM C;  5GSU C;  3R45 B;  5B24 B;  3W96 B;  3B6G A;  5CP6 C;  5AV8 D;  2HIO D;  4H9S A;  1P3I B;  1F1E A;  3VH5 T;  4WU8 B;  5AV9 D;  5AVB D;  3MNN D;  3O62 B;  4WU8 C;  3REL D;  2NZD D;  3KXB B;  1JFI A;  3F6T A;  1HTA A;  3O62 C;  5B32 B;  3AZH D;  1BH8 B;  3KXB C;  2XD1 A;  3KUY D;  3REJ B;  2RVQ C;  4H9R B;  5B1M D;  4DRA A;  2ARO A;  1KX5 C;  3REJ C;  3X1T D;  1BFM A;  5F99 C;  5B0Y B;  3W98 D;  4Z66 D;  3A6N B;  3X1U A;  4YS3 C;  5B0Y C;  3AZM B;  1P3O D;  3WKJ B;  3A6N C;  5B1L D;  5B31 A;  4KUD C;  3AZM C;  3WKJ C;  4Z2M G;  1BH9 B;  3VH6 A;  3MVD A;  5GXQ A;  1KX3 D;  4J8W A;  1ZLA D;  3NQJ B;  1HQ3 D;  3LZ0 A;  4G92 B;  2F8N A;  3C1B A;  3AZN C;  2Y2L A;  3C1B B;  4H9O A;  2BYM B;  5E5A D;  3EPL A;  5B2J A;  2Y2O A;  3VH6 T;  1Q9C A;  4XZQ B;  3B6F B;  3AZI B;  4ZUX D;  4KGC B;  1S32 A;  5B40 A;  4XZQ C;  3B6F C;  3AZI C;  3MGS D;  3AZE D;  1P3F A;  4KGC C;  2RIQ A;  3P5J B;  5FUG A;  4J8X D;  3AYW B;  1EQZ A;  2Y2Q A;  1PZR A;  4WV4 B;  3AV1 B;  4KHA B;  3KWQ D;  5AVC B;  3AYW C;  4E45 A;  3AV2 A;  5B2I D;  1KX4 D;  5B33 A;  3AV1 C;  4Z5T A;  3W97 C;  1M18 D;  5AVC C;  3REK D;  3TU4 A;  4WU9 A;  3LJA D;  3TU4 B;  4G91 B;  1P3M D;  2HIO B;  4H9P B;  3REH D;  5JRG D;  4G91 C;  4UPK A;  5AV9 B;  5AV8 C;  2HIO C;  3X1V D;  5AVB B;  5AV9 C;  3REL B;  3UTB A;  2NQB D;  5AVB C;  5GT3 A;  4Z2M H;  5AV6 A;  3MNN C;  4UUZ B;  3REL C;  3AZH B;  3LZ1 D;  2NZD C;  5GT0 A;  4NE3 A;  5GT0 B;  5AV5 A;  5DNN A;  5B1M B;  3AZH C;  5JA4 B;  5BS7 A;  5CPK A;  3KUY C;  3X1T B;  2PYO D;  5B1M C;  3X1S D;  4Z66 B;  2ZY5 A;  3AZG D;  1B6W A;  3X1T C;  4J8U A;  3W98 C;  1P3O B;  4Z66 C;  5G49 B;  5B1L B;  4YM6 A;  5AY8 A;  1P3O C;  1AOI D;  4YM6 B;  5B1L C;  3MGR D;  3B0D B;  5KDM A;  5CPJ D;  1KX3 B;  1ID3 D;  1ZLA B;  3B0D C;  4XUJ A;  3AZJ D;  1KX3 C;  1P34 B;  1P3B A;  4CAY B;  3AFA D;  1ZLA C;  1HQ3 C;  5E5A B;  3WA9 D;  5E5A C;  1WWI A;  3WTP D;  3AZL B;  3AZF D;  4ZUX B;  1F66 A;  2W8S A;  4WNN A;  3X1U D;  3AZL C;  3AZE B;  4ZUX C;  3WTP E;  4J8X B;  1A7W A;  4R8P B;  3MGS C;  3C1C A;  3AZE C;  1P3G A;  1M19 A;  4J8V A;  4J8X C;  3KWQ B;  1KX4 B;  3REI A;  5GSU A;  3IP4 C;  5B2I B;  2DQN C;  2YFV B;  3V9R A;  5DNM B;  3WAA D;  1U35 D;  3KWQ C;  5CP6 A;  1M18 B;  1KX4 C;  2BG1 A;  4J8W D;  5B2I C;  1P3A D;  3AZK D;  3H0L C;  3R45 A;  5B24 A;  3W96 A;  1M18 C;  3REH B;  3REK C;  3LJA C;  1P3I A;  5JRG B;  4WU8 A;  2ZY3 A;  1P3M C;  3REH C;  4NE5 A;  3X1V B;  2F8N K;  1T3U A;  5JRG C;  3O62 A;  4X23 D;  2NQB B;  3X1V C;  3KXB A;  5B32 A;  2NQB C;  1BH8 A;  3MGP D;  1KX5 A;  3REJ A;  3KFU G;  1EQZ D;  4H9R A;  3LZ1 C;  5CHL B;  1KX5 B;  5F99 B;  1TZY D;  3X1S B;  5B0Y A;  5B33 D;  4YS3 A;  3AZG B;  3B0B A;  4YS3 B;  3A6N A;  2PYO C;  1P3K D;  3X1S C;  4EO5 B;  3AZM A;  3WKJ A;  3AZG C;  4KUD B;  2YFW B;  4EO5 C;  2HUE B;  2LY8 A;  3MGR B;  4H9S C;  1P3L D;  1BH9 A;  1AOI C;  4M6B A;  5CPJ B;  3UTB D;  2HUE C;  1N1J B;  3VH5 W;  3MGR C;  1M1A D;  1ID3 B;  3MGQ D;  3AZJ B;  3NQJ A;  3AZN B;  5CPJ C;  4JJN D;  3AFA B;  1ID3 C;  3W99 D;  3AZJ C;  4QLC D;  2BYM A;  1W2E A;  2Y2M A;  3AFA C;  2FJ7 D;  3WA9 B;  3B6F A;  4XZQ A;  5CPI D;  3AZF B;  3AZI A;  2CV5 D;  2G5I C;  5BNV B;  2IO5 B;  4KGC A;  3WA9 C;  3WTP C;  3AZF C;  1H3O B;  2IO5 C;  4HGA C;  4H9N A;  3UT9 D;  3AN2 D;  3X1U C;  4H9N B;  5AY8 D;  3AYW A;  2BYK B;  3AV1 A;  2JE5 A;  4NFT A;  4KHA A;  5AVC A;  3WAA B;  3W97 B;  1U35 B;  3B0C T;  1P3A B;  3AZK B;  3WAA C;  1U35 C;  4LD9 D;  3EG5 B;  3EPJ A;  2HIO A;  4H9P A;  4J8W C;  1P3A C;  3AZK C;  4ZBJ B;  3H0M C;  5AV8 B;  5AV9 A;  5AVB A;  1KU5 A;  4ZBJ C;  2F8N H;  5B0Z D;  4X23 B;  3REL A;  2NZD A;  4CSR B;  3MNN B;  1F66 D;  2Y2P A;  3NQU A;  2NZD B;  3UTA D;  3NQU B;  3VH6 W;  4UUZ A;  4X23 C;  3AZH A;  3MGP B;  1P3P D;  3LEL D;  5B1M A;  3KUY B;  5JA4 A;  1P3G D;  3MGP C;  5BO0 B;  3REI D;  3X1T A;  1EQZ C;  1TZY B;  4Z66 A;  2CWE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...