5FUGA

Crystal structure of a human yl1-h2a.z-h2b complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
89
structure length
89
Chain Sequence
SRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords HISTONE H2A.Z
publication title Molecular Basis and Specificity of H2A.Z-H2B Recognition and Deposition by the Histone Chaperone Yl1
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 89
sequence length 89
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2016-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5fugA00
2JSSA 3LELD 3AZLB 1KX5D 3C1BD 1ID3A 5BNVB 5AY8D 3W97B 4EO5B 3MGPB 5AVCA 3W98A 1M19A 1EQZA 5GT3C 3B6FD 4Z5TD 2NQBD 1KX4A 5CPKA 1P3BA 3A6NC 2CWEA 4KUDA 5B2IC 5B2JB 3X1UC 4Z66B 1P3FD 1TZYC 2IO5B 3AFAB 1KX3B 5B33C 1WWIA 3AZGD 3AYWD 3X1VB 3MGRC 5JRGC 4LD9A 3AV2C 3AZFC 5GXQD 5F99D 3X1SD 4ZUXD 3B0DC 3MGQA 4J8XC 3UTBC 3AZNA 3A6NA 5BS7A 2PYOB 5B0YC 4QLCA 1ZLAB 4KGCB 5AV9A 3LZ1C 4YM6D 3REHB 1M18B 4AWLB 2HIOB 1U35A 2CV5B 4J8UB 3W99B 1P34C 5B1LB 1P3KA 5B0ZC 4NE3A 5DNND 3AZLA 4XZQC 5B31D 1S32B 5BNVA 3UTBA 3W97A 1P3OB 1TAFA 3VH5T 3LELC 3MGPA 4NE6A 3C1BC 5AY8C 5B0YA 3RELD 3MVDB 3C1CB 3MGSD 4WU8B 1P34A 5B24D 3B6FC 1N1JA 5B2JA 4WV4B 4Z5TC 2NQBC 4XZQA 3AFAA 4HGAC 2F8ND 1P3FC 4WU9B 3LELA 4M6BA 4KHAB 3X1VA 2CV5C 5GSUD 5AY8A 3WKJB 4ZBJB 4JJNB 3AZGC 3AYWC 3B6GD 5B40C 4WZSB 3AZMB 3KUYD 5GXQC 5F99C 3X1SC 4ZUXC 5B32D 2PYOA 1ZLAA 4R8PD 4KGCA 1P3GB 4J8WD 3REHA 3AZKB 1P3FA 2HIOA 1AOIB 1P3MD 2CV5A 1P3IB 3W99A 4YM6C 5CPID 3KWQD 3AZGA 1ID3B 5DNMB 5CPJD 2BYMB 5B40A 4XUJD 5AVBC 5DNNC 3REJD 1M19B 1P3PD 1P3LD 3AZED 3C1CA 1F66D 3NQJB 3AN2D 5CPKB 3RELC 4WU8A 4KUDB 4YM6A 3MNND 2YFWB 3MGSC 2F8NH 5AVBA 5B24C 4G92C 4KHAA 1HTAA 3WKJA 4UUZB 5GT3B 4JJNA 5GSUC 3AZMA 3A6NB 5B2IB 3X1UB 4H9SA 3B6GC 1TZYB 2YFVB 4DRAA 3UT9D 5B33B 1P3AD 4DRBA 5B32C 3AZKA 1A7WA 1AOIA 3O62D 3AV1D 4R8PC 3MGRB 5JRGB 1P3IA 3AV2B 4J8WC 3AZFB 1P3MC 3B0DB 5DNMA 4J8XB 3UTBB 3REID 2BYMA 4X23D 5CPIC 1TAFB 3KWQC 2F8NG 3WA9D 3B6GA 2AROD 5E5AD 5CPJC 5B0YB 2HUEC 4XUJC 5BO0B 3LZ1B 3NQJA 5B32A 5AV6C 1P3PC 3W96D 1P3LC 3AZEC 3AZHB 1P34B 1F66C 1N1JB 5B0ZB 1ULYA 2YFWA 4XZQB 5B32G 4YS3D 3LZ0D 3AZJD 3MNNC 5C3IB 3LELB 2NZDD 3C1BB 5CPJA 5AY8B 4UUZA 1HQ3D 5GT3A 2LY8A 5AV6A 5B2IA 1M1AD 3B6FB 3X1UA 4Z5TB 2NQBB 1TZYA 4HGAB 2YFVA 1P3FB 1M18D 5B33A 3X1TD 4J8UD 3MGRA 5JRGA 3UT9C 3AZHC 3AV2A 1P3AC 3AZFA 3AYWB 3AZGB 3O62C 3AV1C 4E44A 5B40B 4J8XA 1KU5A 5KDMB 3X1SB 5GXQB 5C3IC 5F99B 1KX5C 4ZUXB 3REIC 5GT0D 4X23C 3MVDD 5BO0A 3LZ1A 3WA9C 2AROC 5E5AC 4CSRB 4YM6B 3AZHA 3UT9A 4J8VD 1P3AA 2FJ7D 5B0ZA 3TU4D 3W96C 3UTAD 5CP6D 4Z2MH 5AVBB 3REKD 5DNNB 3LJAD 4WU9D 1KX5A 4YS3C 3LZ0C 3C1BA 3AZJC 1B6WA 4X23A 2NZDC 3KSYA 3RELB 3KXBD 1HQ3C 3B6FA 3MGSB 4Z5TA 2NQBA 2RVQD 1BH8B 3W96A 3WTPD 5B1MD 1P3GD 5B24B 1M1AC 4G92B 3LZ0A 5AV8D 2F8NB 3AYWA 5GSUB 3X1TC 5AVCD 5KDMA 3X1SA 5F99A 5GXQA 3B6GB 3W98D 5B31C 4ZUXA 1M19D 3WAAD 1EQZD 1H3OB 5B32B 1JFIB 4CSRA 1KX4D 5GT0C 4R8PB 1P3BD 4J8WB 3AZID 1P3MB 3X1TA 5CPIB 3KWQB 4J8VC 2FJ7C 3TU4C 5DNNA 5B31A 5CPJB 3UTAC 5CP6C 2HUEB 4XUJB 4LD9D 3REKC 3B0BA 3R45B 5AV5D 5FUGA 5AV6B 1P3PB 5B31G 3MGQD 3RELA 1P3LB 3AZND 3AZEB 1F66B 1WWSA 3MGSA 2BYKB 4QLCD 5BT1D 3KXBC 1BH8A 5AV9D 3KUYC 4J8VA 5B24A 3MNNB 3VH6W 1U35D 2RVQC 3UTAA 3WTPC 5B1MC 2F8NA 1P3KD 3AZLD 5GSUA 5AV8C 3W97D 3MGPD 5B0YD 3KXBA 4H9NB 5AVCC 3KUYA 4H9PB 3W98C 3NQUA 3REJC 1H3OA 1F1EA 3WAAC 1EQZC 1JFIA 4R8PA 3UT9B 3VH6A 4J8WA 3AN2C 1P34D 1P3AB 5B2JD 4Z66D 3O62B 3AV1B 1P3MA 1KX4C 4XZQD 1P3BC 3AFAD 3VH5A 3AZIC 1BH9B 1KX3D 4H9RB 3KWQA 5CPIA 1KX5B 3X1VD 3REIB 4X23B 2L5AA 3V9RA 4XUJA 3WA9B 3R45A 3REJA 2AROB 5E5AB 1P3PA 3WAAA 4LD9C 1P3LA 3AZEA 5AV5C 1F66A 3AN2A 2F8NK 3MGQC 2PYOD 4WNNB 3W96B 3AZNC 2BYKA 1ZLAD 4KGCD 5BS7C 3AZIA 3REHD 3MNNA 2HIOD 4YS3B 3LZ0B 4QLCC 5BT1C 3AZJB 2CV5D 5AV9C 3W99D 5B1LD 2NZDB 1U35C 4G91C 4H9OA 1Q9CA 5B40D 1S32D 1P3KC 1P3OD 1HQ3B 5AV5A 3AZLC 3W97C 4H9QB 4EO5C 4H9NA 3MGPC 3C1CD 1M1AB 4H9PA 4CAYA 4WU8D 3WTPE 3B0CW 3O62A 3AV1A 3X1TB 5AVBD 1BH9A 5B2JC 3VH6T 4H9RA 4Z66C 5B31B 2IO5C 3AFAC 3REIA 3WKJD 1KX3C 4JJND 5FUGB 3WA9A 2AROA 5E5AA 3X1VC 5GT0B 5BNXB 3AZMD 4WNNA 4J8VB 2FJ7B 3TU4B 4Z66A 3AZKD 1AOID 2PYOC 5JA4B 4YS3A 3UTAB 1ZLAC 5CP6B 3AZJA 4KGCC 1P3ID 3REKB 1KX3A 3REHC 1M18C 3LJAB 4AWLC 2HIOC 2NZDA 1ID3D 4J8UC 5G49B 5DNMD 5CHLB 3W99C 1BFMA 5B1LC 1HQ3A 4Z2MG 3KXBB 1S32C 1P3OC 4H9QA 3KUYB 3NQUB 1M1AA 5CPKD 3WTPB 5B1MB 3MVDC 3C1CC 4KUDD 1M18A 4WU8C 4J8UA 5AV8B 4NE5A 5B1LA 3V9RB 1S32A 1P3OA 5AVCB 3W98B 3LJAC 5GT3D 3REJB 4WU9C 3WAAB 5AV6D 1EQZB 5GT0A 4ZBJC 5BNXA 3MVDA 3WKJC 4JJNC 3A6ND 3AN2B 5B2ID 1B67A 3X1UD 4E45A 1KX4B 1TZYD 1P3BB 3AZMC 3AZIB 4H9SC 5B33D 2FJ7A 3TU4A 5JA4A 5CP6A 3MGRD 5JRGD 3B0CT 3AV2D 3REKA 1P3GC 3LJAA 4NFTA 3AZKC 3AZFD 4WU9A 1AOIC 3VH5W 4H9OB 1P3IC 4LD9B 5G49A 4J8XD 3UTBD 5AV5B 1ID3C 3MGQB 5DNMC 3AZNB 3LZ1D 1M19C 4CAYB 4QLCB 5AV9B 3WTPA 5B1MA 3AZHD 1P3GA 5B0ZD 1U35B 4G91B 5CPKC 1R4VA 4KUDC 5AV8A 1P3KB
chains in the Genus database with same CATH superfamily
2JSSA 3LELD 3AZLB 1KX5D 3C1BD 1ID3A 2Y2GA 5BNVB 5AY8D 3W97B 4EO5B 3MGPB 5AVCA 3W98A 1M19A 1EQZA 5GT3C 3B6FD 4Z5TD 2NQBD 1KX4A 3A1KA 5CPKA 1P3BA 2ZY4A 3A6NC 2CWEA 4KUDA 5B2IC 5B2JB 3X1UC 4Z66B 1P3FD 1TZYC 2Y2MA 2IO5B 3AFAB 3EPLA 1KX3B 5B33C 1WWIA 3AZGD 3AYWD 3X1VB 3MGRC 5JRGC 4LD9A 3AV2C 2ZY3A 3AZFC 5GXQD 5F99D 3X1SD 4ZUXD 3B0DC 3MGQA 4J8XC 3UTBC 3AZNA 3A6NA 5BS7A 2PYOB 5B0YC 4QLCA 1ZLAB 4KGCB 5AV9A 3LZ1C 4YM6D 3REHB 1M18B 4AWLB 2HIOB 1U35A 2CV5B 4J8UB 3W99B 4UPKA 1P34C 5B1LB 1P3KA 5B0ZC 4NE3A 5DNND 3AZLA 4XZQC 5B31D 1S32B 5BNVA 3UTBA 2Y2PA 3W97A 1P3OB 1TAFA 3VH5T 3FDDA 3LELC 3MGPA 4NE6A 3C1BC 5AY8C 5B0YA 3RELD 3MVDB 3C1CB 2W8SA 3MGSD 4WU8B 1P34A 5B24D 3B6FC 1N1JA 5B2JA 4WV4B 4Z5TC 2NQBC 4XZQA 3AFAA 4HGAC 2F8ND 2Y2IA 1P3FC 4WU9B 3LELA 4M6BA 4KHAB 3X1VA 2CV5C 5GSUD 5AY8A 3WKJB 4ZBJB 3AL0C 4JJNB 3AZGC 3AYWC 3B6GD 5B40C 4WZSB 3AZMB 3IP4C 3KUYD 5GXQC 5F99C 3X1SC 4ZUXC 5B32D 2PYOA 1ZLAA 4R8PD 4KGCA 1P3GB 4J8WD 3REHA 2RIQA 3AZKB 1P3FA 2HIOA 1AOIB 1P3MD 2CV5A 1P3IB 3W99A 4YM6C 5CPID 3KWQD 3AZGA 1ID3B 5DNMB 5CPJD 2BYMB 5B40A 3EPJA 4XUJD 5AVBC 5DNNC 3REJD 1M19B 1P3PD 1P3LD 3AZED 3C1CA 1F66D 3NQJB 3AN2D 5CPKB 3RELC 4WU8A 4KUDB 4YM6A 3MNND 2YFWB 3MGSC 2F8NH 5AVBA 5B24C 4G92C 4KHAA 1HTAA 3WKJA 4UUZB 5GT3B 4JJNA 5GSUC 3AZMA 3A6NB 5B2IB 3X1UB 4H9SA 3B6GC 1TZYB 2YFVB 4DRAA 3UT9D 5B33B 1P3AD 4DRBA 5B32C 3AZKA 1A7WA 1AOIA 3O62D 3AV1D 4R8PC 3MGRB 5JRGB 1P3IA 3AV2B 4J8WC 3AZFB 2FFFB 1P3MC 3B0DB 5DNMA 4J8XB 3UTBB 3REID 2BYMA 4X23D 5CPIC 1TAFB 3KWQC 2F8NG 3WA9D 1W2EA 2ZY5A 3B6GA 2AROD 5E5AD 5CPJC 5B0YB 2HUEC 4XUJC 5BO0B 3LZ1B 2Y2HA 3NQJA 5B32A 5AV6C 1P3PC 3W96D 1P3LC 3AZEC 3AZHB 1P34B 1F66C 1N1JB 5B0ZB 1ULYA 2YFWA 4XZQB 5B32G 4YS3D 3LZ0D 3AZJD 2G5IC 3MNNC 5C3IB 3LELB 2NZDD 3C1BB 5CPJA 5AY8B 4UUZA 1HQ3D 5GT3A 2LY8A 5AV6A 5B2IA 1M1AD 3B6FB 3X1UA 4Z5TB 2NQBB 1TZYA 4HGAB 2YFVA 1P3FB 1M18D 5B33A 3X1TD 4J8UD 3MGRA 5JRGA 3UT9C 3AZHC 3AV2A 1P3AC 3AZFA 3AYWB 3AZGB 3O62C 3AV1C 4E44A 5B40B 4J8XA 1KU5A 5KDMB 5GXQB 5C3IC 5F99B 3X1SB 1KX5C 2XD1A 4ZUXB 3REIC 5GT0D 4X23C 3MVDD 5BO0A 3LZ1A 3WA9C 2AROC 5E5AC 4CSRB 4YM6B 3AZHA 3UT9A 4J8VD 1P3AA 2FJ7D 5B0ZA 3TU4D 3EPHA 3W96C 3UTAD 5CP6D 4Z2MH 5AVBB 3REKD 5DNNB 3LJAD 4WU9D 1KX5A 4YS3C 3LZ0C 3C1BA 3H0RC 3AZJC 1B6WA 4X23A 2NZDC 3KSYA 2JCHA 3RELB 3KXBD 1HQ3C 3B6FA 3MGSB 4Z5TA 2NQBA 2RVQD 1BH8B 3W96A 3WTPD 5B1MD 1P3GD 2Y2QA 5B24B 1M1AC 4G92B 3LZ0A 5AV8D 2F8NB 3AYWA 5GSUB 3X1TC 3KFUG 5AVCD 5KDMA 3X1SA 5F99A 5GXQA 3B6GB 3W98D 2Y2JA 5B31C 4ZUXA 1M19D 3WAAD 1EQZD 1H3OB 5B32B 1JFIB 4CSRA 1KX4D 5GT0C 4R8PB 1P3BD 4J8WB 3AZID 1P3MB 3X1TA 2UWXA 5CPIB 3KWQB 4J8VC 2FJ7C 3TU4C 5DNNA 5B31A 5CPJB 3UTAC 5CP6C 2HUEB 4XUJB 4LD9D 3REKC 3B0BA 3R45B 5AV5D 5FUGA 5AV6B 1P3PB 5B31G 3MGQD 3RELA 1P3LB 3AZND 3AZEB 1F66B 1WWSA 1Z2CB 3MGSA 2BYKB 4QLCD 5BT1D 3KXBC 1BH8A 5AV9D 3KUYC 4J8VA 5B24A 3MNNB 3VH6W 1U35D 2RVQC 3UTAA 3WTPC 5B1MC 2F8NA 1P3KD 2F2AC 2VQRA 3AZLD 5GSUA 3P5JB 5AV8C 3W97D 3MGPD 5B0YD 3KXBA 3H0LC 2Y2LA 4H9NB 5AVCC 3KUYA 4H9PB 3W98C 3NQUA 3REJC 1H3OA 1F1EA 3WAAC 1EQZC 1JFIA 2J8PA 4R8PA 3UT9B 3VH6A 4J8WA 3AN2C 1P34D 1P3AB 5B2JD 2JE5A 4Z66D 3O62B 3AV1B 1P3MA 1KX4C 4XZQD 1P3BC 3AFAD 3VH5A 3AZIC 1BH9B 1KX3D 4H9RB 3KWQA 5CPIA 1KX5B 3X1VD 3REIB 4X23B 2L5AA 3V9RA 4XUJA 3WA9B 3R45A 3REJA 2AROB 5E5AB 1P3PA 3WAAA 4LD9C 1P3LA 3AZEA 5AV5C 1F66A 3AN2A 2F8NK 2DQNC 3MGQC 4WNNB 2PYOD 3W96B 3AZNC 2BYKA 1ZLAD 4KGCD 5BS7C 3AZIA 3REHD 3MNNA 2HIOD 4YS3B 3LZ0B 4QLCC 5BT1C 3AZJB 2CV5D 5AV9C 3W99D 2G5HC 5B1LD 3EG5B 2NZDB 1U35C 4G91C 4H9OA 1Q9CA 5B40D 1S32D 1P3KC 1P3OD 1HQ3B 5AV5A 3AZLC 3W97C 4H9QB 4EO5C 4H9NA 3MGPC 3C1CD 1M1AB 4H9PA 3EPKA 4CAYA 4WU8D 3WTPE 3B0CW 3O62A 3AV1A 3X1TB 5AVBD 1BH9A 5B2JC 3VH6T 4H9RA 4Z66C 5B31B 2IO5C 3AFAC 3REIA 3WKJD 1KX3C 4JJND 5FUGB 3WA9A 2AROA 5E5AA 3X1VC 1T3UA 5GT0B 5BNXB 3AZMD 1PZRA 4WNNA 4J8VB 2FJ7B 3TU4B 4Z66A 3AZKD 1AOID 2PYOC 5JA4B 4YS3A 3UTAB 1ZLAC 5CP6B 3AZJA 2ZM5A 1P3ID 4KGCC 3REKB 1KX3A 3REHC 1M18C 3LJAB 4AWLC 2HIOC 2NZDA 1ID3D 4J8UC 5G49B 5DNMD 5CHLB 3W99C 1BFMA 5B1LC 1HQ3A 4Z2MG 3KXBB 1S32C 1P3OC 4H9QA 3KUYB 3NQUB 1M1AA 5CPKD 3WTPB 5B1MB 3MVDC 3C1CC 4KUDD 2DF4C 1M18A 4WJ3C 4WU8C 4J8UA 5AV8B 4NE5A 5B1LA 3V9RB 1S32A 1P3OA 5AVCB 3W98B 3LJAC 5GT3D 3REJB 4WU9C 4DQYB 3WAAB 5AV6D 1EQZB 5GT0A 4ZBJC 5BNXA 3MVDA 3WKJC 4JJNC 3A6ND 3AN2B 5B2ID 1B67A 3X1UD 4E45A 1KX4B 1TZYD 1P3BB 3AZMC 3AZIB 2Y2KA 4H9SC 5B33D 2FJ7A 3TU4A 2XD5A 5JA4A 5CP6A 3MGRD 5JRGD 3B0CT 3AV2D 3REKA 1P3GC 3LJAA 4NFTA 3AZKC 3AZFD 4WU9A 1AOIC 3VH5W 4H9OB 2BG1A 1P3IC 5G49A 4J8XD 3UTBD 4LD9B 5AV5B 1ID3C 3MGQB 5DNMC 3AZNB 2Y2OA 3F6TA 3LZ1D 1M19C 4CAYB 4QLCB 5AV9B 3WTPA 2Y2NA 5B1MA 3AZHD 1P3GA 3H0MC 5B0ZD 1U35B 2ZY2A 3A1IA 4G91B 5CPKC 1R4VA 4KUDC 5AV8A 1P3KB
chains in the Genus database with same CATH topology
2JSSA 3LELD 3AZLB 1KX5D 3C1BD 1ID3A 2Y2GA 5BNVB 5AY8D 3W97B 4EO5B 3MGPB 5AVCA 3W98A 1M19A 1EQZA 5GT3C 3B6FD 4Z5TD 2NQBD 1KX4A 3A1KA 5CPKA 1P3BA 2ZY4A 3A6NC 2CWEA 4KUDA 5B2IC 5B2JB 3X1UC 4Z66B 1P3FD 1TZYC 2Y2MA 2IO5B 3AFAB 3EPLA 1KX3B 5B33C 1WWIA 3AZGD 3AYWD 3X1VB 3MGRC 5JRGC 4LD9A 3AV2C 2ZY3A 3AZFC 5GXQD 5F99D 3X1SD 4ZUXD 3B0DC 3MGQA 4J8XC 3UTBC 3AZNA 3A6NA 5BS7A 2PYOB 5B0YC 4QLCA 1ZLAB 4KGCB 5AV9A 3LZ1C 4YM6D 3REHB 1M18B 4AWLB 2HIOB 1U35A 2CV5B 4J8UB 3W99B 4UPKA 1P34C 5B1LB 1P3KA 5B0ZC 4NE3A 5DNND 3AZLA 4XZQC 5B31D 1S32B 5BNVA 3UTBA 2Y2PA 3W97A 1P3OB 1TAFA 3VH5T 3FDDA 3LELC 3MGPA 4NE6A 3C1BC 5AY8C 5B0YA 3RELD 3MVDB 3C1CB 2W8SA 3MGSD 4WU8B 1P34A 5B24D 3B6FC 1N1JA 5B2JA 4WV4B 4Z5TC 2NQBC 4XZQA 3AFAA 4HGAC 2F8ND 2Y2IA 1P3FC 4WU9B 3LELA 4M6BA 4KHAB 3X1VA 2CV5C 5GSUD 5AY8A 3WKJB 4ZBJB 3AL0C 4JJNB 3AZGC 3AYWC 3B6GD 5B40C 4WZSB 3AZMB 3IP4C 3KUYD 5GXQC 5F99C 3X1SC 4ZUXC 5B32D 2PYOA 1ZLAA 4R8PD 4KGCA 1P3GB 4J8WD 3REHA 2RIQA 3AZKB 1P3FA 2HIOA 1AOIB 1P3MD 2CV5A 1P3IB 3W99A 4YM6C 5CPID 3KWQD 3AZGA 1ID3B 5DNMB 5CPJD 2BYMB 5B40A 3EPJA 4XUJD 5AVBC 5DNNC 3REJD 1M19B 1P3PD 1P3LD 3AZED 3C1CA 1F66D 3NQJB 3AN2D 5CPKB 3RELC 4WU8A 4KUDB 4YM6A 3MNND 2YFWB 3MGSC 2F8NH 5AVBA 5B24C 4G92C 4KHAA 1HTAA 3WKJA 4UUZB 5GT3B 4JJNA 5GSUC 3AZMA 3A6NB 5B2IB 3X1UB 4H9SA 3B6GC 1TZYB 2YFVB 4DRAA 3UT9D 5B33B 1P3AD 4DRBA 5B32C 3AZKA 1A7WA 1AOIA 3O62D 3AV1D 4R8PC 3MGRB 5JRGB 1P3IA 3AV2B 4J8WC 3AZFB 2FFFB 1P3MC 3B0DB 5DNMA 4J8XB 3UTBB 3REID 2BYMA 4X23D 5CPIC 1TAFB 3KWQC 2F8NG 3WA9D 1W2EA 2ZY5A 3B6GA 2AROD 5E5AD 5CPJC 5B0YB 2HUEC 4XUJC 5BO0B 3LZ1B 2Y2HA 3NQJA 5B32A 5AV6C 1P3PC 3W96D 1P3LC 3AZEC 3AZHB 1P34B 1F66C 1N1JB 5B0ZB 1ULYA 2YFWA 4XZQB 5B32G 4YS3D 3LZ0D 3AZJD 2G5IC 3MNNC 5C3IB 3LELB 2NZDD 3C1BB 5CPJA 5AY8B 4UUZA 1HQ3D 5GT3A 2LY8A 5AV6A 5B2IA 1M1AD 3B6FB 3X1UA 4Z5TB 2NQBB 1TZYA 4HGAB 2YFVA 1P3FB 1M18D 5B33A 3X1TD 4J8UD 3MGRA 5JRGA 3UT9C 3AZHC 3AV2A 1P3AC 3AZFA 3AYWB 3AZGB 3O62C 3AV1C 4E44A 5B40B 4J8XA 1KU5A 5KDMB 5GXQB 5C3IC 5F99B 3X1SB 1KX5C 2XD1A 4ZUXB 3REIC 5GT0D 4X23C 3MVDD 5BO0A 3LZ1A 3WA9C 2AROC 5E5AC 4CSRB 4YM6B 3AZHA 3UT9A 4J8VD 1P3AA 2FJ7D 5B0ZA 3TU4D 3EPHA 3W96C 3UTAD 5CP6D 4Z2MH 5AVBB 3REKD 5DNNB 3LJAD 4WU9D 1KX5A 4YS3C 3LZ0C 3C1BA 3H0RC 3AZJC 1B6WA 4X23A 2NZDC 3KSYA 2JCHA 3RELB 3KXBD 1HQ3C 3B6FA 3MGSB 4Z5TA 2NQBA 2RVQD 1BH8B 3W96A 3WTPD 5B1MD 1P3GD 2Y2QA 5B24B 1M1AC 4G92B 3LZ0A 5AV8D 2F8NB 3AYWA 5GSUB 3X1TC 3KFUG 5AVCD 5KDMA 3X1SA 5F99A 5GXQA 3B6GB 3W98D 2Y2JA 5B31C 4ZUXA 1M19D 3WAAD 1EQZD 1H3OB 5B32B 1JFIB 4CSRA 1KX4D 5GT0C 4R8PB 1P3BD 4J8WB 3AZID 1P3MB 3X1TA 2UWXA 5CPIB 3KWQB 4J8VC 2FJ7C 3TU4C 5DNNA 5B31A 5CPJB 3UTAC 5CP6C 2HUEB 4XUJB 4LD9D 3REKC 3B0BA 3R45B 5AV5D 5FUGA 5AV6B 1P3PB 5B31G 3MGQD 3RELA 1P3LB 3AZND 3AZEB 1F66B 1WWSA 1Z2CB 3MGSA 2BYKB 4QLCD 5BT1D 3KXBC 1BH8A 5AV9D 3KUYC 4J8VA 5B24A 3MNNB 3VH6W 1U35D 2RVQC 3UTAA 3WTPC 5B1MC 2F8NA 1P3KD 2F2AC 2VQRA 3AZLD 5GSUA 3P5JB 5AV8C 3W97D 3MGPD 5B0YD 3KXBA 3H0LC 2Y2LA 4H9NB 5AVCC 3KUYA 4H9PB 3W98C 3NQUA 3REJC 1H3OA 1F1EA 3WAAC 1EQZC 1JFIA 2J8PA 4R8PA 3UT9B 3VH6A 4J8WA 3AN2C 1P34D 1P3AB 5B2JD 2JE5A 4Z66D 3O62B 3AV1B 1P3MA 1KX4C 4XZQD 1P3BC 3AFAD 3VH5A 3AZIC 1BH9B 1KX3D 4H9RB 3KWQA 5CPIA 1KX5B 3X1VD 3REIB 4X23B 2L5AA 3V9RA 4XUJA 3WA9B 3R45A 3REJA 2AROB 5E5AB 1P3PA 3WAAA 4LD9C 1P3LA 3AZEA 5AV5C 1F66A 3AN2A 2F8NK 2DQNC 3MGQC 4WNNB 2PYOD 3W96B 3AZNC 2BYKA 1ZLAD 4KGCD 5BS7C 3AZIA 3REHD 3MNNA 2HIOD 4YS3B 3LZ0B 4QLCC 5BT1C 3AZJB 2CV5D 5AV9C 3W99D 2G5HC 5B1LD 3EG5B 2NZDB 1U35C 4G91C 4H9OA 1Q9CA 5B40D 1S32D 1P3KC 1P3OD 1HQ3B 5AV5A 3AZLC 3W97C 4H9QB 4EO5C 4H9NA 3MGPC 3C1CD 1M1AB 4H9PA 3EPKA 4CAYA 4WU8D 3WTPE 3B0CW 3O62A 3AV1A 3X1TB 5AVBD 1BH9A 5B2JC 3VH6T 4H9RA 4Z66C 5B31B 2IO5C 3AFAC 3REIA 3WKJD 1KX3C 4JJND 5FUGB 3WA9A 2AROA 5E5AA 3X1VC 1T3UA 5GT0B 5BNXB 3AZMD 1PZRA 4WNNA 4J8VB 2FJ7B 3TU4B 4Z66A 3AZKD 1AOID 2PYOC 5JA4B 4YS3A 3UTAB 1ZLAC 5CP6B 3AZJA 2ZM5A 1P3ID 4KGCC 3REKB 1KX3A 3REHC 1M18C 3LJAB 4AWLC 2HIOC 2NZDA 1ID3D 4J8UC 5G49B 5DNMD 5CHLB 3W99C 1BFMA 5B1LC 1HQ3A 4Z2MG 3KXBB 1S32C 1P3OC 4H9QA 3KUYB 3NQUB 1M1AA 5CPKD 3WTPB 5B1MB 3MVDC 3C1CC 4KUDD 2DF4C 1M18A 4WJ3C 4WU8C 4J8UA 5AV8B 4NE5A 5B1LA 3V9RB 1S32A 1P3OA 5AVCB 3W98B 3LJAC 5GT3D 3REJB 4WU9C 4DQYB 3WAAB 5AV6D 1EQZB 5GT0A 4ZBJC 5BNXA 3MVDA 3WKJC 4JJNC 3A6ND 3AN2B 5B2ID 1B67A 3X1UD 4E45A 1KX4B 1TZYD 1P3BB 3AZMC 3AZIB 2Y2KA 4H9SC 5B33D 2FJ7A 3TU4A 2XD5A 5JA4A 5CP6A 3MGRD 5JRGD 3B0CT 3AV2D 3REKA 1P3GC 3LJAA 4NFTA 3AZKC 3AZFD 4WU9A 1AOIC 3VH5W 4H9OB 2BG1A 1P3IC 5G49A 4J8XD 3UTBD 4LD9B 5AV5B 1ID3C 3MGQB 5DNMC 3AZNB 2Y2OA 3F6TA 3LZ1D 1M19C 4CAYB 4QLCB 5AV9B 3WTPA 2Y2NA 5B1MA 3AZHD 1P3GA 3H0MC 5B0ZD 1U35B 2ZY2A 3A1IA 4G91B 5CPKC 1R4VA 4KUDC 5AV8A 1P3KB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JSS A;  3LEL D;  3AZL B;  1KX5 D;  3C1B D;  1ID3 A;  5BNV B;  5AY8 D;  3W97 B;  4EO5 B;  3MGP B;  5AVC A;  3W98 A;  1M19 A;  1EQZ A;  5GT3 C;  3B6F D;  4Z5T D;  2NQB D;  1KX4 A;  5CPK A;  1P3B A;  3A6N C;  2CWE A;  4KUD A;  5B2I C;  5B2J B;  3X1U C;  4Z66 B;  1P3F D;  1TZY C;  2IO5 B;  3AFA B;  1KX3 B;  5B33 C;  1WWI A;  3AZG D;  3AYW D;  3X1V B;  3MGR C;  5JRG C;  4LD9 A;  3AV2 C;  3AZF C;  5GXQ D;  5F99 D;  3X1S D;  4ZUX D;  3B0D C;  3MGQ A;  4J8X C;  3UTB C;  3AZN A;  3A6N A;  5BS7 A;  2PYO B;  5B0Y C;  4QLC A;  1ZLA B;  4KGC B;  5AV9 A;  3LZ1 C;  4YM6 D;  3REH B;  1M18 B;  4AWL B;  2HIO B;  1U35 A;  2CV5 B;  4J8U B;  3W99 B;  1P34 C;  5B1L B;  1P3K A;  5B0Z C;  4NE3 A;  5DNN D;  3AZL A;  4XZQ C;  5B31 D;  1S32 B;  5BNV A;  3UTB A;  3W97 A;  1P3O B;  1TAF A;  3VH5 T;  3LEL C;  3MGP A;  4NE6 A;  3C1B C;  5AY8 C;  5B0Y A;  3REL D;  3MVD B;  3C1C B;  3MGS D;  4WU8 B;  1P34 A;  5B24 D;  3B6F C;  1N1J A;  5B2J A;  4WV4 B;  4Z5T C;  2NQB C;  4XZQ A;  3AFA A;  4HGA C;  2F8N D;  1P3F C;  4WU9 B;  3LEL A;  4M6B A;  4KHA B;  3X1V A;  2CV5 C;  5GSU D;  5AY8 A;  3WKJ B;  4ZBJ B;  4JJN B;  3AZG C;  3AYW C;  3B6G D;  5B40 C;  4WZS B;  3AZM B;  3KUY D;  5GXQ C;  5F99 C;  3X1S C;  4ZUX C;  5B32 D;  2PYO A;  1ZLA A;  4R8P D;  4KGC A;  1P3G B;  4J8W D;  3REH A;  3AZK B;  1P3F A;  2HIO A;  1AOI B;  1P3M D;  2CV5 A;  1P3I B;  3W99 A;  4YM6 C;  5CPI D;  3KWQ D;  3AZG A;  1ID3 B;  5DNM B;  5CPJ D;  2BYM B;  5B40 A;  4XUJ D;  5AVB C;  5DNN C;  3REJ D;  1M19 B;  1P3P D;  1P3L D;  3AZE D;  3C1C A;  1F66 D;  3NQJ B;  3AN2 D;  5CPK B;  3REL C;  4WU8 A;  4KUD B;  4YM6 A;  3MNN D;  2YFW B;  3MGS C;  2F8N H;  5AVB A;  5B24 C;  4G92 C;  4KHA A;  1HTA A;  3WKJ A;  4UUZ B;  5GT3 B;  4JJN A;  5GSU C;  3AZM A;  3A6N B;  5B2I B;  3X1U B;  4H9S A;  3B6G C;  1TZY B;  2YFV B;  4DRA A;  3UT9 D;  5B33 B;  1P3A D;  4DRB A;  5B32 C;  3AZK A;  1A7W A;  1AOI A;  3O62 D;  3AV1 D;  4R8P C;  3MGR B;  5JRG B;  1P3I A;  3AV2 B;  4J8W C;  3AZF B;  1P3M C;  3B0D B;  5DNM A;  4J8X B;  3UTB B;  3REI D;  2BYM A;  4X23 D;  5CPI C;  1TAF B;  3KWQ C;  2F8N G;  3WA9 D;  3B6G A;  2ARO D;  5E5A D;  5CPJ C;  5B0Y B;  2HUE C;  4XUJ C;  5BO0 B;  3LZ1 B;  3NQJ A;  5B32 A;  5AV6 C;  1P3P C;  3W96 D;  1P3L C;  3AZE C;  3AZH B;  1P34 B;  1F66 C;  1N1J B;  5B0Z B;  1ULY A;  2YFW A;  4XZQ B;  5B32 G;  4YS3 D;  3LZ0 D;  3AZJ D;  3MNN C;  5C3I B;  3LEL B;  2NZD D;  3C1B B;  5CPJ A;  5AY8 B;  4UUZ A;  1HQ3 D;  5GT3 A;  2LY8 A;  5AV6 A;  5B2I A;  1M1A D;  3B6F B;  3X1U A;  4Z5T B;  2NQB B;  1TZY A;  4HGA B;  2YFV A;  1P3F B;  1M18 D;  5B33 A;  3X1T D;  4J8U D;  3MGR A;  5JRG A;  3UT9 C;  3AZH C;  3AV2 A;  1P3A C;  3AZF A;  3AYW B;  3AZG B;  3O62 C;  3AV1 C;  4E44 A;  5B40 B;  4J8X A;  1KU5 A;  5KDM B;  3X1S B;  5GXQ B;  5C3I C;  5F99 B;  1KX5 C;  4ZUX B;  3REI C;  5GT0 D;  4X23 C;  3MVD D;  5BO0 A;  3LZ1 A;  3WA9 C;  2ARO C;  5E5A C;  4CSR B;  4YM6 B;  3AZH A;  3UT9 A;  4J8V D;  1P3A A;  2FJ7 D;  5B0Z A;  3TU4 D;  3W96 C;  3UTA D;  5CP6 D;  4Z2M H;  5AVB B;  3REK D;  5DNN B;  3LJA D;  4WU9 D;  1KX5 A;  4YS3 C;  3LZ0 C;  3C1B A;  3AZJ C;  1B6W A;  4X23 A;  2NZD C;  3KSY A;  3REL B;  3KXB D;  1HQ3 C;  3B6F A;  3MGS B;  4Z5T A;  2NQB A;  2RVQ D;  1BH8 B;  3W96 A;  3WTP D;  5B1M D;  1P3G D;  5B24 B;  1M1A C;  4G92 B;  3LZ0 A;  5AV8 D;  2F8N B;  3AYW A;  5GSU B;  3X1T C;  5AVC D;  5KDM A;  3X1S A;  5F99 A;  5GXQ A;  3B6G B;  3W98 D;  5B31 C;  4ZUX A;  1M19 D;  3WAA D;  1EQZ D;  1H3O B;  5B32 B;  1JFI B;  4CSR A;  1KX4 D;  5GT0 C;  4R8P B;  1P3B D;  4J8W B;  3AZI D;  1P3M B;  3X1T A;  5CPI B;  3KWQ B;  4J8V C;  2FJ7 C;  3TU4 C;  5DNN A;  5B31 A;  5CPJ B;  3UTA C;  5CP6 C;  2HUE B;  4XUJ B;  4LD9 D;  3REK C;  3B0B A;  3R45 B;  5AV5 D;  5FUG A;  5AV6 B;  1P3P B;  5B31 G;  3MGQ D;  3REL A;  1P3L B;  3AZN D;  3AZE B;  1F66 B;  1WWS A;  3MGS A;  2BYK B;  4QLC D;  5BT1 D;  3KXB C;  1BH8 A;  5AV9 D;  3KUY C;  4J8V A;  5B24 A;  3MNN B;  3VH6 W;  1U35 D;  2RVQ C;  3UTA A;  3WTP C;  5B1M C;  2F8N A;  1P3K D;  3AZL D;  5GSU A;  5AV8 C;  3W97 D;  3MGP D;  5B0Y D;  3KXB A;  4H9N B;  5AVC C;  3KUY A;  4H9P B;  3W98 C;  3NQU A;  3REJ C;  1H3O A;  1F1E A;  3WAA C;  1EQZ C;  1JFI A;  4R8P A;  3UT9 B;  3VH6 A;  4J8W A;  3AN2 C;  1P34 D;  1P3A B;  5B2J D;  4Z66 D;  3O62 B;  3AV1 B;  1P3M A;  1KX4 C;  4XZQ D;  1P3B C;  3AFA D;  3VH5 A;  3AZI C;  1BH9 B;  1KX3 D;  4H9R B;  3KWQ A;  5CPI A;  1KX5 B;  3X1V D;  3REI B;  4X23 B;  2L5A A;  3V9R A;  4XUJ A;  3WA9 B;  3R45 A;  3REJ A;  2ARO B;  5E5A B;  1P3P A;  3WAA A;  4LD9 C;  1P3L A;  3AZE A;  5AV5 C;  1F66 A;  3AN2 A;  2F8N K;  3MGQ C;  2PYO D;  4WNN B;  3W96 B;  3AZN C;  2BYK A;  1ZLA D;  4KGC D;  5BS7 C;  3AZI A;  3REH D;  3MNN A;  2HIO D;  4YS3 B;  3LZ0 B;  4QLC C;  5BT1 C;  3AZJ B;  2CV5 D;  5AV9 C;  3W99 D;  5B1L D;  2NZD B;  1U35 C;  4G91 C;  4H9O A;  1Q9C A;  5B40 D;  1S32 D;  1P3K C;  1P3O D;  1HQ3 B;  5AV5 A;  3AZL C;  3W97 C;  4H9Q B;  4EO5 C;  4H9N A;  3MGP C;  3C1C D;  1M1A B;  4H9P A;  4CAY A;  4WU8 D;  3WTP E;  3B0C W;  3O62 A;  3AV1 A;  3X1T B;  5AVB D;  1BH9 A;  5B2J C;  3VH6 T;  4H9R A;  4Z66 C;  5B31 B;  2IO5 C;  3AFA C;  3REI A;  3WKJ D;  1KX3 C;  4JJN D;  5FUG B;  3WA9 A;  2ARO A;  5E5A A;  3X1V C;  5GT0 B;  5BNX B;  3AZM D;  4WNN A;  4J8V B;  2FJ7 B;  3TU4 B;  4Z66 A;  3AZK D;  1AOI D;  2PYO C;  5JA4 B;  4YS3 A;  3UTA B;  1ZLA C;  5CP6 B;  3AZJ A;  4KGC C;  1P3I D;  3REK B;  1KX3 A;  3REH C;  1M18 C;  3LJA B;  4AWL C;  2HIO C;  2NZD A;  1ID3 D;  4J8U C;  5G49 B;  5DNM D;  5CHL B;  3W99 C;  1BFM A;  5B1L C;  1HQ3 A;  4Z2M G;  3KXB B;  1S32 C;  1P3O C;  4H9Q A;  3KUY B;  3NQU B;  1M1A A;  5CPK D;  3WTP B;  5B1M B;  3MVD C;  3C1C C;  4KUD D;  1M18 A;  4WU8 C;  4J8U A;  5AV8 B;  4NE5 A;  5B1L A;  3V9R B;  1S32 A;  1P3O A;  5AVC B;  3W98 B;  3LJA C;  5GT3 D;  3REJ B;  4WU9 C;  3WAA B;  5AV6 D;  1EQZ B;  5GT0 A;  4ZBJ C;  5BNX A;  3MVD A;  3WKJ C;  4JJN C;  3A6N D;  3AN2 B;  5B2I D;  1B67 A;  3X1U D;  4E45 A;  1KX4 B;  1TZY D;  1P3B B;  3AZM C;  3AZI B;  4H9S C;  5B33 D;  2FJ7 A;  3TU4 A;  5JA4 A;  5CP6 A;  3MGR D;  5JRG D;  3B0C T;  3AV2 D;  3REK A;  1P3G C;  3LJA A;  4NFT A;  3AZK C;  3AZF D;  4WU9 A;  1AOI C;  3VH5 W;  4H9O B;  1P3I C;  4LD9 B;  5G49 A;  4J8X D;  3UTB D;  5AV5 B;  1ID3 C;  3MGQ B;  5DNM C;  3AZN B;  3LZ1 D;  1M19 C;  4CAY B;  4QLC B;  5AV9 B;  3WTP A;  5B1M A;  3AZH D;  1P3G A;  5B0Z D;  1U35 B;  4G91 B;  5CPK C;  1R4V A;  4KUD C;  5AV8 A;  1P3K B; 
#chains in the Genus database with same CATH topology
 2JSS A;  3LEL D;  3AZL B;  1KX5 D;  3C1B D;  1ID3 A;  2Y2G A;  5BNV B;  5AY8 D;  3W97 B;  4EO5 B;  3MGP B;  5AVC A;  3W98 A;  1M19 A;  1EQZ A;  5GT3 C;  3B6F D;  4Z5T D;  2NQB D;  1KX4 A;  3A1K A;  5CPK A;  1P3B A;  2ZY4 A;  3A6N C;  2CWE A;  4KUD A;  5B2I C;  5B2J B;  3X1U C;  4Z66 B;  1P3F D;  1TZY C;  2Y2M A;  2IO5 B;  3AFA B;  3EPL A;  1KX3 B;  5B33 C;  1WWI A;  3AZG D;  3AYW D;  3X1V B;  3MGR C;  5JRG C;  4LD9 A;  3AV2 C;  2ZY3 A;  3AZF C;  5GXQ D;  5F99 D;  3X1S D;  4ZUX D;  3B0D C;  3MGQ A;  4J8X C;  3UTB C;  3AZN A;  3A6N A;  5BS7 A;  2PYO B;  5B0Y C;  4QLC A;  1ZLA B;  4KGC B;  5AV9 A;  3LZ1 C;  4YM6 D;  3REH B;  1M18 B;  4AWL B;  2HIO B;  1U35 A;  2CV5 B;  4J8U B;  3W99 B;  4UPK A;  1P34 C;  5B1L B;  1P3K A;  5B0Z C;  4NE3 A;  5DNN D;  3AZL A;  4XZQ C;  5B31 D;  1S32 B;  5BNV A;  3UTB A;  2Y2P A;  3W97 A;  1P3O B;  1TAF A;  3VH5 T;  3FDD A;  3LEL C;  3MGP A;  4NE6 A;  3C1B C;  5AY8 C;  5B0Y A;  3REL D;  3MVD B;  3C1C B;  2W8S A;  3MGS D;  4WU8 B;  1P34 A;  5B24 D;  3B6F C;  1N1J A;  5B2J A;  4WV4 B;  4Z5T C;  2NQB C;  4XZQ A;  3AFA A;  4HGA C;  2F8N D;  2Y2I A;  1P3F C;  4WU9 B;  3LEL A;  4M6B A;  4KHA B;  3X1V A;  2CV5 C;  5GSU D;  5AY8 A;  3WKJ B;  4ZBJ B;  3AL0 C;  4JJN B;  3AZG C;  3AYW C;  3B6G D;  5B40 C;  4WZS B;  3AZM B;  3IP4 C;  3KUY D;  5GXQ C;  5F99 C;  3X1S C;  4ZUX C;  5B32 D;  2PYO A;  1ZLA A;  4R8P D;  4KGC A;  1P3G B;  4J8W D;  3REH A;  2RIQ A;  3AZK B;  1P3F A;  2HIO A;  1AOI B;  1P3M D;  2CV5 A;  1P3I B;  3W99 A;  4YM6 C;  5CPI D;  3KWQ D;  3AZG A;  1ID3 B;  5DNM B;  5CPJ D;  2BYM B;  5B40 A;  3EPJ A;  4XUJ D;  5AVB C;  5DNN C;  3REJ D;  1M19 B;  1P3P D;  1P3L D;  3AZE D;  3C1C A;  1F66 D;  3NQJ B;  3AN2 D;  5CPK B;  3REL C;  4WU8 A;  4KUD B;  4YM6 A;  3MNN D;  2YFW B;  3MGS C;  2F8N H;  5AVB A;  5B24 C;  4G92 C;  4KHA A;  1HTA A;  3WKJ A;  4UUZ B;  5GT3 B;  4JJN A;  5GSU C;  3AZM A;  3A6N B;  5B2I B;  3X1U B;  4H9S A;  3B6G C;  1TZY B;  2YFV B;  4DRA A;  3UT9 D;  5B33 B;  1P3A D;  4DRB A;  5B32 C;  3AZK A;  1A7W A;  1AOI A;  3O62 D;  3AV1 D;  4R8P C;  3MGR B;  5JRG B;  1P3I A;  3AV2 B;  4J8W C;  3AZF B;  2FFF B;  1P3M C;  3B0D B;  5DNM A;  4J8X B;  3UTB B;  3REI D;  2BYM A;  4X23 D;  5CPI C;  1TAF B;  3KWQ C;  2F8N G;  3WA9 D;  1W2E A;  2ZY5 A;  3B6G A;  2ARO D;  5E5A D;  5CPJ C;  5B0Y B;  2HUE C;  4XUJ C;  5BO0 B;  3LZ1 B;  2Y2H A;  3NQJ A;  5B32 A;  5AV6 C;  1P3P C;  3W96 D;  1P3L C;  3AZE C;  3AZH B;  1P34 B;  1F66 C;  1N1J B;  5B0Z B;  1ULY A;  2YFW A;  4XZQ B;  5B32 G;  4YS3 D;  3LZ0 D;  3AZJ D;  2G5I C;  3MNN C;  5C3I B;  3LEL B;  2NZD D;  3C1B B;  5CPJ A;  5AY8 B;  4UUZ A;  1HQ3 D;  5GT3 A;  2LY8 A;  5AV6 A;  5B2I A;  1M1A D;  3B6F B;  3X1U A;  4Z5T B;  2NQB B;  1TZY A;  4HGA B;  2YFV A;  1P3F B;  1M18 D;  5B33 A;  3X1T D;  4J8U D;  3MGR A;  5JRG A;  3UT9 C;  3AZH C;  3AV2 A;  1P3A C;  3AZF A;  3AYW B;  3AZG B;  3O62 C;  3AV1 C;  4E44 A;  5B40 B;  4J8X A;  1KU5 A;  5KDM B;  5GXQ B;  5C3I C;  5F99 B;  3X1S B;  1KX5 C;  2XD1 A;  4ZUX B;  3REI C;  5GT0 D;  4X23 C;  3MVD D;  5BO0 A;  3LZ1 A;  3WA9 C;  2ARO C;  5E5A C;  4CSR B;  4YM6 B;  3AZH A;  3UT9 A;  4J8V D;  1P3A A;  2FJ7 D;  5B0Z A;  3TU4 D;  3EPH A;  3W96 C;  3UTA D;  5CP6 D;  4Z2M H;  5AVB B;  3REK D;  5DNN B;  3LJA D;  4WU9 D;  1KX5 A;  4YS3 C;  3LZ0 C;  3C1B A;  3H0R C;  3AZJ C;  1B6W A;  4X23 A;  2NZD C;  3KSY A;  2JCH A;  3REL B;  3KXB D;  1HQ3 C;  3B6F A;  3MGS B;  4Z5T A;  2NQB A;  2RVQ D;  1BH8 B;  3W96 A;  3WTP D;  5B1M D;  1P3G D;  2Y2Q A;  5B24 B;  1M1A C;  4G92 B;  3LZ0 A;  5AV8 D;  2F8N B;  3AYW A;  5GSU B;  3X1T C;  3KFU G;  5AVC D;  5KDM A;  3X1S A;  5F99 A;  5GXQ A;  3B6G B;  3W98 D;  2Y2J A;  5B31 C;  4ZUX A;  1M19 D;  3WAA D;  1EQZ D;  1H3O B;  5B32 B;  1JFI B;  4CSR A;  1KX4 D;  5GT0 C;  4R8P B;  1P3B D;  4J8W B;  3AZI D;  1P3M B;  3X1T A;  2UWX A;  5CPI B;  3KWQ B;  4J8V C;  2FJ7 C;  3TU4 C;  5DNN A;  5B31 A;  5CPJ B;  3UTA C;  5CP6 C;  2HUE B;  4XUJ B;  4LD9 D;  3REK C;  3B0B A;  3R45 B;  5AV5 D;  5FUG A;  5AV6 B;  1P3P B;  5B31 G;  3MGQ D;  3REL A;  1P3L B;  3AZN D;  3AZE B;  1F66 B;  1WWS A;  1Z2C B;  3MGS A;  2BYK B;  4QLC D;  5BT1 D;  3KXB C;  1BH8 A;  5AV9 D;  3KUY C;  4J8V A;  5B24 A;  3MNN B;  3VH6 W;  1U35 D;  2RVQ C;  3UTA A;  3WTP C;  5B1M C;  2F8N A;  1P3K D;  2F2A C;  2VQR A;  3AZL D;  5GSU A;  3P5J B;  5AV8 C;  3W97 D;  3MGP D;  5B0Y D;  3KXB A;  3H0L C;  2Y2L A;  4H9N B;  5AVC C;  3KUY A;  4H9P B;  3W98 C;  3NQU A;  3REJ C;  1H3O A;  1F1E A;  3WAA C;  1EQZ C;  1JFI A;  2J8P A;  4R8P A;  3UT9 B;  3VH6 A;  4J8W A;  3AN2 C;  1P34 D;  1P3A B;  5B2J D;  2JE5 A;  4Z66 D;  3O62 B;  3AV1 B;  1P3M A;  1KX4 C;  4XZQ D;  1P3B C;  3AFA D;  3VH5 A;  3AZI C;  1BH9 B;  1KX3 D;  4H9R B;  3KWQ A;  5CPI A;  1KX5 B;  3X1V D;  3REI B;  4X23 B;  2L5A A;  3V9R A;  4XUJ A;  3WA9 B;  3R45 A;  3REJ A;  2ARO B;  5E5A B;  1P3P A;  3WAA A;  4LD9 C;  1P3L A;  3AZE A;  5AV5 C;  1F66 A;  3AN2 A;  2F8N K;  2DQN C;  3MGQ C;  4WNN B;  2PYO D;  3W96 B;  3AZN C;  2BYK A;  1ZLA D;  4KGC D;  5BS7 C;  3AZI A;  3REH D;  3MNN A;  2HIO D;  4YS3 B;  3LZ0 B;  4QLC C;  5BT1 C;  3AZJ B;  2CV5 D;  5AV9 C;  3W99 D;  2G5H C;  5B1L D;  3EG5 B;  2NZD B;  1U35 C;  4G91 C;  4H9O A;  1Q9C A;  5B40 D;  1S32 D;  1P3K C;  1P3O D;  1HQ3 B;  5AV5 A;  3AZL C;  3W97 C;  4H9Q B;  4EO5 C;  4H9N A;  3MGP C;  3C1C D;  1M1A B;  4H9P A;  3EPK A;  4CAY A;  4WU8 D;  3WTP E;  3B0C W;  3O62 A;  3AV1 A;  3X1T B;  5AVB D;  1BH9 A;  5B2J C;  3VH6 T;  4H9R A;  4Z66 C;  5B31 B;  2IO5 C;  3AFA C;  3REI A;  3WKJ D;  1KX3 C;  4JJN D;  5FUG B;  3WA9 A;  2ARO A;  5E5A A;  3X1V C;  1T3U A;  5GT0 B;  5BNX B;  3AZM D;  1PZR A;  4WNN A;  4J8V B;  2FJ7 B;  3TU4 B;  4Z66 A;  3AZK D;  1AOI D;  2PYO C;  5JA4 B;  4YS3 A;  3UTA B;  1ZLA C;  5CP6 B;  3AZJ A;  2ZM5 A;  1P3I D;  4KGC C;  3REK B;  1KX3 A;  3REH C;  1M18 C;  3LJA B;  4AWL C;  2HIO C;  2NZD A;  1ID3 D;  4J8U C;  5G49 B;  5DNM D;  5CHL B;  3W99 C;  1BFM A;  5B1L C;  1HQ3 A;  4Z2M G;  3KXB B;  1S32 C;  1P3O C;  4H9Q A;  3KUY B;  3NQU B;  1M1A A;  5CPK D;  3WTP B;  5B1M B;  3MVD C;  3C1C C;  4KUD D;  2DF4 C;  1M18 A;  4WJ3 C;  4WU8 C;  4J8U A;  5AV8 B;  4NE5 A;  5B1L A;  3V9R B;  1S32 A;  1P3O A;  5AVC B;  3W98 B;  3LJA C;  5GT3 D;  3REJ B;  4WU9 C;  4DQY B;  3WAA B;  5AV6 D;  1EQZ B;  5GT0 A;  4ZBJ C;  5BNX A;  3MVD A;  3WKJ C;  4JJN C;  3A6N D;  3AN2 B;  5B2I D;  1B67 A;  3X1U D;  4E45 A;  1KX4 B;  1TZY D;  1P3B B;  3AZM C;  3AZI B;  2Y2K A;  4H9S C;  5B33 D;  2FJ7 A;  3TU4 A;  2XD5 A;  5JA4 A;  5CP6 A;  3MGR D;  5JRG D;  3B0C T;  3AV2 D;  3REK A;  1P3G C;  3LJA A;  4NFT A;  3AZK C;  3AZF D;  4WU9 A;  1AOI C;  3VH5 W;  4H9O B;  2BG1 A;  1P3I C;  5G49 A;  4J8X D;  3UTB D;  4LD9 B;  5AV5 B;  1ID3 C;  3MGQ B;  5DNM C;  3AZN B;  2Y2O A;  3F6T A;  3LZ1 D;  1M19 C;  4CAY B;  4QLC B;  5AV9 B;  3WTP A;  2Y2N A;  5B1M A;  3AZH D;  1P3G A;  3H0M C;  5B0Z D;  1U35 B;  2ZY2 A;  3A1I A;  4G91 B;  5CPK C;  1R4V A;  4KUD C;  5AV8 A;  1P3K B; 
#chains in the Genus database with same CATH homology
 2JSS A;  3LEL D;  3AZL B;  1KX5 D;  3C1B D;  1ID3 A;  2Y2G A;  5BNV B;  5AY8 D;  3W97 B;  4EO5 B;  3MGP B;  5AVC A;  3W98 A;  1M19 A;  1EQZ A;  5GT3 C;  3B6F D;  4Z5T D;  2NQB D;  1KX4 A;  3A1K A;  5CPK A;  1P3B A;  2ZY4 A;  3A6N C;  2CWE A;  4KUD A;  5B2I C;  5B2J B;  3X1U C;  4Z66 B;  1P3F D;  1TZY C;  2Y2M A;  2IO5 B;  3AFA B;  3EPL A;  1KX3 B;  5B33 C;  1WWI A;  3AZG D;  3AYW D;  3X1V B;  3MGR C;  5JRG C;  4LD9 A;  3AV2 C;  2ZY3 A;  3AZF C;  5GXQ D;  5F99 D;  3X1S D;  4ZUX D;  3B0D C;  3MGQ A;  4J8X C;  3UTB C;  3AZN A;  3A6N A;  5BS7 A;  2PYO B;  5B0Y C;  4QLC A;  1ZLA B;  4KGC B;  5AV9 A;  3LZ1 C;  4YM6 D;  3REH B;  1M18 B;  4AWL B;  2HIO B;  1U35 A;  2CV5 B;  4J8U B;  3W99 B;  4UPK A;  1P34 C;  5B1L B;  1P3K A;  5B0Z C;  4NE3 A;  5DNN D;  3AZL A;  4XZQ C;  5B31 D;  1S32 B;  5BNV A;  3UTB A;  2Y2P A;  3W97 A;  1P3O B;  1TAF A;  3VH5 T;  3FDD A;  3LEL C;  3MGP A;  4NE6 A;  3C1B C;  5AY8 C;  5B0Y A;  3REL D;  3MVD B;  3C1C B;  2W8S A;  3MGS D;  4WU8 B;  1P34 A;  5B24 D;  3B6F C;  1N1J A;  5B2J A;  4WV4 B;  4Z5T C;  2NQB C;  4XZQ A;  3AFA A;  4HGA C;  2F8N D;  2Y2I A;  1P3F C;  4WU9 B;  3LEL A;  4M6B A;  4KHA B;  3X1V A;  2CV5 C;  5GSU D;  5AY8 A;  3WKJ B;  4ZBJ B;  3AL0 C;  4JJN B;  3AZG C;  3AYW C;  3B6G D;  5B40 C;  4WZS B;  3AZM B;  3IP4 C;  3KUY D;  5GXQ C;  5F99 C;  3X1S C;  4ZUX C;  5B32 D;  2PYO A;  1ZLA A;  4R8P D;  4KGC A;  1P3G B;  4J8W D;  3REH A;  2RIQ A;  3AZK B;  1P3F A;  2HIO A;  1AOI B;  1P3M D;  2CV5 A;  1P3I B;  3W99 A;  4YM6 C;  5CPI D;  3KWQ D;  3AZG A;  1ID3 B;  5DNM B;  5CPJ D;  2BYM B;  5B40 A;  3EPJ A;  4XUJ D;  5AVB C;  5DNN C;  3REJ D;  1M19 B;  1P3P D;  1P3L D;  3AZE D;  3C1C A;  1F66 D;  3NQJ B;  3AN2 D;  5CPK B;  3REL C;  4WU8 A;  4KUD B;  4YM6 A;  3MNN D;  2YFW B;  3MGS C;  2F8N H;  5AVB A;  5B24 C;  4G92 C;  4KHA A;  1HTA A;  3WKJ A;  4UUZ B;  5GT3 B;  4JJN A;  5GSU C;  3AZM A;  3A6N B;  5B2I B;  3X1U B;  4H9S A;  3B6G C;  1TZY B;  2YFV B;  4DRA A;  3UT9 D;  5B33 B;  1P3A D;  4DRB A;  5B32 C;  3AZK A;  1A7W A;  1AOI A;  3O62 D;  3AV1 D;  4R8P C;  3MGR B;  5JRG B;  1P3I A;  3AV2 B;  4J8W C;  3AZF B;  2FFF B;  1P3M C;  3B0D B;  5DNM A;  4J8X B;  3UTB B;  3REI D;  2BYM A;  4X23 D;  5CPI C;  1TAF B;  3KWQ C;  2F8N G;  3WA9 D;  1W2E A;  2ZY5 A;  3B6G A;  2ARO D;  5E5A D;  5CPJ C;  5B0Y B;  2HUE C;  4XUJ C;  5BO0 B;  3LZ1 B;  2Y2H A;  3NQJ A;  5B32 A;  5AV6 C;  1P3P C;  3W96 D;  1P3L C;  3AZE C;  3AZH B;  1P34 B;  1F66 C;  1N1J B;  5B0Z B;  1ULY A;  2YFW A;  4XZQ B;  5B32 G;  4YS3 D;  3LZ0 D;  3AZJ D;  2G5I C;  3MNN C;  5C3I B;  3LEL B;  2NZD D;  3C1B B;  5CPJ A;  5AY8 B;  4UUZ A;  1HQ3 D;  5GT3 A;  2LY8 A;  5AV6 A;  5B2I A;  1M1A D;  3B6F B;  3X1U A;  4Z5T B;  2NQB B;  1TZY A;  4HGA B;  2YFV A;  1P3F B;  1M18 D;  5B33 A;  3X1T D;  4J8U D;  3MGR A;  5JRG A;  3UT9 C;  3AZH C;  3AV2 A;  1P3A C;  3AZF A;  3AYW B;  3AZG B;  3O62 C;  3AV1 C;  4E44 A;  5B40 B;  4J8X A;  1KU5 A;  5KDM B;  5GXQ B;  5C3I C;  5F99 B;  3X1S B;  1KX5 C;  2XD1 A;  4ZUX B;  3REI C;  5GT0 D;  4X23 C;  3MVD D;  5BO0 A;  3LZ1 A;  3WA9 C;  2ARO C;  5E5A C;  4CSR B;  4YM6 B;  3AZH A;  3UT9 A;  4J8V D;  1P3A A;  2FJ7 D;  5B0Z A;  3TU4 D;  3EPH A;  3W96 C;  3UTA D;  5CP6 D;  4Z2M H;  5AVB B;  3REK D;  5DNN B;  3LJA D;  4WU9 D;  1KX5 A;  4YS3 C;  3LZ0 C;  3C1B A;  3H0R C;  3AZJ C;  1B6W A;  4X23 A;  2NZD C;  3KSY A;  2JCH A;  3REL B;  3KXB D;  1HQ3 C;  3B6F A;  3MGS B;  4Z5T A;  2NQB A;  2RVQ D;  1BH8 B;  3W96 A;  3WTP D;  5B1M D;  1P3G D;  2Y2Q A;  5B24 B;  1M1A C;  4G92 B;  3LZ0 A;  5AV8 D;  2F8N B;  3AYW A;  5GSU B;  3X1T C;  3KFU G;  5AVC D;  5KDM A;  3X1S A;  5F99 A;  5GXQ A;  3B6G B;  3W98 D;  2Y2J A;  5B31 C;  4ZUX A;  1M19 D;  3WAA D;  1EQZ D;  1H3O B;  5B32 B;  1JFI B;  4CSR A;  1KX4 D;  5GT0 C;  4R8P B;  1P3B D;  4J8W B;  3AZI D;  1P3M B;  3X1T A;  2UWX A;  5CPI B;  3KWQ B;  4J8V C;  2FJ7 C;  3TU4 C;  5DNN A;  5B31 A;  5CPJ B;  3UTA C;  5CP6 C;  2HUE B;  4XUJ B;  4LD9 D;  3REK C;  3B0B A;  3R45 B;  5AV5 D;  5FUG A;  5AV6 B;  1P3P B;  5B31 G;  3MGQ D;  3REL A;  1P3L B;  3AZN D;  3AZE B;  1F66 B;  1WWS A;  1Z2C B;  3MGS A;  2BYK B;  4QLC D;  5BT1 D;  3KXB C;  1BH8 A;  5AV9 D;  3KUY C;  4J8V A;  5B24 A;  3MNN B;  3VH6 W;  1U35 D;  2RVQ C;  3UTA A;  3WTP C;  5B1M C;  2F8N A;  1P3K D;  2F2A C;  2VQR A;  3AZL D;  5GSU A;  3P5J B;  5AV8 C;  3W97 D;  3MGP D;  5B0Y D;  3KXB A;  3H0L C;  2Y2L A;  4H9N B;  5AVC C;  3KUY A;  4H9P B;  3W98 C;  3NQU A;  3REJ C;  1H3O A;  1F1E A;  3WAA C;  1EQZ C;  1JFI A;  2J8P A;  4R8P A;  3UT9 B;  3VH6 A;  4J8W A;  3AN2 C;  1P34 D;  1P3A B;  5B2J D;  2JE5 A;  4Z66 D;  3O62 B;  3AV1 B;  1P3M A;  1KX4 C;  4XZQ D;  1P3B C;  3AFA D;  3VH5 A;  3AZI C;  1BH9 B;  1KX3 D;  4H9R B;  3KWQ A;  5CPI A;  1KX5 B;  3X1V D;  3REI B;  4X23 B;  2L5A A;  3V9R A;  4XUJ A;  3WA9 B;  3R45 A;  3REJ A;  2ARO B;  5E5A B;  1P3P A;  3WAA A;  4LD9 C;  1P3L A;  3AZE A;  5AV5 C;  1F66 A;  3AN2 A;  2F8N K;  2DQN C;  3MGQ C;  4WNN B;  2PYO D;  3W96 B;  3AZN C;  2BYK A;  1ZLA D;  4KGC D;  5BS7 C;  3AZI A;  3REH D;  3MNN A;  2HIO D;  4YS3 B;  3LZ0 B;  4QLC C;  5BT1 C;  3AZJ B;  2CV5 D;  5AV9 C;  3W99 D;  2G5H C;  5B1L D;  3EG5 B;  2NZD B;  1U35 C;  4G91 C;  4H9O A;  1Q9C A;  5B40 D;  1S32 D;  1P3K C;  1P3O D;  1HQ3 B;  5AV5 A;  3AZL C;  3W97 C;  4H9Q B;  4EO5 C;  4H9N A;  3MGP C;  3C1C D;  1M1A B;  4H9P A;  3EPK A;  4CAY A;  4WU8 D;  3WTP E;  3B0C W;  3O62 A;  3AV1 A;  3X1T B;  5AVB D;  1BH9 A;  5B2J C;  3VH6 T;  4H9R A;  4Z66 C;  5B31 B;  2IO5 C;  3AFA C;  3REI A;  3WKJ D;  1KX3 C;  4JJN D;  5FUG B;  3WA9 A;  2ARO A;  5E5A A;  3X1V C;  1T3U A;  5GT0 B;  5BNX B;  3AZM D;  1PZR A;  4WNN A;  4J8V B;  2FJ7 B;  3TU4 B;  4Z66 A;  3AZK D;  1AOI D;  2PYO C;  5JA4 B;  4YS3 A;  3UTA B;  1ZLA C;  5CP6 B;  3AZJ A;  2ZM5 A;  1P3I D;  4KGC C;  3REK B;  1KX3 A;  3REH C;  1M18 C;  3LJA B;  4AWL C;  2HIO C;  2NZD A;  1ID3 D;  4J8U C;  5G49 B;  5DNM D;  5CHL B;  3W99 C;  1BFM A;  5B1L C;  1HQ3 A;  4Z2M G;  3KXB B;  1S32 C;  1P3O C;  4H9Q A;  3KUY B;  3NQU B;  1M1A A;  5CPK D;  3WTP B;  5B1M B;  3MVD C;  3C1C C;  4KUD D;  2DF4 C;  1M18 A;  4WJ3 C;  4WU8 C;  4J8U A;  5AV8 B;  4NE5 A;  5B1L A;  3V9R B;  1S32 A;  1P3O A;  5AVC B;  3W98 B;  3LJA C;  5GT3 D;  3REJ B;  4WU9 C;  4DQY B;  3WAA B;  5AV6 D;  1EQZ B;  5GT0 A;  4ZBJ C;  5BNX A;  3MVD A;  3WKJ C;  4JJN C;  3A6N D;  3AN2 B;  5B2I D;  1B67 A;  3X1U D;  4E45 A;  1KX4 B;  1TZY D;  1P3B B;  3AZM C;  3AZI B;  2Y2K A;  4H9S C;  5B33 D;  2FJ7 A;  3TU4 A;  2XD5 A;  5JA4 A;  5CP6 A;  3MGR D;  5JRG D;  3B0C T;  3AV2 D;  3REK A;  1P3G C;  3LJA A;  4NFT A;  3AZK C;  3AZF D;  4WU9 A;  1AOI C;  3VH5 W;  4H9O B;  2BG1 A;  1P3I C;  5G49 A;  4J8X D;  3UTB D;  4LD9 B;  5AV5 B;  1ID3 C;  3MGQ B;  5DNM C;  3AZN B;  2Y2O A;  3F6T A;  3LZ1 D;  1M19 C;  4CAY B;  4QLC B;  5AV9 B;  3WTP A;  2Y2N A;  5B1M A;  3AZH D;  1P3G A;  3H0M C;  5B0Z D;  1U35 B;  2ZY2 A;  3A1I A;  4G91 B;  5CPK C;  1R4V A;  4KUD C;  5AV8 A;  1P3K B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...