5FUGA

Crystal structure of a human yl1-h2a.z-h2b complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
89
structure length
89
Chain Sequence
SRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Basis and Specificity of H2A.Z-H2B Recognition and Deposition by the Histone Chaperone Yl1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords HISTONE H2A.Z
total genus 29
structure length 89
sequence length 89
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2016-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5fugA00
4WU8C 1A7WA 4QLCB 4E44A 5GT0B 3KWQA 5AV6D 4J8VD 3X1VB 3AN2B 4H9SC 1TAFA 5AV9C 1S32B 4KGCD 5BT1D 3AZLB 3WKJC 3MGPC 5AVBC 4J8WD 3NQUA 3X1TB 1KX5C 1ID3A 1KX3D 2PYOC 5AV8C 3LZ1D 4YM6C 3AZHC 3MGRB 2F8NB 5CP6D 3W99C 2CV5A 4H9SA 3WTPB 4Z2MG 3MGSC 3UTAC 4KUDD 3MVDB 4ZUXD 3AZMC 3X1UB 3AZJA 1P3LC 3AZLA 5E5AB 1EQZC 3AV2D 3O62D 3LZ0D 5F99C 5B24C 5AV8A 1ID3B 4KGCC 4YM6A 3AZHA 3AZFB 1P3AC 3AZGB 1P3FA 5B33D 4CAYB 5DNND 3X1TD 4J8WB 5F99D 2FJ7D 1U35C 1M18C 3AZEB 4H9PB 5GT3A 3UT9B 3C1CB 1N1JB 3TU4C 1HQ3D 5AV8B 4DRAA 4H9NB 4G91C 3VH5A 5B2IB 5GT3D 2HIOC 4R8PB 2YFWB 3REKD 3O62A 3LZ0A 3AZIB 4H9RA 1ZLAB 1P3AD 4Z5TC 5CPJD 4Z66B 4YS3D 4ZBJC 4XUJC 2IO5C 4H9PA 5B0YC 3TU4A 3AZFC 2NZDB 1KU5A 1P3KA 1WWIA 1P3OD 4H9NA 4J8XC 4AWLC 5B31A 3LELA 4XZQC 3A6ND 4QLCA 3W96D 5B32D 5B0ZD 3X1VA 1TAFB 4H9OB 3V9RA 1JFIA 3B6FA 5AY8C 1HQ3A 1BFMA 3A6NA 5CPIA 3LZ1B 5B0ZA 4M6BA 4JJNB 5CPJA 1P34B 5JRGA 5B40B 3A6NC 5KDMA 2NQBC 3RELB 1AOIA 3REIC 4ZUXB 2RVQC 3UTBA 4J8VB 2AROB 5CPJC 5DNMD 4NE6A 4J8VC 5CPJB 1P34A 4YS3B 3MNNC 5B32C 1KX3C 3MGQC 4J8WA 3AZED 4WU9C 2NQBA 1M19B 4LD9B 2HIOB 1EQZB 3VH6W 3LJAD 3UTBC 5JRGD 3NQJA 3MGQD 3WAAB 4J8VA 4R8PA 5GSUC 3UT9D 3AV2A 1P34C 3KUYC 2JSSA 3WA9D 1TZYC 4Z2MH 4H9RB 1ZLAA 5B33C 3AZKB 3AZNA 2HUEC 4XZQA 5B2JA 3LJAC 3WA9A 5CPKC 4HGAC 3KWQC 4KUDA 4X23C 5DNMA 5B32B 5B1MB 4X23B 1KX4C 3VH6T 3AZKD 3AV2B 2NQBD 5F99B 3B0CW 5DNNC 2FJ7C 5E5AC 5AVBA 1ZLAC 4H9OA 3V9RB 1JFIB 3B6FB 4UUZA 3REJB 5GXQC 3WA9C 3KUYB 5CPIB 3LZ1A 2IO5B 5CP6B 5GSUB 2F8NH 5B0ZB 4Z66C 4NFTA 1KX4A 5FUGA 3UT9C 5F99A 3AZLD 1BH9A 5AV5B 3C1BB 1P3OB 4WZSB 5JRGB 4G91B 5B40A 2L5AA 3LZ1C 1KX3B 3W96B 3RELA 5B1LD 5B1MC 1S32A 3X1TA 1M18A 2AROA 2RVQD 1BH9B 1P3KD 1P3MD 4J8XB 5B24D 3AV1D 1H3OB 4CSRB 1TZYB 5AVCA 5BO0B 3AZJC 1P3LA 4LD9A 1KX4D 3W96A 2HIOA 5BS7C 5B24A 2PYOB 5B31D 4NE3A 5B33B 5AV5C 3MGSB 3C1BC 3UTAB 4J8UA 3AV1C 1P3AA 5B0YA 3AZHB 1M19C 3AZFA 3WKJA 1B6WA 3MNND 1U35A 5B31C 5GT0C 5BS7A 5B0YD 4XZQB 5B2JB 3WA9B 2LY8A 1KX5A 5B1MD 5B1LC 5GXQB 4KUDB 2PYOA 4J8XD 4J8UC 3AN2C 1N1JA 3B6FD 2NZDC 1P3AB 5B0YB 1EQZD 3X1SB 1M1AA 5BNVB 5B2IA 4X23D 5GT0A 3REJA 4HGAB 3KWQB 1F66C 4H9QA 3MGPD 3AV1B 3AZKC 5BNXB 5AV6B 4WNNA 3UTBD 5AV9D 5AV5D 3KXBA 3C1BD 3TU4B 1P3PA 2NZDA 3KWQD 3WKJD 1M1AC 3X1SA 4DRBA 4JJNC 3REJC 3B6FC 1BH8A 1F66A 2NZDD 4EO5B 3C1CD 3B0CT 1ID3D 3X1UA 3AFAD 3AZJB 4WNNB 1P3PC 1F66D 4WU9A 1P3PB 3REHC 4JJNA 3R45A 4Z5TA 1P3OC 3VH5W 3WTPC 2F8NG 4R8PC 4KHAA 4JJND 1AOIC 1P3FD 3NQUB 3REID 5CP6C 4ZUXA 3KUYD 3AZND 2YFVA 5AY8A 3W98D 1P3BA 2CV5B 2YFWA 3WTPA 3REHD 1HTAA 4E45A 2BYKA 5B32G 5B0ZC 3O62B 3LZ0B 3MVDA 3AZGC 2F8NK 3W98A 5E5AA 1P3BD 3W97B 3WTPD 4ZUXC 3AN2D 1P3KB 1P3MB 4Z66D 2CWEA 3AYWC 3AV2C 1P3MC 5B31B 5BNVA 1P3BB 3B6GC 3RELD 1P3ID 4WV4B 3WAAC 1F1EA 1HQ3B 5AV8D 2CV5C 3AZIC 2AROD 3KXBB 4QLCD 5AY8D 3MGPB 1P3IA 1P3MA 3MNNA 2HIOD 1B67A 3AZLC 3REKB 5DNNA 2FJ7A 5B1MA 1S32C 3B6GA 3TU4D 3AYWD 5AV6C 3X1TC 3AZEC 2AROC 3AZFD 1M18D 1P34D 5KDMB 4Z66A 2F8ND 1P3GC 4WU9B 1P3IC 5GSUA 3MNNB 4WU8B 5JA4B 3W96C 5AVCD 3REKA 1KX4B 4ZBJB 4XUJB 2F8NA 1U35D 4Z5TB 5FUGB 5GT3C 1ID3C 3B6GB 5B40C 5GSUD 4KGCB 4YS3A 5AV5A 3KXBD 3C1BA 4G92B 3MGSD 3UTAD 5CPKA 3W99A 4KHAB 4EO5C 4KUDC 5DNMC 1M19A 4XUJD 3A6NB 3AZMA 3W97C 1EQZA 3REKC 5JA4A 5B2ID 4WU8A 1TZYD 4YM6B 4XUJA 5B31G 5AY8B 1M18B 4KGCA 5AV9A 1KX5D 4CAYA 5AVCC 2BYKB 4J8XA 1WWSA 1P3FC 4LD9C 5BT1C 1P3PD 3W97A 1P3GD 4R8PD 5GT3B 3X1VC 3UT9A 1AOIB 5C3IB 3C1CA 5B24B 3B0DC 5DNMB 3VH6A 3MGSA 3UTAA 5CPKD 3W99D 4J8UB 4AWLB 5GXQD 3REIB 3RELC 2NQBB 3O62C 3LZ0C 3B0BA 2CV5D 3C1CC 1KX5B 5JRGC 5G49B 3LELB 5B2JD 4XZQD 3REIA 3AFAA 3X1UD 1M1AB 4WU9D 4QLCC 3AZHD 3AZKA 1ULYA 3AZNB 1KX3A 3AV1A 3MGQA 4J8WC 1HQ3C 4Z5TD 5G49A 5E5AD 3AFAC 3MVDD 3AFAB 3AZJD 5B1LA 5CPKB 1S32D 4J8UD 3W99B 3LJAB 4UUZB 2BYMA 3MGRC 2HUEB 1P3KC 5BO0A 3X1UC 3AN2A 1P3LB 3KUYA 3AZMB 4YM6D 3LELC 5B33A 3REHA 5B2IC 5AVBD 3W98C 3UTBB 1P3LD 5AV9B 5CHLB 1P3OA 3R45B 3MGRA 5CPIC 1R4VA 2BYMB 4G92C 1U35B 3B6GD 3KXBC 1M1AD 4NE5A 3X1SC 3REHB 3AZGD 3NQJB 3WAAA 5B40D 5CPID 1P3BC 3WTPE 2YFVB 3AZGA 1P3FB 1H3OA 4CSRA 4WU8D 1TZYA 5AVCB 5C3IC 3X1SD 4H9QB 3LELD 3W98B 5BNXA 5AV6A 3AZEA 3AYWA 5B32A 3X1VD 4X23A 3MGRD 3REJD 3VH5T 3KSYA 1P3GA 1AOID 3AZID 2PYOD 5AVBB 4LD9D 3WKJB 1BH8B 1F66B 3AZIA 5CP6A 3MGQB 3WAAD 5GXQA 1Q9CA 4YS3C 5GT0D 3AYWB 1ZLAD 3W97D 3MGPA 1P3IB 1P3GB 3MVDC 1M19D 5DNNB 3AZNC 5B1LB 2FJ7B 3AZMD 5B2JC 3LJAA 3B0DB
chains in the Genus database with same CATH superfamily
4WU8C 1A7WA 4QLCB 4E44A 5GT0B 3KWQA 5AV6D 4J8VD 3X1VB 3AN2B 4H9SC 1TAFA 5AV9C 1S32B 4KGCD 5BT1D 3AZLB 3WKJC 3MGPC 5AVBC 4J8WD 3NQUA 3X1TB 3EPLA 1KX5C 1ID3A 1KX3D 2PYOC 5AV8C 3LZ1D 4YM6C 3AZHC 3MGRB 2F8NB 5CP6D 3W99C 2CV5A 4H9SA 3WTPB 4Z2MG 3MGSC 2XD1A 3UTAC 4KUDD 3MVDB 4ZUXD 3AZMC 3X1UB 3AZJA 1P3LC 3IP4C 5E5AB 3AZLA 3AV2D 1EQZC 3O62D 3LZ0D 5F99C 5B24C 5AV8A 1ID3B 4KGCC 4YM6A 3AZHA 3AZFB 1P3AC 3AZGB 1P3FA 5B33D 3EG5B 4CAYB 5DNND 3X1TD 2JE5A 5F99D 4J8WB 2FJ7D 1U35C 1M18C 2G5HC 3AZEB 4H9PB 5GT3A 3UT9B 3C1CB 1N1JB 3TU4C 1HQ3D 5AV8B 4DRAA 4H9NB 4G91C 3VH5A 5B2IB 5GT3D 2HIOC 4R8PB 2BG1A 2YFWB 3REKD 3O62A 3LZ0A 3AZIB 4H9RA 1ZLAB 1P3AD 4Z5TC 5CPJD 4Z66B 4YS3D 4ZBJC 4XUJC 3A1IA 2IO5C 4H9PA 5B0YC 3TU4A 3AZFC 2NZDB 1KU5A 1P3KA 1WWIA 1P3OD 3H0MC 4H9NA 4J8XC 4AWLC 5B31A 3LELA 4XZQC 3A6ND 4QLCA 3W96D 5B32D 5B0ZD 3X1VA 1TAFB 4H9OB 3V9RA 1JFIA 3B6FA 5AY8C 1PZRA 1HQ3A 1BFMA 3A6NA 5CPIA 3LZ1B 5B0ZA 4M6BA 4JJNB 5CPJA 1P34B 5JRGA 5B40B 3A6NC 5KDMA 2NQBC 2W8SA 3RELB 1AOIA 3REIC 4ZUXB 2RVQC 3UTBA 4J8VB 2AROB 5CPJC 5DNMD 4NE6A 4J8VC 5CPJB 1P34A 4YS3B 3MNNC 5B32C 1KX3C 3MGQC 4J8WA 3AZED 4WU9C 2NQBA 3F6TA 2Y2QA 1M19B 4LD9B 2HIOB 1EQZB 3VH6W 3LJAD 3UTBC 5JRGD 3NQJA 3MGQD 3WAAB 3EPJA 4R8PA 5GSUC 4J8VA 3UT9D 3AV2A 1P34C 3KUYC 2JSSA 3WA9D 1TZYC 4Z2MH 4H9RB 1ZLAA 5B33C 3AZKB 3AZNA 2HUEC 4XZQA 5B2JA 3LJAC 3WA9A 5CPKC 4HGAC 3KWQC 4KUDA 4X23C 5DNMA 2UWXA 5B32B 5B1MB 4X23B 1KX4C 3VH6T 3AZKD 3AV2B 2NQBD 5F99B 3B0CW 5DNNC 2FJ7C 5E5AC 5AVBA 1ZLAC 4H9OA 3V9RB 1JFIB 3B6FB 4UUZA 3REJB 5GXQC 3WA9C 3KUYB 5CPIB 3LZ1A 2IO5B 5CP6B 5GSUB 2F8NH 5B0ZB 4Z66C 4NFTA 3H0LC 1T3UA 2JCHA 1KX4A 2FFFB 5FUGA 3UT9C 5F99A 3AZLD 1BH9A 5AV5B 3C1BB 1P3OB 4WZSB 5JRGB 4G91B 5B40A 2L5AA 2DF4C 3LZ1C 1KX3B 3W96B 3RELA 5B1LD 5B1MC 1S32A 3X1TA 1M18A 2AROA 2RVQD 1BH9B 1P3KD 1P3MD 4J8XB 5B24D 3AV1D 1H3OB 4CSRB 1TZYB 5AVCA 5BO0B 3AZJC 1P3LA 2F8NK 4LD9A 1KX4D 3W96A 2HIOA 5BS7C 5B24A 2PYOB 5B31D 4NE3A 5B33B 2Y2IA 5AV5C 3MGSB 3C1BC 3UTAB 4J8UA 3AV1C 1P3AA 2ZY2A 5B0YA 3AZHB 1M19C 3AZFA 3WKJA 1B6WA 3MNND 1U35A 5B31C 2J8PA 5GT0C 5BS7A 5B0YD 4XZQB 5B2JB 3WA9B 2LY8A 1KX5A 5B1MD 5B1LC 5GXQB 4KUDB 2PYOA 4J8XD 4J8UC 3AN2C 1N1JA 3B6FD 2NZDC 1P3AB 5B0YB 1EQZD 3X1SB 1M1AA 5BNVB 5B2IA 1W2EA 4UPKA 4X23D 5GT0A 3REJA 4HGAB 3KWQB 3P5JB 1F66C 4H9QA 3MGPD 3AV1B 3AZKC 5BNXB 5AV6B 4WNNA 3UTBD 5AV9D 2Y2PA 5AV5D 3KXBA 3C1BD 3TU4B 1P3PA 3KWQD 2Y2JA 2NZDA 3WKJD 1M1AC 3X1SA 4DRBA 4JJNC 3REJC 3B6FC 1BH8A 1F66A 2NZDD 4EO5B 3A1KA 3B0CT 3C1CD 1ID3D 3X1UA 3AFAD 3AZJB 4WNNB 1P3PC 1F66D 4WU9A 1P3PB 3REHC 4JJNA 3R45A 4Z5TA 1P3OC 3VH5W 3WTPC 2F8NG 4R8PC 4KHAA 4JJND 1AOIC 1P3FD 2Y2MA 3NQUB 3REID 5CP6C 4ZUXA 3KUYD 3AZND 2YFVA 2RIQA 5AY8A 3W98D 1P3BA 3EPHA 2CV5B 2YFWA 3WTPA 3REHD 1HTAA 4E45A 2BYKA 5B32G 5B0ZC 3O62B 3LZ0B 3MVDA 3FDDA 3AZGC 3W98A 5E5AA 1P3BD 2Y2HA 3W97B 3WTPD 4ZUXC 3AN2D 1P3KB 1P3MB 4Z66D 2CWEA 3AYWC 3AV2C 1P3MC 2G5IC 5BNVA 5B31B 1P3BB 3B6GC 2Y2NA 3RELD 1P3ID 4WV4B 2ZY3A 3WAAC 1F1EA 1HQ3B 5AV8D 2CV5C 3AZIC 2AROD 3KXBB 4QLCD 5AY8D 4DQYB 3MGPB 1P3IA 1P3MA 3MNNA 2HIOD 1B67A 3AZLC 3REKB 5DNNA 2FJ7A 5B1MA 1S32C 3B6GA 3TU4D 3AYWD 5AV6C 3X1TC 3AZEC 3EPKA 2AROC 3KFUG 3AZFD 1M18D 1P34D 5KDMB 4Z66A 2ZY5A 2Y2GA 2F8ND 1P3GC 4WU9B 1P3IC 5GSUA 3MNNB 4WU8B 5JA4B 3W96C 5AVCD 3REKA 1KX4B 4ZBJB 4XUJB 2F8NA 1U35D 4Z5TB 5FUGB 5GT3C 1ID3C 3B6GB 5B40C 5GSUD 4KGCB 4YS3A 5AV5A 3KXBD 3C1BA 4G92B 3MGSD 3UTAD 5CPKA 3W99A 4KHAB 4EO5C 4KUDC 5DNMC 1M19A 4XUJD 3A6NB 3AZMA 3W97C 1EQZA 3REKC 5JA4A 5B2ID 4WU8A 1TZYD 4YM6B 4XUJA 5B31G 5AY8B 1M18B 2XD5A 4KGCA 5AV9A 1KX5D 4CAYA 5AVCC 2BYKB 4J8XA 1WWSA 1P3FC 4LD9C 5BT1C 1P3PD 3W97A 1P3GD 2Y2KA 5GT3B 4R8PD 3X1VC 3UT9A 1AOIB 5C3IB 3C1CA 5B24B 3B0DC 5DNMB 3VH6A 3MGSA 2Y2OA 2Y2LA 3W99D 4J8UB 4AWLB 3UTAA 5CPKD 5GXQD 3REIB 3RELC 2NQBB 3O62C 3LZ0C 3B0BA 2CV5D 3C1CC 1KX5B 5JRGC 5G49B 3LELB 5B2JD 4XZQD 3REIA 3X1UD 3AFAA 1M1AB 4WU9D 4QLCC 3AZHD 3AZKA 1ULYA 1Z2CB 3AZNB 1KX3A 3AV1A 3MGQA 4J8WC 1HQ3C 4Z5TD 5G49A 5E5AD 3AFAC 3MVDD 3AFAB 3AZJD 2ZM5A 5B1LA 5CPKB 1S32D 3AL0C 4J8UD 3W99B 3LJAB 4UUZB 2BYMA 3MGRC 2HUEB 1P3KC 5BO0A 3X1UC 3AN2A 1P3LB 3KUYA 3AZMB 4YM6D 3LELC 5B33A 3REHA 5B2IC 5AVBD 3W98C 3UTBB 1P3LD 3H0RC 5AV9B 5CHLB 1P3OA 3R45B 3MGRA 5CPIC 1R4VA 2BYMB 4G92C 1U35B 3B6GD 3KXBC 1M1AD 2ZY4A 4NE5A 3X1SC 3REHB 3AZGD 3NQJB 3WAAA 5B40D 5CPID 1P3BC 2F2AC 3WTPE 2YFVB 3AZGA 1P3FB 4WJ3C 1H3OA 4CSRA 4WU8D 1TZYA 5AVCB 5C3IC 3X1SD 4H9QB 3LELD 3W98B 5BNXA 5AV6A 3AZEA 2VQRA 3AYWA 5B32A 2DQNC 3X1VD 4X23A 3MGRD 3REJD 3VH5T 3KSYA 1P3GA 1AOID 3AZID 2PYOD 5AVBB 4LD9D 3WKJB 1BH8B 1F66B 3AZIA 5CP6A 3MGQB 3WAAD 5GXQA 1Q9CA 4YS3C 5GT0D 3AYWB 1ZLAD 3W97D 3MGPA 1P3IB 1P3GB 3MVDC 1M19D 5DNNB 3AZNC 5B1LB 2FJ7B 3AZMD 5B2JC 3LJAA 3B0DB
chains in the Genus database with same CATH topology
4WU8C 1A7WA 4QLCB 4E44A 5GT0B 3KWQA 5AV6D 4J8VD 3X1VB 3AN2B 4H9SC 1TAFA 5AV9C 1S32B 4KGCD 5BT1D 3AZLB 3WKJC 3MGPC 5AVBC 4J8WD 3NQUA 3X1TB 3EPLA 1KX5C 1ID3A 1KX3D 2PYOC 5AV8C 3LZ1D 4YM6C 3AZHC 3MGRB 2F8NB 5CP6D 3W99C 2CV5A 4H9SA 3WTPB 4Z2MG 3MGSC 2XD1A 3UTAC 4KUDD 3MVDB 4ZUXD 3AZMC 3X1UB 3AZJA 1P3LC 3IP4C 5E5AB 3AZLA 3AV2D 1EQZC 3O62D 3LZ0D 5F99C 5B24C 5AV8A 1ID3B 4KGCC 4YM6A 3AZHA 3AZFB 1P3AC 3AZGB 1P3FA 5B33D 3EG5B 4CAYB 5DNND 3X1TD 2JE5A 5F99D 4J8WB 2FJ7D 1U35C 1M18C 2G5HC 3AZEB 4H9PB 5GT3A 3UT9B 3C1CB 1N1JB 3TU4C 1HQ3D 5AV8B 4DRAA 4H9NB 4G91C 3VH5A 5B2IB 5GT3D 2HIOC 4R8PB 2BG1A 2YFWB 3REKD 3O62A 3LZ0A 3AZIB 4H9RA 1ZLAB 1P3AD 4Z5TC 5CPJD 4Z66B 4YS3D 4ZBJC 4XUJC 3A1IA 2IO5C 4H9PA 5B0YC 3TU4A 3AZFC 2NZDB 1KU5A 1P3KA 1WWIA 1P3OD 3H0MC 4H9NA 4J8XC 4AWLC 5B31A 3LELA 4XZQC 3A6ND 4QLCA 3W96D 5B32D 5B0ZD 3X1VA 1TAFB 4H9OB 3V9RA 1JFIA 3B6FA 5AY8C 1PZRA 1HQ3A 1BFMA 3A6NA 5CPIA 3LZ1B 5B0ZA 4M6BA 4JJNB 5CPJA 1P34B 5JRGA 5B40B 3A6NC 5KDMA 2NQBC 2W8SA 3RELB 1AOIA 3REIC 4ZUXB 2RVQC 3UTBA 4J8VB 2AROB 5CPJC 5DNMD 4NE6A 4J8VC 5CPJB 1P34A 4YS3B 3MNNC 5B32C 1KX3C 3MGQC 4J8WA 3AZED 4WU9C 2NQBA 3F6TA 2Y2QA 1M19B 4LD9B 2HIOB 1EQZB 3VH6W 3LJAD 3UTBC 5JRGD 3NQJA 3MGQD 3WAAB 3EPJA 4R8PA 5GSUC 4J8VA 3UT9D 3AV2A 1P34C 3KUYC 2JSSA 3WA9D 1TZYC 4Z2MH 4H9RB 1ZLAA 5B33C 3AZKB 3AZNA 2HUEC 4XZQA 5B2JA 3LJAC 3WA9A 5CPKC 4HGAC 3KWQC 4KUDA 4X23C 5DNMA 2UWXA 5B32B 5B1MB 4X23B 1KX4C 3VH6T 3AZKD 3AV2B 2NQBD 5F99B 3B0CW 5DNNC 2FJ7C 5E5AC 5AVBA 1ZLAC 4H9OA 3V9RB 1JFIB 3B6FB 4UUZA 3REJB 5GXQC 3WA9C 3KUYB 5CPIB 3LZ1A 2IO5B 5CP6B 5GSUB 2F8NH 5B0ZB 4Z66C 4NFTA 3H0LC 1T3UA 2JCHA 1KX4A 2FFFB 5FUGA 3UT9C 5F99A 3AZLD 1BH9A 5AV5B 3C1BB 1P3OB 4WZSB 5JRGB 4G91B 5B40A 2L5AA 2DF4C 3LZ1C 1KX3B 3W96B 3RELA 5B1LD 5B1MC 1S32A 3X1TA 1M18A 2AROA 2RVQD 1BH9B 1P3KD 1P3MD 4J8XB 5B24D 3AV1D 1H3OB 4CSRB 1TZYB 5AVCA 5BO0B 3AZJC 1P3LA 2F8NK 4LD9A 1KX4D 3W96A 2HIOA 5BS7C 5B24A 2PYOB 5B31D 4NE3A 5B33B 2Y2IA 5AV5C 3MGSB 3C1BC 3UTAB 4J8UA 3AV1C 1P3AA 2ZY2A 5B0YA 3AZHB 1M19C 3AZFA 3WKJA 1B6WA 3MNND 1U35A 5B31C 2J8PA 5GT0C 5BS7A 5B0YD 4XZQB 5B2JB 3WA9B 2LY8A 1KX5A 5B1MD 5B1LC 5GXQB 4KUDB 2PYOA 4J8XD 4J8UC 3AN2C 1N1JA 3B6FD 2NZDC 1P3AB 5B0YB 1EQZD 3X1SB 1M1AA 5BNVB 5B2IA 1W2EA 4UPKA 4X23D 5GT0A 3REJA 4HGAB 3KWQB 3P5JB 1F66C 4H9QA 3MGPD 3AV1B 3AZKC 5BNXB 5AV6B 4WNNA 3UTBD 5AV9D 2Y2PA 5AV5D 3KXBA 3C1BD 3TU4B 1P3PA 3KWQD 2Y2JA 2NZDA 3WKJD 1M1AC 3X1SA 4DRBA 4JJNC 3REJC 3B6FC 1BH8A 1F66A 2NZDD 4EO5B 3A1KA 3B0CT 3C1CD 1ID3D 3X1UA 3AFAD 3AZJB 4WNNB 1P3PC 1F66D 4WU9A 1P3PB 3REHC 4JJNA 3R45A 4Z5TA 1P3OC 3VH5W 3WTPC 2F8NG 4R8PC 4KHAA 4JJND 1AOIC 1P3FD 2Y2MA 3NQUB 3REID 5CP6C 4ZUXA 3KUYD 3AZND 2YFVA 2RIQA 5AY8A 3W98D 1P3BA 3EPHA 2CV5B 2YFWA 3WTPA 3REHD 1HTAA 4E45A 2BYKA 5B32G 5B0ZC 3O62B 3LZ0B 3MVDA 3FDDA 3AZGC 3W98A 5E5AA 1P3BD 2Y2HA 3W97B 3WTPD 4ZUXC 3AN2D 1P3KB 1P3MB 4Z66D 2CWEA 3AYWC 3AV2C 1P3MC 2G5IC 5BNVA 5B31B 1P3BB 3B6GC 2Y2NA 3RELD 1P3ID 4WV4B 2ZY3A 3WAAC 1F1EA 1HQ3B 5AV8D 2CV5C 3AZIC 2AROD 3KXBB 4QLCD 5AY8D 4DQYB 3MGPB 1P3IA 1P3MA 3MNNA 2HIOD 1B67A 3AZLC 3REKB 5DNNA 2FJ7A 5B1MA 1S32C 3B6GA 3TU4D 3AYWD 5AV6C 3X1TC 3AZEC 3EPKA 2AROC 3KFUG 3AZFD 1M18D 1P34D 5KDMB 4Z66A 2ZY5A 2Y2GA 2F8ND 1P3GC 4WU9B 1P3IC 5GSUA 3MNNB 4WU8B 5JA4B 3W96C 5AVCD 3REKA 1KX4B 4ZBJB 4XUJB 2F8NA 1U35D 4Z5TB 5FUGB 5GT3C 1ID3C 3B6GB 5B40C 5GSUD 4KGCB 4YS3A 5AV5A 3KXBD 3C1BA 4G92B 3MGSD 3UTAD 5CPKA 3W99A 4KHAB 4EO5C 4KUDC 5DNMC 1M19A 4XUJD 3A6NB 3AZMA 3W97C 1EQZA 3REKC 5JA4A 5B2ID 4WU8A 1TZYD 4YM6B 4XUJA 5B31G 5AY8B 1M18B 2XD5A 4KGCA 5AV9A 1KX5D 4CAYA 5AVCC 2BYKB 4J8XA 1WWSA 1P3FC 4LD9C 5BT1C 1P3PD 3W97A 1P3GD 2Y2KA 5GT3B 4R8PD 3X1VC 3UT9A 1AOIB 5C3IB 3C1CA 5B24B 3B0DC 5DNMB 3VH6A 3MGSA 2Y2OA 2Y2LA 3W99D 4J8UB 4AWLB 3UTAA 5CPKD 5GXQD 3REIB 3RELC 2NQBB 3O62C 3LZ0C 3B0BA 2CV5D 3C1CC 1KX5B 5JRGC 5G49B 3LELB 5B2JD 4XZQD 3REIA 3X1UD 3AFAA 1M1AB 4WU9D 4QLCC 3AZHD 3AZKA 1ULYA 1Z2CB 3AZNB 1KX3A 3AV1A 3MGQA 4J8WC 1HQ3C 4Z5TD 5G49A 5E5AD 3AFAC 3MVDD 3AFAB 3AZJD 2ZM5A 5B1LA 5CPKB 1S32D 3AL0C 4J8UD 3W99B 3LJAB 4UUZB 2BYMA 3MGRC 2HUEB 1P3KC 5BO0A 3X1UC 3AN2A 1P3LB 3KUYA 3AZMB 4YM6D 3LELC 5B33A 3REHA 5B2IC 5AVBD 3W98C 3UTBB 1P3LD 3H0RC 5AV9B 5CHLB 1P3OA 3R45B 3MGRA 5CPIC 1R4VA 2BYMB 4G92C 1U35B 3B6GD 3KXBC 1M1AD 2ZY4A 4NE5A 3X1SC 3REHB 3AZGD 3NQJB 3WAAA 5B40D 5CPID 1P3BC 2F2AC 3WTPE 2YFVB 3AZGA 1P3FB 4WJ3C 1H3OA 4CSRA 4WU8D 1TZYA 5AVCB 5C3IC 3X1SD 4H9QB 3LELD 3W98B 5BNXA 5AV6A 3AZEA 2VQRA 3AYWA 5B32A 2DQNC 3X1VD 4X23A 3MGRD 3REJD 3VH5T 3KSYA 1P3GA 1AOID 3AZID 2PYOD 5AVBB 4LD9D 3WKJB 1BH8B 1F66B 3AZIA 5CP6A 3MGQB 3WAAD 5GXQA 1Q9CA 4YS3C 5GT0D 3AYWB 1ZLAD 3W97D 3MGPA 1P3IB 1P3GB 3MVDC 1M19D 5DNNB 3AZNC 5B1LB 2FJ7B 3AZMD 5B2JC 3LJAA 3B0DB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WU8 C;  1A7W A;  4QLC B;  4E44 A;  5GT0 B;  3KWQ A;  5AV6 D;  4J8V D;  3X1V B;  3AN2 B;  4H9S C;  1TAF A;  5AV9 C;  1S32 B;  4KGC D;  5BT1 D;  3AZL B;  3WKJ C;  3MGP C;  5AVB C;  4J8W D;  3NQU A;  3X1T B;  1KX5 C;  1ID3 A;  1KX3 D;  2PYO C;  5AV8 C;  3LZ1 D;  4YM6 C;  3AZH C;  3MGR B;  2F8N B;  5CP6 D;  3W99 C;  2CV5 A;  4H9S A;  3WTP B;  4Z2M G;  3MGS C;  3UTA C;  4KUD D;  3MVD B;  4ZUX D;  3AZM C;  3X1U B;  3AZJ A;  1P3L C;  3AZL A;  5E5A B;  1EQZ C;  3AV2 D;  3O62 D;  3LZ0 D;  5F99 C;  5B24 C;  5AV8 A;  1ID3 B;  4KGC C;  4YM6 A;  3AZH A;  3AZF B;  1P3A C;  3AZG B;  1P3F A;  5B33 D;  4CAY B;  5DNN D;  3X1T D;  4J8W B;  5F99 D;  2FJ7 D;  1U35 C;  1M18 C;  3AZE B;  4H9P B;  5GT3 A;  3UT9 B;  3C1C B;  1N1J B;  3TU4 C;  1HQ3 D;  5AV8 B;  4DRA A;  4H9N B;  4G91 C;  3VH5 A;  5B2I B;  5GT3 D;  2HIO C;  4R8P B;  2YFW B;  3REK D;  3O62 A;  3LZ0 A;  3AZI B;  4H9R A;  1ZLA B;  1P3A D;  4Z5T C;  5CPJ D;  4Z66 B;  4YS3 D;  4ZBJ C;  4XUJ C;  2IO5 C;  4H9P A;  5B0Y C;  3TU4 A;  3AZF C;  2NZD B;  1KU5 A;  1P3K A;  1WWI A;  1P3O D;  4H9N A;  4J8X C;  4AWL C;  5B31 A;  3LEL A;  4XZQ C;  3A6N D;  4QLC A;  3W96 D;  5B32 D;  5B0Z D;  3X1V A;  1TAF B;  4H9O B;  3V9R A;  1JFI A;  3B6F A;  5AY8 C;  1HQ3 A;  1BFM A;  3A6N A;  5CPI A;  3LZ1 B;  5B0Z A;  4M6B A;  4JJN B;  5CPJ A;  1P34 B;  5JRG A;  5B40 B;  3A6N C;  5KDM A;  2NQB C;  3REL B;  1AOI A;  3REI C;  4ZUX B;  2RVQ C;  3UTB A;  4J8V B;  2ARO B;  5CPJ C;  5DNM D;  4NE6 A;  4J8V C;  5CPJ B;  1P34 A;  4YS3 B;  3MNN C;  5B32 C;  1KX3 C;  3MGQ C;  4J8W A;  3AZE D;  4WU9 C;  2NQB A;  1M19 B;  4LD9 B;  2HIO B;  1EQZ B;  3VH6 W;  3LJA D;  3UTB C;  5JRG D;  3NQJ A;  3MGQ D;  3WAA B;  4J8V A;  4R8P A;  5GSU C;  3UT9 D;  3AV2 A;  1P34 C;  3KUY C;  2JSS A;  3WA9 D;  1TZY C;  4Z2M H;  4H9R B;  1ZLA A;  5B33 C;  3AZK B;  3AZN A;  2HUE C;  4XZQ A;  5B2J A;  3LJA C;  3WA9 A;  5CPK C;  4HGA C;  3KWQ C;  4KUD A;  4X23 C;  5DNM A;  5B32 B;  5B1M B;  4X23 B;  1KX4 C;  3VH6 T;  3AZK D;  3AV2 B;  2NQB D;  5F99 B;  3B0C W;  5DNN C;  2FJ7 C;  5E5A C;  5AVB A;  1ZLA C;  4H9O A;  3V9R B;  1JFI B;  3B6F B;  4UUZ A;  3REJ B;  5GXQ C;  3WA9 C;  3KUY B;  5CPI B;  3LZ1 A;  2IO5 B;  5CP6 B;  5GSU B;  2F8N H;  5B0Z B;  4Z66 C;  4NFT A;  1KX4 A;  5FUG A;  3UT9 C;  5F99 A;  3AZL D;  1BH9 A;  5AV5 B;  3C1B B;  1P3O B;  4WZS B;  5JRG B;  4G91 B;  5B40 A;  2L5A A;  3LZ1 C;  1KX3 B;  3W96 B;  3REL A;  5B1L D;  5B1M C;  1S32 A;  3X1T A;  1M18 A;  2ARO A;  2RVQ D;  1BH9 B;  1P3K D;  1P3M D;  4J8X B;  5B24 D;  3AV1 D;  1H3O B;  4CSR B;  1TZY B;  5AVC A;  5BO0 B;  3AZJ C;  1P3L A;  4LD9 A;  1KX4 D;  3W96 A;  2HIO A;  5BS7 C;  5B24 A;  2PYO B;  5B31 D;  4NE3 A;  5B33 B;  5AV5 C;  3MGS B;  3C1B C;  3UTA B;  4J8U A;  3AV1 C;  1P3A A;  5B0Y A;  3AZH B;  1M19 C;  3AZF A;  3WKJ A;  1B6W A;  3MNN D;  1U35 A;  5B31 C;  5GT0 C;  5BS7 A;  5B0Y D;  4XZQ B;  5B2J B;  3WA9 B;  2LY8 A;  1KX5 A;  5B1M D;  5B1L C;  5GXQ B;  4KUD B;  2PYO A;  4J8X D;  4J8U C;  3AN2 C;  1N1J A;  3B6F D;  2NZD C;  1P3A B;  5B0Y B;  1EQZ D;  3X1S B;  1M1A A;  5BNV B;  5B2I A;  4X23 D;  5GT0 A;  3REJ A;  4HGA B;  3KWQ B;  1F66 C;  4H9Q A;  3MGP D;  3AV1 B;  3AZK C;  5BNX B;  5AV6 B;  4WNN A;  3UTB D;  5AV9 D;  5AV5 D;  3KXB A;  3C1B D;  3TU4 B;  1P3P A;  2NZD A;  3KWQ D;  3WKJ D;  1M1A C;  3X1S A;  4DRB A;  4JJN C;  3REJ C;  3B6F C;  1BH8 A;  1F66 A;  2NZD D;  4EO5 B;  3C1C D;  3B0C T;  1ID3 D;  3X1U A;  3AFA D;  3AZJ B;  4WNN B;  1P3P C;  1F66 D;  4WU9 A;  1P3P B;  3REH C;  4JJN A;  3R45 A;  4Z5T A;  1P3O C;  3VH5 W;  3WTP C;  2F8N G;  4R8P C;  4KHA A;  4JJN D;  1AOI C;  1P3F D;  3NQU B;  3REI D;  5CP6 C;  4ZUX A;  3KUY D;  3AZN D;  2YFV A;  5AY8 A;  3W98 D;  1P3B A;  2CV5 B;  2YFW A;  3WTP A;  3REH D;  1HTA A;  4E45 A;  2BYK A;  5B32 G;  5B0Z C;  3O62 B;  3LZ0 B;  3MVD A;  3AZG C;  2F8N K;  3W98 A;  5E5A A;  1P3B D;  3W97 B;  3WTP D;  4ZUX C;  3AN2 D;  1P3K B;  1P3M B;  4Z66 D;  2CWE A;  3AYW C;  3AV2 C;  1P3M C;  5B31 B;  5BNV A;  1P3B B;  3B6G C;  3REL D;  1P3I D;  4WV4 B;  3WAA C;  1F1E A;  1HQ3 B;  5AV8 D;  2CV5 C;  3AZI C;  2ARO D;  3KXB B;  4QLC D;  5AY8 D;  3MGP B;  1P3I A;  1P3M A;  3MNN A;  2HIO D;  1B67 A;  3AZL C;  3REK B;  5DNN A;  2FJ7 A;  5B1M A;  1S32 C;  3B6G A;  3TU4 D;  3AYW D;  5AV6 C;  3X1T C;  3AZE C;  2ARO C;  3AZF D;  1M18 D;  1P34 D;  5KDM B;  4Z66 A;  2F8N D;  1P3G C;  4WU9 B;  1P3I C;  5GSU A;  3MNN B;  4WU8 B;  5JA4 B;  3W96 C;  5AVC D;  3REK A;  1KX4 B;  4ZBJ B;  4XUJ B;  2F8N A;  1U35 D;  4Z5T B;  5FUG B;  5GT3 C;  1ID3 C;  3B6G B;  5B40 C;  5GSU D;  4KGC B;  4YS3 A;  5AV5 A;  3KXB D;  3C1B A;  4G92 B;  3MGS D;  3UTA D;  5CPK A;  3W99 A;  4KHA B;  4EO5 C;  4KUD C;  5DNM C;  1M19 A;  4XUJ D;  3A6N B;  3AZM A;  3W97 C;  1EQZ A;  3REK C;  5JA4 A;  5B2I D;  4WU8 A;  1TZY D;  4YM6 B;  4XUJ A;  5B31 G;  5AY8 B;  1M18 B;  4KGC A;  5AV9 A;  1KX5 D;  4CAY A;  5AVC C;  2BYK B;  4J8X A;  1WWS A;  1P3F C;  4LD9 C;  5BT1 C;  1P3P D;  3W97 A;  1P3G D;  4R8P D;  5GT3 B;  3X1V C;  3UT9 A;  1AOI B;  5C3I B;  3C1C A;  5B24 B;  3B0D C;  5DNM B;  3VH6 A;  3MGS A;  3UTA A;  5CPK D;  3W99 D;  4J8U B;  4AWL B;  5GXQ D;  3REI B;  3REL C;  2NQB B;  3O62 C;  3LZ0 C;  3B0B A;  2CV5 D;  3C1C C;  1KX5 B;  5JRG C;  5G49 B;  3LEL B;  5B2J D;  4XZQ D;  3REI A;  3AFA A;  3X1U D;  1M1A B;  4WU9 D;  4QLC C;  3AZH D;  3AZK A;  1ULY A;  3AZN B;  1KX3 A;  3AV1 A;  3MGQ A;  4J8W C;  1HQ3 C;  4Z5T D;  5G49 A;  5E5A D;  3AFA C;  3MVD D;  3AFA B;  3AZJ D;  5B1L A;  5CPK B;  1S32 D;  4J8U D;  3W99 B;  3LJA B;  4UUZ B;  2BYM A;  3MGR C;  2HUE B;  1P3K C;  5BO0 A;  3X1U C;  3AN2 A;  1P3L B;  3KUY A;  3AZM B;  4YM6 D;  3LEL C;  5B33 A;  3REH A;  5B2I C;  5AVB D;  3W98 C;  3UTB B;  1P3L D;  5AV9 B;  5CHL B;  1P3O A;  3R45 B;  3MGR A;  5CPI C;  1R4V A;  2BYM B;  4G92 C;  1U35 B;  3B6G D;  3KXB C;  1M1A D;  4NE5 A;  3X1S C;  3REH B;  3AZG D;  3NQJ B;  3WAA A;  5B40 D;  5CPI D;  1P3B C;  3WTP E;  2YFV B;  3AZG A;  1P3F B;  1H3O A;  4CSR A;  4WU8 D;  1TZY A;  5AVC B;  5C3I C;  3X1S D;  4H9Q B;  3LEL D;  3W98 B;  5BNX A;  5AV6 A;  3AZE A;  3AYW A;  5B32 A;  3X1V D;  4X23 A;  3MGR D;  3REJ D;  3VH5 T;  3KSY A;  1P3G A;  1AOI D;  3AZI D;  2PYO D;  5AVB B;  4LD9 D;  3WKJ B;  1BH8 B;  1F66 B;  3AZI A;  5CP6 A;  3MGQ B;  3WAA D;  5GXQ A;  1Q9C A;  4YS3 C;  5GT0 D;  3AYW B;  1ZLA D;  3W97 D;  3MGP A;  1P3I B;  1P3G B;  3MVD C;  1M19 D;  5DNN B;  3AZN C;  5B1L B;  2FJ7 B;  3AZM D;  5B2J C;  3LJA A;  3B0D B; 
#chains in the Genus database with same CATH topology
 4WU8 C;  1A7W A;  4QLC B;  4E44 A;  5GT0 B;  3KWQ A;  5AV6 D;  4J8V D;  3X1V B;  3AN2 B;  4H9S C;  1TAF A;  5AV9 C;  1S32 B;  4KGC D;  5BT1 D;  3AZL B;  3WKJ C;  3MGP C;  5AVB C;  4J8W D;  3NQU A;  3X1T B;  3EPL A;  1KX5 C;  1ID3 A;  1KX3 D;  2PYO C;  5AV8 C;  3LZ1 D;  4YM6 C;  3AZH C;  3MGR B;  2F8N B;  5CP6 D;  3W99 C;  2CV5 A;  4H9S A;  3WTP B;  4Z2M G;  3MGS C;  2XD1 A;  3UTA C;  4KUD D;  3MVD B;  4ZUX D;  3AZM C;  3X1U B;  3AZJ A;  1P3L C;  3IP4 C;  5E5A B;  3AZL A;  3AV2 D;  1EQZ C;  3O62 D;  3LZ0 D;  5F99 C;  5B24 C;  5AV8 A;  1ID3 B;  4KGC C;  4YM6 A;  3AZH A;  3AZF B;  1P3A C;  3AZG B;  1P3F A;  5B33 D;  3EG5 B;  4CAY B;  5DNN D;  3X1T D;  2JE5 A;  5F99 D;  4J8W B;  2FJ7 D;  1U35 C;  1M18 C;  2G5H C;  3AZE B;  4H9P B;  5GT3 A;  3UT9 B;  3C1C B;  1N1J B;  3TU4 C;  1HQ3 D;  5AV8 B;  4DRA A;  4H9N B;  4G91 C;  3VH5 A;  5B2I B;  5GT3 D;  2HIO C;  4R8P B;  2BG1 A;  2YFW B;  3REK D;  3O62 A;  3LZ0 A;  3AZI B;  4H9R A;  1ZLA B;  1P3A D;  4Z5T C;  5CPJ D;  4Z66 B;  4YS3 D;  4ZBJ C;  4XUJ C;  3A1I A;  2IO5 C;  4H9P A;  5B0Y C;  3TU4 A;  3AZF C;  2NZD B;  1KU5 A;  1P3K A;  1WWI A;  1P3O D;  3H0M C;  4H9N A;  4J8X C;  4AWL C;  5B31 A;  3LEL A;  4XZQ C;  3A6N D;  4QLC A;  3W96 D;  5B32 D;  5B0Z D;  3X1V A;  1TAF B;  4H9O B;  3V9R A;  1JFI A;  3B6F A;  5AY8 C;  1PZR A;  1HQ3 A;  1BFM A;  3A6N A;  5CPI A;  3LZ1 B;  5B0Z A;  4M6B A;  4JJN B;  5CPJ A;  1P34 B;  5JRG A;  5B40 B;  3A6N C;  5KDM A;  2NQB C;  2W8S A;  3REL B;  1AOI A;  3REI C;  4ZUX B;  2RVQ C;  3UTB A;  4J8V B;  2ARO B;  5CPJ C;  5DNM D;  4NE6 A;  4J8V C;  5CPJ B;  1P34 A;  4YS3 B;  3MNN C;  5B32 C;  1KX3 C;  3MGQ C;  4J8W A;  3AZE D;  4WU9 C;  2NQB A;  3F6T A;  2Y2Q A;  1M19 B;  4LD9 B;  2HIO B;  1EQZ B;  3VH6 W;  3LJA D;  3UTB C;  5JRG D;  3NQJ A;  3MGQ D;  3WAA B;  3EPJ A;  4R8P A;  5GSU C;  4J8V A;  3UT9 D;  3AV2 A;  1P34 C;  3KUY C;  2JSS A;  3WA9 D;  1TZY C;  4Z2M H;  4H9R B;  1ZLA A;  5B33 C;  3AZK B;  3AZN A;  2HUE C;  4XZQ A;  5B2J A;  3LJA C;  3WA9 A;  5CPK C;  4HGA C;  3KWQ C;  4KUD A;  4X23 C;  5DNM A;  2UWX A;  5B32 B;  5B1M B;  4X23 B;  1KX4 C;  3VH6 T;  3AZK D;  3AV2 B;  2NQB D;  5F99 B;  3B0C W;  5DNN C;  2FJ7 C;  5E5A C;  5AVB A;  1ZLA C;  4H9O A;  3V9R B;  1JFI B;  3B6F B;  4UUZ A;  3REJ B;  5GXQ C;  3WA9 C;  3KUY B;  5CPI B;  3LZ1 A;  2IO5 B;  5CP6 B;  5GSU B;  2F8N H;  5B0Z B;  4Z66 C;  4NFT A;  3H0L C;  1T3U A;  2JCH A;  1KX4 A;  2FFF B;  5FUG A;  3UT9 C;  5F99 A;  3AZL D;  1BH9 A;  5AV5 B;  3C1B B;  1P3O B;  4WZS B;  5JRG B;  4G91 B;  5B40 A;  2L5A A;  2DF4 C;  3LZ1 C;  1KX3 B;  3W96 B;  3REL A;  5B1L D;  5B1M C;  1S32 A;  3X1T A;  1M18 A;  2ARO A;  2RVQ D;  1BH9 B;  1P3K D;  1P3M D;  4J8X B;  5B24 D;  3AV1 D;  1H3O B;  4CSR B;  1TZY B;  5AVC A;  5BO0 B;  3AZJ C;  1P3L A;  2F8N K;  4LD9 A;  1KX4 D;  3W96 A;  2HIO A;  5BS7 C;  5B24 A;  2PYO B;  5B31 D;  4NE3 A;  5B33 B;  2Y2I A;  5AV5 C;  3MGS B;  3C1B C;  3UTA B;  4J8U A;  3AV1 C;  1P3A A;  2ZY2 A;  5B0Y A;  3AZH B;  1M19 C;  3AZF A;  3WKJ A;  1B6W A;  3MNN D;  1U35 A;  5B31 C;  2J8P A;  5GT0 C;  5BS7 A;  5B0Y D;  4XZQ B;  5B2J B;  3WA9 B;  2LY8 A;  1KX5 A;  5B1M D;  5B1L C;  5GXQ B;  4KUD B;  2PYO A;  4J8X D;  4J8U C;  3AN2 C;  1N1J A;  3B6F D;  2NZD C;  1P3A B;  5B0Y B;  1EQZ D;  3X1S B;  1M1A A;  5BNV B;  5B2I A;  1W2E A;  4UPK A;  4X23 D;  5GT0 A;  3REJ A;  4HGA B;  3KWQ B;  3P5J B;  1F66 C;  4H9Q A;  3MGP D;  3AV1 B;  3AZK C;  5BNX B;  5AV6 B;  4WNN A;  3UTB D;  5AV9 D;  2Y2P A;  5AV5 D;  3KXB A;  3C1B D;  3TU4 B;  1P3P A;  3KWQ D;  2Y2J A;  2NZD A;  3WKJ D;  1M1A C;  3X1S A;  4DRB A;  4JJN C;  3REJ C;  3B6F C;  1BH8 A;  1F66 A;  2NZD D;  4EO5 B;  3A1K A;  3B0C T;  3C1C D;  1ID3 D;  3X1U A;  3AFA D;  3AZJ B;  4WNN B;  1P3P C;  1F66 D;  4WU9 A;  1P3P B;  3REH C;  4JJN A;  3R45 A;  4Z5T A;  1P3O C;  3VH5 W;  3WTP C;  2F8N G;  4R8P C;  4KHA A;  4JJN D;  1AOI C;  1P3F D;  2Y2M A;  3NQU B;  3REI D;  5CP6 C;  4ZUX A;  3KUY D;  3AZN D;  2YFV A;  2RIQ A;  5AY8 A;  3W98 D;  1P3B A;  3EPH A;  2CV5 B;  2YFW A;  3WTP A;  3REH D;  1HTA A;  4E45 A;  2BYK A;  5B32 G;  5B0Z C;  3O62 B;  3LZ0 B;  3MVD A;  3FDD A;  3AZG C;  3W98 A;  5E5A A;  1P3B D;  2Y2H A;  3W97 B;  3WTP D;  4ZUX C;  3AN2 D;  1P3K B;  1P3M B;  4Z66 D;  2CWE A;  3AYW C;  3AV2 C;  1P3M C;  2G5I C;  5BNV A;  5B31 B;  1P3B B;  3B6G C;  2Y2N A;  3REL D;  1P3I D;  4WV4 B;  2ZY3 A;  3WAA C;  1F1E A;  1HQ3 B;  5AV8 D;  2CV5 C;  3AZI C;  2ARO D;  3KXB B;  4QLC D;  5AY8 D;  4DQY B;  3MGP B;  1P3I A;  1P3M A;  3MNN A;  2HIO D;  1B67 A;  3AZL C;  3REK B;  5DNN A;  2FJ7 A;  5B1M A;  1S32 C;  3B6G A;  3TU4 D;  3AYW D;  5AV6 C;  3X1T C;  3AZE C;  3EPK A;  2ARO C;  3KFU G;  3AZF D;  1M18 D;  1P34 D;  5KDM B;  4Z66 A;  2ZY5 A;  2Y2G A;  2F8N D;  1P3G C;  4WU9 B;  1P3I C;  5GSU A;  3MNN B;  4WU8 B;  5JA4 B;  3W96 C;  5AVC D;  3REK A;  1KX4 B;  4ZBJ B;  4XUJ B;  2F8N A;  1U35 D;  4Z5T B;  5FUG B;  5GT3 C;  1ID3 C;  3B6G B;  5B40 C;  5GSU D;  4KGC B;  4YS3 A;  5AV5 A;  3KXB D;  3C1B A;  4G92 B;  3MGS D;  3UTA D;  5CPK A;  3W99 A;  4KHA B;  4EO5 C;  4KUD C;  5DNM C;  1M19 A;  4XUJ D;  3A6N B;  3AZM A;  3W97 C;  1EQZ A;  3REK C;  5JA4 A;  5B2I D;  4WU8 A;  1TZY D;  4YM6 B;  4XUJ A;  5B31 G;  5AY8 B;  1M18 B;  2XD5 A;  4KGC A;  5AV9 A;  1KX5 D;  4CAY A;  5AVC C;  2BYK B;  4J8X A;  1WWS A;  1P3F C;  4LD9 C;  5BT1 C;  1P3P D;  3W97 A;  1P3G D;  2Y2K A;  5GT3 B;  4R8P D;  3X1V C;  3UT9 A;  1AOI B;  5C3I B;  3C1C A;  5B24 B;  3B0D C;  5DNM B;  3VH6 A;  3MGS A;  2Y2O A;  2Y2L A;  3W99 D;  4J8U B;  4AWL B;  3UTA A;  5CPK D;  5GXQ D;  3REI B;  3REL C;  2NQB B;  3O62 C;  3LZ0 C;  3B0B A;  2CV5 D;  3C1C C;  1KX5 B;  5JRG C;  5G49 B;  3LEL B;  5B2J D;  4XZQ D;  3REI A;  3X1U D;  3AFA A;  1M1A B;  4WU9 D;  4QLC C;  3AZH D;  3AZK A;  1ULY A;  1Z2C B;  3AZN B;  1KX3 A;  3AV1 A;  3MGQ A;  4J8W C;  1HQ3 C;  4Z5T D;  5G49 A;  5E5A D;  3AFA C;  3MVD D;  3AFA B;  3AZJ D;  2ZM5 A;  5B1L A;  5CPK B;  1S32 D;  3AL0 C;  4J8U D;  3W99 B;  3LJA B;  4UUZ B;  2BYM A;  3MGR C;  2HUE B;  1P3K C;  5BO0 A;  3X1U C;  3AN2 A;  1P3L B;  3KUY A;  3AZM B;  4YM6 D;  3LEL C;  5B33 A;  3REH A;  5B2I C;  5AVB D;  3W98 C;  3UTB B;  1P3L D;  3H0R C;  5AV9 B;  5CHL B;  1P3O A;  3R45 B;  3MGR A;  5CPI C;  1R4V A;  2BYM B;  4G92 C;  1U35 B;  3B6G D;  3KXB C;  1M1A D;  2ZY4 A;  4NE5 A;  3X1S C;  3REH B;  3AZG D;  3NQJ B;  3WAA A;  5B40 D;  5CPI D;  1P3B C;  2F2A C;  3WTP E;  2YFV B;  3AZG A;  1P3F B;  4WJ3 C;  1H3O A;  4CSR A;  4WU8 D;  1TZY A;  5AVC B;  5C3I C;  3X1S D;  4H9Q B;  3LEL D;  3W98 B;  5BNX A;  5AV6 A;  3AZE A;  2VQR A;  3AYW A;  5B32 A;  2DQN C;  3X1V D;  4X23 A;  3MGR D;  3REJ D;  3VH5 T;  3KSY A;  1P3G A;  1AOI D;  3AZI D;  2PYO D;  5AVB B;  4LD9 D;  3WKJ B;  1BH8 B;  1F66 B;  3AZI A;  5CP6 A;  3MGQ B;  3WAA D;  5GXQ A;  1Q9C A;  4YS3 C;  5GT0 D;  3AYW B;  1ZLA D;  3W97 D;  3MGP A;  1P3I B;  1P3G B;  3MVD C;  1M19 D;  5DNN B;  3AZN C;  5B1L B;  2FJ7 B;  3AZM D;  5B2J C;  3LJA A;  3B0D B; 
#chains in the Genus database with same CATH homology
 4WU8 C;  1A7W A;  4QLC B;  4E44 A;  5GT0 B;  3KWQ A;  5AV6 D;  4J8V D;  3X1V B;  3AN2 B;  4H9S C;  1TAF A;  5AV9 C;  1S32 B;  4KGC D;  5BT1 D;  3AZL B;  3WKJ C;  3MGP C;  5AVB C;  4J8W D;  3NQU A;  3X1T B;  3EPL A;  1KX5 C;  1ID3 A;  1KX3 D;  2PYO C;  5AV8 C;  3LZ1 D;  4YM6 C;  3AZH C;  3MGR B;  2F8N B;  5CP6 D;  3W99 C;  2CV5 A;  4H9S A;  3WTP B;  4Z2M G;  3MGS C;  2XD1 A;  3UTA C;  4KUD D;  3MVD B;  4ZUX D;  3AZM C;  3X1U B;  3AZJ A;  1P3L C;  3IP4 C;  5E5A B;  3AZL A;  3AV2 D;  1EQZ C;  3O62 D;  3LZ0 D;  5F99 C;  5B24 C;  5AV8 A;  1ID3 B;  4KGC C;  4YM6 A;  3AZH A;  3AZF B;  1P3A C;  3AZG B;  1P3F A;  5B33 D;  3EG5 B;  4CAY B;  5DNN D;  3X1T D;  2JE5 A;  5F99 D;  4J8W B;  2FJ7 D;  1U35 C;  1M18 C;  2G5H C;  3AZE B;  4H9P B;  5GT3 A;  3UT9 B;  3C1C B;  1N1J B;  3TU4 C;  1HQ3 D;  5AV8 B;  4DRA A;  4H9N B;  4G91 C;  3VH5 A;  5B2I B;  5GT3 D;  2HIO C;  4R8P B;  2BG1 A;  2YFW B;  3REK D;  3O62 A;  3LZ0 A;  3AZI B;  4H9R A;  1ZLA B;  1P3A D;  4Z5T C;  5CPJ D;  4Z66 B;  4YS3 D;  4ZBJ C;  4XUJ C;  3A1I A;  2IO5 C;  4H9P A;  5B0Y C;  3TU4 A;  3AZF C;  2NZD B;  1KU5 A;  1P3K A;  1WWI A;  1P3O D;  3H0M C;  4H9N A;  4J8X C;  4AWL C;  5B31 A;  3LEL A;  4XZQ C;  3A6N D;  4QLC A;  3W96 D;  5B32 D;  5B0Z D;  3X1V A;  1TAF B;  4H9O B;  3V9R A;  1JFI A;  3B6F A;  5AY8 C;  1PZR A;  1HQ3 A;  1BFM A;  3A6N A;  5CPI A;  3LZ1 B;  5B0Z A;  4M6B A;  4JJN B;  5CPJ A;  1P34 B;  5JRG A;  5B40 B;  3A6N C;  5KDM A;  2NQB C;  2W8S A;  3REL B;  1AOI A;  3REI C;  4ZUX B;  2RVQ C;  3UTB A;  4J8V B;  2ARO B;  5CPJ C;  5DNM D;  4NE6 A;  4J8V C;  5CPJ B;  1P34 A;  4YS3 B;  3MNN C;  5B32 C;  1KX3 C;  3MGQ C;  4J8W A;  3AZE D;  4WU9 C;  2NQB A;  3F6T A;  2Y2Q A;  1M19 B;  4LD9 B;  2HIO B;  1EQZ B;  3VH6 W;  3LJA D;  3UTB C;  5JRG D;  3NQJ A;  3MGQ D;  3WAA B;  3EPJ A;  4R8P A;  5GSU C;  4J8V A;  3UT9 D;  3AV2 A;  1P34 C;  3KUY C;  2JSS A;  3WA9 D;  1TZY C;  4Z2M H;  4H9R B;  1ZLA A;  5B33 C;  3AZK B;  3AZN A;  2HUE C;  4XZQ A;  5B2J A;  3LJA C;  3WA9 A;  5CPK C;  4HGA C;  3KWQ C;  4KUD A;  4X23 C;  5DNM A;  2UWX A;  5B32 B;  5B1M B;  4X23 B;  1KX4 C;  3VH6 T;  3AZK D;  3AV2 B;  2NQB D;  5F99 B;  3B0C W;  5DNN C;  2FJ7 C;  5E5A C;  5AVB A;  1ZLA C;  4H9O A;  3V9R B;  1JFI B;  3B6F B;  4UUZ A;  3REJ B;  5GXQ C;  3WA9 C;  3KUY B;  5CPI B;  3LZ1 A;  2IO5 B;  5CP6 B;  5GSU B;  2F8N H;  5B0Z B;  4Z66 C;  4NFT A;  3H0L C;  1T3U A;  2JCH A;  1KX4 A;  2FFF B;  5FUG A;  3UT9 C;  5F99 A;  3AZL D;  1BH9 A;  5AV5 B;  3C1B B;  1P3O B;  4WZS B;  5JRG B;  4G91 B;  5B40 A;  2L5A A;  2DF4 C;  3LZ1 C;  1KX3 B;  3W96 B;  3REL A;  5B1L D;  5B1M C;  1S32 A;  3X1T A;  1M18 A;  2ARO A;  2RVQ D;  1BH9 B;  1P3K D;  1P3M D;  4J8X B;  5B24 D;  3AV1 D;  1H3O B;  4CSR B;  1TZY B;  5AVC A;  5BO0 B;  3AZJ C;  1P3L A;  2F8N K;  4LD9 A;  1KX4 D;  3W96 A;  2HIO A;  5BS7 C;  5B24 A;  2PYO B;  5B31 D;  4NE3 A;  5B33 B;  2Y2I A;  5AV5 C;  3MGS B;  3C1B C;  3UTA B;  4J8U A;  3AV1 C;  1P3A A;  2ZY2 A;  5B0Y A;  3AZH B;  1M19 C;  3AZF A;  3WKJ A;  1B6W A;  3MNN D;  1U35 A;  5B31 C;  2J8P A;  5GT0 C;  5BS7 A;  5B0Y D;  4XZQ B;  5B2J B;  3WA9 B;  2LY8 A;  1KX5 A;  5B1M D;  5B1L C;  5GXQ B;  4KUD B;  2PYO A;  4J8X D;  4J8U C;  3AN2 C;  1N1J A;  3B6F D;  2NZD C;  1P3A B;  5B0Y B;  1EQZ D;  3X1S B;  1M1A A;  5BNV B;  5B2I A;  1W2E A;  4UPK A;  4X23 D;  5GT0 A;  3REJ A;  4HGA B;  3KWQ B;  3P5J B;  1F66 C;  4H9Q A;  3MGP D;  3AV1 B;  3AZK C;  5BNX B;  5AV6 B;  4WNN A;  3UTB D;  5AV9 D;  2Y2P A;  5AV5 D;  3KXB A;  3C1B D;  3TU4 B;  1P3P A;  3KWQ D;  2Y2J A;  2NZD A;  3WKJ D;  1M1A C;  3X1S A;  4DRB A;  4JJN C;  3REJ C;  3B6F C;  1BH8 A;  1F66 A;  2NZD D;  4EO5 B;  3A1K A;  3B0C T;  3C1C D;  1ID3 D;  3X1U A;  3AFA D;  3AZJ B;  4WNN B;  1P3P C;  1F66 D;  4WU9 A;  1P3P B;  3REH C;  4JJN A;  3R45 A;  4Z5T A;  1P3O C;  3VH5 W;  3WTP C;  2F8N G;  4R8P C;  4KHA A;  4JJN D;  1AOI C;  1P3F D;  2Y2M A;  3NQU B;  3REI D;  5CP6 C;  4ZUX A;  3KUY D;  3AZN D;  2YFV A;  2RIQ A;  5AY8 A;  3W98 D;  1P3B A;  3EPH A;  2CV5 B;  2YFW A;  3WTP A;  3REH D;  1HTA A;  4E45 A;  2BYK A;  5B32 G;  5B0Z C;  3O62 B;  3LZ0 B;  3MVD A;  3FDD A;  3AZG C;  3W98 A;  5E5A A;  1P3B D;  2Y2H A;  3W97 B;  3WTP D;  4ZUX C;  3AN2 D;  1P3K B;  1P3M B;  4Z66 D;  2CWE A;  3AYW C;  3AV2 C;  1P3M C;  2G5I C;  5BNV A;  5B31 B;  1P3B B;  3B6G C;  2Y2N A;  3REL D;  1P3I D;  4WV4 B;  2ZY3 A;  3WAA C;  1F1E A;  1HQ3 B;  5AV8 D;  2CV5 C;  3AZI C;  2ARO D;  3KXB B;  4QLC D;  5AY8 D;  4DQY B;  3MGP B;  1P3I A;  1P3M A;  3MNN A;  2HIO D;  1B67 A;  3AZL C;  3REK B;  5DNN A;  2FJ7 A;  5B1M A;  1S32 C;  3B6G A;  3TU4 D;  3AYW D;  5AV6 C;  3X1T C;  3AZE C;  3EPK A;  2ARO C;  3KFU G;  3AZF D;  1M18 D;  1P34 D;  5KDM B;  4Z66 A;  2ZY5 A;  2Y2G A;  2F8N D;  1P3G C;  4WU9 B;  1P3I C;  5GSU A;  3MNN B;  4WU8 B;  5JA4 B;  3W96 C;  5AVC D;  3REK A;  1KX4 B;  4ZBJ B;  4XUJ B;  2F8N A;  1U35 D;  4Z5T B;  5FUG B;  5GT3 C;  1ID3 C;  3B6G B;  5B40 C;  5GSU D;  4KGC B;  4YS3 A;  5AV5 A;  3KXB D;  3C1B A;  4G92 B;  3MGS D;  3UTA D;  5CPK A;  3W99 A;  4KHA B;  4EO5 C;  4KUD C;  5DNM C;  1M19 A;  4XUJ D;  3A6N B;  3AZM A;  3W97 C;  1EQZ A;  3REK C;  5JA4 A;  5B2I D;  4WU8 A;  1TZY D;  4YM6 B;  4XUJ A;  5B31 G;  5AY8 B;  1M18 B;  2XD5 A;  4KGC A;  5AV9 A;  1KX5 D;  4CAY A;  5AVC C;  2BYK B;  4J8X A;  1WWS A;  1P3F C;  4LD9 C;  5BT1 C;  1P3P D;  3W97 A;  1P3G D;  2Y2K A;  5GT3 B;  4R8P D;  3X1V C;  3UT9 A;  1AOI B;  5C3I B;  3C1C A;  5B24 B;  3B0D C;  5DNM B;  3VH6 A;  3MGS A;  2Y2O A;  2Y2L A;  3W99 D;  4J8U B;  4AWL B;  3UTA A;  5CPK D;  5GXQ D;  3REI B;  3REL C;  2NQB B;  3O62 C;  3LZ0 C;  3B0B A;  2CV5 D;  3C1C C;  1KX5 B;  5JRG C;  5G49 B;  3LEL B;  5B2J D;  4XZQ D;  3REI A;  3X1U D;  3AFA A;  1M1A B;  4WU9 D;  4QLC C;  3AZH D;  3AZK A;  1ULY A;  1Z2C B;  3AZN B;  1KX3 A;  3AV1 A;  3MGQ A;  4J8W C;  1HQ3 C;  4Z5T D;  5G49 A;  5E5A D;  3AFA C;  3MVD D;  3AFA B;  3AZJ D;  2ZM5 A;  5B1L A;  5CPK B;  1S32 D;  3AL0 C;  4J8U D;  3W99 B;  3LJA B;  4UUZ B;  2BYM A;  3MGR C;  2HUE B;  1P3K C;  5BO0 A;  3X1U C;  3AN2 A;  1P3L B;  3KUY A;  3AZM B;  4YM6 D;  3LEL C;  5B33 A;  3REH A;  5B2I C;  5AVB D;  3W98 C;  3UTB B;  1P3L D;  3H0R C;  5AV9 B;  5CHL B;  1P3O A;  3R45 B;  3MGR A;  5CPI C;  1R4V A;  2BYM B;  4G92 C;  1U35 B;  3B6G D;  3KXB C;  1M1A D;  2ZY4 A;  4NE5 A;  3X1S C;  3REH B;  3AZG D;  3NQJ B;  3WAA A;  5B40 D;  5CPI D;  1P3B C;  2F2A C;  3WTP E;  2YFV B;  3AZG A;  1P3F B;  4WJ3 C;  1H3O A;  4CSR A;  4WU8 D;  1TZY A;  5AVC B;  5C3I C;  3X1S D;  4H9Q B;  3LEL D;  3W98 B;  5BNX A;  5AV6 A;  3AZE A;  2VQR A;  3AYW A;  5B32 A;  2DQN C;  3X1V D;  4X23 A;  3MGR D;  3REJ D;  3VH5 T;  3KSY A;  1P3G A;  1AOI D;  3AZI D;  2PYO D;  5AVB B;  4LD9 D;  3WKJ B;  1BH8 B;  1F66 B;  3AZI A;  5CP6 A;  3MGQ B;  3WAA D;  5GXQ A;  1Q9C A;  4YS3 C;  5GT0 D;  3AYW B;  1ZLA D;  3W97 D;  3MGP A;  1P3I B;  1P3G B;  3MVD C;  1M19 D;  5DNN B;  3AZN C;  5B1L B;  2FJ7 B;  3AZM D;  5B2J C;  3LJA A;  3B0D B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...