5FUGA

Crystal structure of a human yl1-h2a.z-h2b complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
89
structure length
89
Chain Sequence
SRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HISTONE H2A.Z
publication title Molecular Basis and Specificity of H2A.Z-H2B Recognition and Deposition by the Histone Chaperone Yl1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 29
structure length 89
sequence length 89
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2016-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5fugA00
4H9QA 5E5AB 5CPJC 4J8VB 5B2IB 3RELB 5B0ZC 4J8XA 1M1AB 1KX3D 5B1LA 1TAFA 4XZQC 3AZJC 3B6GD 5JRGC 4R8PC 1EQZB 3NQJB 4H9NA 5BNXB 3A6NB 5B32G 5AV8D 4LD9C 3WAAA 5B24D 5BT1C 5AV9B 2CV5B 1P34B 2NZDB 1P3LA 3AZHB 4NE6A 5GSUA 4XUJC 3NQUB 3REKC 4KGCC 3LZ0B 5E5AD 4X23B 4J8UD 4EO5C 5GXQC 3LJAC 5AV5A 4J8VD 3REJC 3O62B 5B33A 3RELD 5KDMA 1M1AD 4Z5TC 5B40B 3MGPC 3AN2C 3TU4C 3AZKB 3B0BA 3C1CC 3AYWC 3AV2B 4KUDB 3A6ND 5B0YA 2HIOD 3LZ1A 5AV9D 2YFVB 2CV5D 1P3PB 2NZDD 3B0CW 3AZHD 5AV6B 1M19C 3X1TA 2F8NB 1HQ3A 1TZYB 4YM6C 3LZ0D 1N1JA 1P3KC 1ID3B 1KX5A 5B32C 5AY8B 3X1UC 2RVQC 1P3IC 1ZLAD 3AZKD 2FJ7B 4H9OA 3W97C 1P3OB 3X1VC 5JA4A 3AV2D 5DNNB 1S32C 4YS3B 4J8VA 1P3PD 5B2IA 3RELA 1BH8B 4ZUXC 4H9RB 5AV6D 3WTPC 5FUGB 3B6GC 4Z66B 2F8ND 4H9QB 2BYMB 3LELC 3UTBB 3MVDC 1EQZA 1U35D 1ID3D 1A7WA 5BNXA 5AY8D 4WU8B 2AROC 5AV8C 3A6NA 3AZMA 3AZJB 3KXBD 2CV5A 1P34A 4R8PB 3AZHA 2FJ7D 1HTAA 5B31G 5AVBB 5F99C 2PYOD 4H9SC 1P3OD 3NQUA 4CAYB 3UTAD 4J8UC 4X23A 5C3IC 3WTPE 3REID 3O62A 3REHC 5B40A 3C1BA 1P3GA 4Z2MH 3AV2A 4KUDA 1P3AC 3AFAC 3MNNA 4J8XD 5KDMB 3AN2B 4ZBJC 2YFVA 5B1LD 3AZEC 1WWSA 1R4VA 4HGAC 3W99C 5AV6A 1P3MB 1TZYA 3W96C 5AVCA 3X1SC 1ID3A 4KHAA 3WAAD 4J8WA 3MGRC 1ZLAC 3WA9B 3X1TB 4G91B 5GSUD 1HQ3B 1P3KB 1BFMA 1P3BB 5G49B 1P3OA 3B0DB 3MGQC 3AZFC 3KSYA 5DNNA 3AZNC 5B33D 3B6FC 4YS3A 1KU5A 3R45A 3B0CT 4G92C 1BH8A 1B67A 4H9RA 1P3MD 5GT0B 4Z66A 3V9RA 2BYMA 5B2JC 3UTBA 1S32B 5B0YD 4WNNB 2HUEC 3UT9C 4WU8A 3LZ1D 1AOIC 4ZUXB 3AV1C 4XZQA 3KXBC 3AZJA 3X1TD 4JJNB 4R8PA 1HQ3D 3MVDB 3KUYC 5AVBA 3AZIC 1P3BD 1KX5D 3UTAC 3WKJC 4CAYA 3AZMB 5BO0B 4QLCB 1ULYA 5GT3C 4XUJA 3REKA 4KGCA 3REJA 3REHB 5B2ID 3AN2A 3KWQC 3C1BB 1H3OB 2JSSA 5B1LC 2NQBB 1BH9B 5B1MC 1P3GB 1EQZD 1P3MA 1P3FB 2YFWB 1KX4C 3WAAC 4ZBJB 5CPIC 3MNNB 3AZMD 3AZGB 3AZEB 1P34D 5CP6B 2F8NH 1P3LC 3WA9A 3W98C 3X1SB 2L5AA 4WU9C 3AZLB 5AVCB 1P3KA 1P3BA 3X1UA 4X23D 5G49A 4KHAB 5DNMB 1F66C 5AV5C 3O62D 4J8WB 5B31B 1M18C 5B40D 3C1BD 4AWLC 3X1VA 2NQBD 3MGQB 3AZFB 5CPKB 1P3GD 4E45A 5GT0A 4KUDD 5B0YC 1S32A 4WNNA 3MGSB 3MNND 3R45B 5CP6D 2IO5B 4ZUXA 1KX3C 3WTPA 4JJNA 5CPJB 5B2JB 3LELA 1TZYD 3V9RB 5AVCD 3MVDA 3AZLD 1KX5C 1AOIB 5B0ZB 5B24C 4J8WD 4XZQB 5BO0A 4QLCA 5JRGB 5F99A 4H9SA 4NFTA 4LD9B 5E5AC 5DNND 3MGSD 4YS3D 4J8VC 3REHA 3RELC 1M1AC 4XUJB 3REKB 4KGCB 5BNVA 1H3OA 5CPJD 4Z66D 2F8NG 4EO5B 2NQBA 1BH9A 5GXQB 3UTBD 3LJAB 3REJB 1P3AA 1P3FA 3A6NC 2BYKA 2YFWA 3AFAA 5B0ZD 4WU8D 2HIOC 4Z5TB 3KWQB 3MGPB 3TU4B 5AV9C 4XZQD 3AZJD 3AZGA 3AZEA 2CV5C 1P34C 5CP6A 3W99A 5B1MB 4R8PD 3AZHC 2NZDC 5AVBD 3C1CB 3AYWB 3X1SA 3VH6W 3VH6A 3AZLA 1KX4B 3LZ0C 5CHLB 5CPIB 4NE5A 5DNMA 3MGRA 3O62C 1M19B 5B31A 4XUJD 3REKD 4KGCD 4YM6B 3AZKC 5GXQD 5B32B 3X1UB 3MGQA 3AZFA 5BS7C 5CPKA 1F66B 3LJAD 3AV2C 3REJD 1P3IB 4KUDC 4H9PB 3AZNA 4DRBA 1M18B 3MGSA 3MGPD 3AN2D 3TU4D 1P3PC 3W97B 3X1VB 5AV6C 3AYWD 5CPJA 5B2JA 1U35C 1ID3C 3UT9A 1AOIA 5AY8C 5B0ZA 3AV1A 1M19D 3WTPB 3B6GB 3WA9D 5JRGA 4YM6D 3LELB 3AZIA 2FJ7C 2PYOC 1P3KD 2F8NK 5B32D 3X1UD 1P3OC 2RVQD 2AROB 5AV8B 3WKJA 4LD9A 5DNNC 4YS3C 3REIC 4Z2MG 5GT3A 5F99B 3X1VD 4Z66C 5GT0D 4J8UB 5C3IB 5GXQA 3UTBC 1S32D 3LJAA 4WU8C 2LY8A 3VH5W 3VH5A 4Z5TA 4ZUXD 3KWQA 3MGPA 3WTPD 4J8XC 3TU4A 5BNVB 4JJND 5B1MA 3LELD 4NE3A 5AVBC 3MVDD 3C1CA 3AYWA 1P3AB 2AROD 2HIOB 2BYKB 3AFAB 1KX4A 5CPIA 4CSRB 4HGAB 4QLCD 3W99B 5F99D 1M19A 3W98A 4WU9A 3W96B 5GSUC 4YM6A 5B32A 1F66A 1P3IA 4H9PA 1B6WA 3MGRB 3REHD 1ZLAB 1M18A 5B33C 3W97A 2CWEA 1P3MC 1P3AD 3VH6T 1P3FD 3AFAD 3AZNB 3B6FB 3LZ1C 3AZGD 3AZED 4G92B 3W99D 1KX3A 3WA9C 3B6GA 4M6BA 3X1TC 4G91C 3W96D 1HQ3C 3X1SD 1U35B 2HUEB 1P3BC 3UT9B 2AROA 5DNMD 3B0DC 5AV8A 5B24A 3MGRD 3AV1B 3KXBB 1JFIB 5B31D 3KUYB 2PYOB 3AZIB 3MGQD 3AZFD 3UTAB 5CPKD 3WKJB 5GT0C 5E5AA 4J8UA 4UUZB 3AZND 1WWIA 4WV4B 3REIB 3B6FD 5GT3B 5B2IC 1M1AA 4JJNC 5B2JD 3NQJA 1EQZC 3UT9D 1AOID 2HIOA 4J8XB 4CSRA 5AV9A 3AV1D 5B1LB 1TAFB 3AZMC 2NZDA 4QLCC 3KUYD 5JRGD 3AZID 4H9NB 3W96A 3LZ0A 4DRAA 3WKJD 4LD9D 3WAAB 4X23C 5BT1D 1P3LB 1Q9CA 5GT3D 1ZLAA 3VH5T 3W98B 5GSUB 4WU9B 3AZKA 5B40C 3C1BC 1F1EA 2NQBC 5BS7A 1P3GC 5AV5B 1P3FC 5B33B 3B6FA 3MNNC 4Z5TD 3KWQD 1P3PA 3AZGC 4AWLB 5CP6C 5B1MD 2F8NA 3C1CD 1TZYC 5AVCC 5B0YB 3AZLC 1U35A 1KX4D 4WZSB 5CPID 5AY8A 3LZ1B 5DNMC 1P3LD 1KX3B 3KXBA 4J8WC 1JFIA 3W98D 5B31C 4WU9D 2FJ7A 3KUYA 2PYOA 1N1JB 1KX5B 5CPKC 4E44A 3UTAA 1F66D 5AV5D 1P3ID 4UUZA 5B24B 3MGSC 3REIA 1M18D 4H9OB 2IO5C 3W97D 5FUGA 5JA4B
chains in the Genus database with same CATH superfamily
4H9QA 5E5AB 5CPJC 3EG5B 4J8VB 2ZY4A 5B2IB 3RELB 5B0ZC 4J8XA 1M1AB 1KX3D 5B1LA 1PZRA 1TAFA 4XZQC 3AZJC 3B6GD 1Z2CB 5JRGC 4R8PC 1EQZB 3NQJB 4H9NA 5BNXB 3A6NB 5B32G 5AV8D 4LD9C 3WAAA 5B24D 5BT1C 5AV9B 2CV5B 1P34B 2NZDB 1P3LA 2ZY3A 3AZHB 2G5IC 4NE6A 5GSUA 4XUJC 3NQUB 3REKC 4KGCC 3LZ0B 3H0LC 5E5AD 4X23B 4J8UD 4EO5C 5GXQC 2Y2NA 5AV5A 3LJAC 4J8VD 3REJC 3O62B 5B33A 3RELD 5KDMA 1M1AD 4Z5TC 5B40B 3MGPC 3AN2C 3TU4C 3AZKB 3B0BA 3C1CC 3AYWC 3AV2B 4KUDB 3A6ND 2Y2PA 5B0YA 2HIOD 3LZ1A 5AV9D 2YFVB 2CV5D 1P3PB 2NZDD 3B0CW 3AZHD 5AV6B 1M19C 3X1TA 2F8NB 1HQ3A 1TZYB 4YM6C 3LZ0D 1N1JA 2W8SA 1P3KC 1ID3B 1KX5A 5B32C 5AY8B 3X1UC 2RVQC 1P3IC 1ZLAD 3AZKD 2FJ7B 4H9OA 3W97C 1P3OB 3X1VC 5JA4A 3AV2D 3H0MC 5DNNB 1S32C 2Y2LA 4YS3B 4J8VA 1P3PD 5B2IA 3RELA 1BH8B 4ZUXC 4H9RB 5AV6D 3WTPC 5FUGB 3B6GC 4Z66B 2F8ND 4H9QB 2BYMB 3LELC 3UTBB 3MVDC 1EQZA 1U35D 1ID3D 1A7WA 5BNXA 5AY8D 4WU8B 2AROC 5AV8C 3A6NA 2VQRA 3AZMA 3AZJB 3KXBD 2CV5A 1P34A 4R8PB 3AZHA 2FJ7D 1HTAA 2ZY2A 5B31G 5AVBB 5F99C 2PYOD 4H9SC 1P3OD 3NQUA 4CAYB 3UTAD 2RIQA 4J8UC 4X23A 2XD5A 5C3IC 3WTPE 1T3UA 3REID 3F6TA 3O62A 3REHC 1W2EA 2JE5A 5B40A 3C1BA 1P3GA 4Z2MH 3AV2A 4KUDA 1P3AC 3AFAC 3MNNA 4J8XD 5KDMB 2UWXA 3AN2B 3FDDA 4ZBJC 2YFVA 5B1LD 3AZEC 1WWSA 1R4VA 4HGAC 3W99C 3EPKA 5AV6A 1P3MB 1TZYA 3W96C 5AVCA 3X1SC 1ID3A 4KHAA 3WAAD 4J8WA 3MGRC 1ZLAC 3WA9B 3X1TB 4G91B 5GSUD 1HQ3B 1P3KB 1BFMA 1P3BB 5G49B 1P3OA 3B0DB 3MGQC 3AZFC 3KSYA 5DNNA 3AZNC 5B33D 3B6FC 4YS3A 1KU5A 3R45A 3IP4C 3B0CT 4G92C 1BH8A 1B67A 4H9RA 1P3MD 5GT0B 4Z66A 3V9RA 2BYMA 5B2JC 3UTBA 1S32B 5B0YD 4WNNB 2Y2OA 2HUEC 3UT9C 4WU8A 3LZ1D 1AOIC 2XD1A 4ZUXB 3A1KA 4XZQA 3KXBC 3AZJA 3AV1C 3X1TD 4JJNB 4R8PA 1HQ3D 3MVDB 3KUYC 5AVBA 3AZIC 1P3BD 1KX5D 3UTAC 3WKJC 4CAYA 3AZMB 5BO0B 4QLCB 1ULYA 5GT3C 4XUJA 3REKA 4KGCA 3REJA 3REHB 5B2ID 3AN2A 3KWQC 3C1BB 1H3OB 2JSSA 5B1LC 2NQBB 1BH9B 5B1MC 1P3GB 3EPHA 3H0RC 1EQZD 1P3MA 1P3FB 2YFWB 1KX4C 5CPIC 3WAAC 4ZBJB 3MNNB 3AZMD 3AZGB 3AZEB 1P34D 5CP6B 2F8NH 1P3LC 3A1IA 3WA9A 3W98C 3X1SB 2L5AA 4WU9C 3AZLB 5AVCB 1P3KA 1P3BA 3X1UA 4X23D 5G49A 4KHAB 5DNMB 2ZY5A 1F66C 3AL0C 5AV5C 3O62D 4J8WB 5B31B 1M18C 5B40D 3C1BD 4AWLC 2Y2GA 3X1VA 2NQBD 3MGQB 3AZFB 5CPKB 1P3GD 4E45A 5GT0A 4KUDD 5B0YC 1S32A 4UPKA 4WNNA 3MGSB 3MNND 3R45B 5CP6D 2IO5B 4ZUXA 1KX3C 3WTPA 4JJNA 5CPJB 5B2JB 3LELA 1TZYD 3V9RB 5AVCD 3MVDA 3AZLD 1KX5C 1AOIB 5B0ZB 5B24C 4J8WD 4XZQB 5BO0A 4QLCA 5JRGB 5F99A 4H9SA 4NFTA 4LD9B 5E5AC 5DNND 3MGSD 4YS3D 4J8VC 3REHA 3RELC 1M1AC 4XUJB 3REKB 4KGCB 5BNVA 1H3OA 5CPJD 4Z66D 2F8NG 4EO5B 2NQBA 1BH9A 5GXQB 3UTBD 3LJAB 3REJB 1P3AA 2BG1A 1P3FA 3A6NC 2BYKA 2YFWA 3AFAA 5B0ZD 4WU8D 2HIOC 4Z5TB 3KWQB 3MGPB 3TU4B 5AV9C 4XZQD 3AZJD 3AZGA 3AZEA 2CV5C 1P34C 5CP6A 3W99A 5B1MB 4R8PD 3AZHC 2NZDC 5AVBD 3C1CB 3AYWB 2JCHA 3VH6W 3X1SA 3VH6A 3AZLA 1KX4B 3LZ0C 5CHLB 5CPIB 4NE5A 5DNMA 2DQNC 3MGRA 3O62C 1M19B 5B31A 4XUJD 3REKD 4KGCD 4YM6B 3AZKC 5GXQD 5B32B 3X1UB 3MGQA 3AZFA 5BS7C 5CPKA 1F66B 3LJAD 3AV2C 3REJD 1P3IB 4KUDC 4H9PB 3AZNA 4DRBA 1M18B 3MGSA 3MGPD 3AN2D 3TU4D 1P3PC 3W97B 3X1VB 5AV6C 3AYWD 5CPJA 5B2JA 1U35C 1ID3C 3UT9A 1AOIA 5AY8C 5B0ZA 3AV1A 1M19D 3WTPB 3B6GB 3WA9D 5JRGA 4YM6D 3LELB 3AZIA 2FJ7C 2PYOC 1P3KD 2F8NK 5B32D 3X1UD 1P3OC 2FFFB 2AROB 2RVQD 5AV8B 3WKJA 4LD9A 5DNNC 4YS3C 3REIC 4Z2MG 5GT3A 5F99B 3X1VD 4Z66C 3EPLA 5GT0D 4J8UB 2Y2JA 5C3IB 5GXQA 3UTBC 1S32D 3LJAA 4WU8C 2LY8A 2Y2KA 3VH5W 3VH5A 4Z5TA 4ZUXD 3KWQA 3MGPA 2F2AC 3WTPD 4J8XC 3TU4A 5BNVB 2J8PA 4JJND 5B1MA 3LELD 4NE3A 5AVBC 3MVDD 3C1CA 3AYWA 4WJ3C 2Y2IA 1P3AB 2AROD 2HIOB 2BYKB 3AFAB 1KX4A 5CPIA 4CSRB 4HGAB 4QLCD 3W99B 5F99D 1M19A 3W98A 4WU9A 3W96B 5GSUC 4YM6A 5B32A 1F66A 2ZM5A 1P3IA 4H9PA 1B6WA 3MGRB 3REHD 1ZLAB 1M18A 5B33C 3W97A 2CWEA 1P3MC 1P3AD 3VH6T 1P3FD 3AFAD 3AZNB 3B6FB 3LZ1C 3AZGD 3AZED 2G5HC 3W99D 4G92B 1KX3A 3WA9C 3B6GA 4M6BA 3X1TC 4G91C 3W96D 1HQ3C 3X1SD 1U35B 2HUEB 1P3BC 3UT9B 2AROA 5DNMD 3B0DC 5AV8A 5B24A 3MGRD 3AV1B 3KXBB 1JFIB 5B31D 3KUYB 2Y2HA 2PYOB 3AZIB 3MGQD 3EPJA 3UTAB 3AZFD 5CPKD 5GT0C 5E5AA 3WKJB 4J8UA 4UUZB 3AZND 1WWIA 4WV4B 3REIB 3B6FD 5GT3B 5B2IC 1M1AA 4JJNC 5B2JD 3NQJA 1EQZC 3UT9D 1AOID 2HIOA 4J8XB 4CSRA 5AV9A 3AV1D 5B1LB 1TAFB 3AZMC 2NZDA 4QLCC 3KUYD 5JRGD 3AZID 4H9NB 3W96A 3LZ0A 4DRAA 3WKJD 4LD9D 3WAAB 4X23C 5BT1D 1P3LB 1Q9CA 5GT3D 1ZLAA 3VH5T 2Y2QA 3W98B 5GSUB 2Y2MA 4WU9B 3AZKA 5B40C 3C1BC 3P5JB 1F1EA 2NQBC 5BS7A 1P3GC 5AV5B 1P3FC 3KFUG 5B33B 3B6FA 3MNNC 4Z5TD 3KWQD 4DQYB 1P3PA 3AZGC 4AWLB 5CP6C 5B1MD 2F8NA 3C1CD 2DF4C 1TZYC 5AVCC 5B0YB 3AZLC 1U35A 1KX4D 4WZSB 5CPID 5AY8A 3LZ1B 5DNMC 1P3LD 1KX3B 3KXBA 4J8WC 1JFIA 3W98D 5B31C 4WU9D 2FJ7A 3KUYA 2PYOA 1N1JB 1KX5B 5CPKC 4E44A 3UTAA 1F66D 5AV5D 1P3ID 4UUZA 5B24B 3MGSC 3REIA 1M18D 4H9OB 2IO5C 3W97D 5FUGA 5JA4B
chains in the Genus database with same CATH topology
4H9QA 5E5AB 5CPJC 3EG5B 4J8VB 2ZY4A 5B2IB 3RELB 5B0ZC 4J8XA 1M1AB 1KX3D 5B1LA 1PZRA 1TAFA 4XZQC 3AZJC 3B6GD 1Z2CB 5JRGC 4R8PC 1EQZB 3NQJB 4H9NA 5BNXB 3A6NB 5B32G 5AV8D 4LD9C 3WAAA 5B24D 5BT1C 5AV9B 2CV5B 1P34B 2NZDB 1P3LA 2ZY3A 3AZHB 2G5IC 4NE6A 5GSUA 4XUJC 3NQUB 3REKC 4KGCC 3LZ0B 3H0LC 5E5AD 4X23B 4J8UD 4EO5C 5GXQC 2Y2NA 5AV5A 3LJAC 4J8VD 3REJC 3O62B 5B33A 3RELD 5KDMA 1M1AD 4Z5TC 5B40B 3MGPC 3AN2C 3TU4C 3AZKB 3B0BA 3C1CC 3AYWC 3AV2B 4KUDB 3A6ND 2Y2PA 5B0YA 2HIOD 3LZ1A 5AV9D 2YFVB 2CV5D 1P3PB 2NZDD 3B0CW 3AZHD 5AV6B 1M19C 3X1TA 2F8NB 1HQ3A 1TZYB 4YM6C 3LZ0D 1N1JA 2W8SA 1P3KC 1ID3B 1KX5A 5B32C 5AY8B 3X1UC 2RVQC 1P3IC 1ZLAD 3AZKD 2FJ7B 4H9OA 3W97C 1P3OB 3X1VC 5JA4A 3AV2D 3H0MC 5DNNB 1S32C 2Y2LA 4YS3B 4J8VA 1P3PD 5B2IA 3RELA 1BH8B 4ZUXC 4H9RB 5AV6D 3WTPC 5FUGB 3B6GC 4Z66B 2F8ND 4H9QB 2BYMB 3LELC 3UTBB 3MVDC 1EQZA 1U35D 1ID3D 1A7WA 5BNXA 5AY8D 4WU8B 2AROC 5AV8C 3A6NA 2VQRA 3AZMA 3AZJB 3KXBD 2CV5A 1P34A 4R8PB 3AZHA 2FJ7D 1HTAA 2ZY2A 5B31G 5AVBB 5F99C 2PYOD 4H9SC 1P3OD 3NQUA 4CAYB 3UTAD 2RIQA 4J8UC 4X23A 2XD5A 5C3IC 3WTPE 1T3UA 3REID 3F6TA 3O62A 3REHC 1W2EA 2JE5A 5B40A 3C1BA 1P3GA 4Z2MH 3AV2A 4KUDA 1P3AC 3AFAC 3MNNA 4J8XD 5KDMB 2UWXA 3AN2B 3FDDA 4ZBJC 2YFVA 5B1LD 3AZEC 1WWSA 1R4VA 4HGAC 3W99C 3EPKA 5AV6A 1P3MB 1TZYA 3W96C 5AVCA 3X1SC 1ID3A 4KHAA 3WAAD 4J8WA 3MGRC 1ZLAC 3WA9B 3X1TB 4G91B 5GSUD 1HQ3B 1P3KB 1BFMA 1P3BB 5G49B 1P3OA 3B0DB 3MGQC 3AZFC 3KSYA 5DNNA 3AZNC 5B33D 3B6FC 4YS3A 1KU5A 3R45A 3IP4C 3B0CT 4G92C 1BH8A 1B67A 4H9RA 1P3MD 5GT0B 4Z66A 3V9RA 2BYMA 5B2JC 3UTBA 1S32B 5B0YD 4WNNB 2Y2OA 2HUEC 3UT9C 4WU8A 3LZ1D 1AOIC 2XD1A 4ZUXB 3A1KA 4XZQA 3KXBC 3AZJA 3AV1C 3X1TD 4JJNB 4R8PA 1HQ3D 3MVDB 3KUYC 5AVBA 3AZIC 1P3BD 1KX5D 3UTAC 3WKJC 4CAYA 3AZMB 5BO0B 4QLCB 1ULYA 5GT3C 4XUJA 3REKA 4KGCA 3REJA 3REHB 5B2ID 3AN2A 3KWQC 3C1BB 1H3OB 2JSSA 5B1LC 2NQBB 1BH9B 5B1MC 1P3GB 3EPHA 3H0RC 1EQZD 1P3MA 1P3FB 2YFWB 1KX4C 5CPIC 3WAAC 4ZBJB 3MNNB 3AZMD 3AZGB 3AZEB 1P34D 5CP6B 2F8NH 1P3LC 3A1IA 3WA9A 3W98C 3X1SB 2L5AA 4WU9C 3AZLB 5AVCB 1P3KA 1P3BA 3X1UA 4X23D 5G49A 4KHAB 5DNMB 2ZY5A 1F66C 3AL0C 5AV5C 3O62D 4J8WB 5B31B 1M18C 5B40D 3C1BD 4AWLC 2Y2GA 3X1VA 2NQBD 3MGQB 3AZFB 5CPKB 1P3GD 4E45A 5GT0A 4KUDD 5B0YC 1S32A 4UPKA 4WNNA 3MGSB 3MNND 3R45B 5CP6D 2IO5B 4ZUXA 1KX3C 3WTPA 4JJNA 5CPJB 5B2JB 3LELA 1TZYD 3V9RB 5AVCD 3MVDA 3AZLD 1KX5C 1AOIB 5B0ZB 5B24C 4J8WD 4XZQB 5BO0A 4QLCA 5JRGB 5F99A 4H9SA 4NFTA 4LD9B 5E5AC 5DNND 3MGSD 4YS3D 4J8VC 3REHA 3RELC 1M1AC 4XUJB 3REKB 4KGCB 5BNVA 1H3OA 5CPJD 4Z66D 2F8NG 4EO5B 2NQBA 1BH9A 5GXQB 3UTBD 3LJAB 3REJB 1P3AA 2BG1A 1P3FA 3A6NC 2BYKA 2YFWA 3AFAA 5B0ZD 4WU8D 2HIOC 4Z5TB 3KWQB 3MGPB 3TU4B 5AV9C 4XZQD 3AZJD 3AZGA 3AZEA 2CV5C 1P34C 5CP6A 3W99A 5B1MB 4R8PD 3AZHC 2NZDC 5AVBD 3C1CB 3AYWB 2JCHA 3VH6W 3X1SA 3VH6A 3AZLA 1KX4B 3LZ0C 5CHLB 5CPIB 4NE5A 5DNMA 2DQNC 3MGRA 3O62C 1M19B 5B31A 4XUJD 3REKD 4KGCD 4YM6B 3AZKC 5GXQD 5B32B 3X1UB 3MGQA 3AZFA 5BS7C 5CPKA 1F66B 3LJAD 3AV2C 3REJD 1P3IB 4KUDC 4H9PB 3AZNA 4DRBA 1M18B 3MGSA 3MGPD 3AN2D 3TU4D 1P3PC 3W97B 3X1VB 5AV6C 3AYWD 5CPJA 5B2JA 1U35C 1ID3C 3UT9A 1AOIA 5AY8C 5B0ZA 3AV1A 1M19D 3WTPB 3B6GB 3WA9D 5JRGA 4YM6D 3LELB 3AZIA 2FJ7C 2PYOC 1P3KD 2F8NK 5B32D 3X1UD 1P3OC 2FFFB 2AROB 2RVQD 5AV8B 3WKJA 4LD9A 5DNNC 4YS3C 3REIC 4Z2MG 5GT3A 5F99B 3X1VD 4Z66C 3EPLA 5GT0D 4J8UB 2Y2JA 5C3IB 5GXQA 3UTBC 1S32D 3LJAA 4WU8C 2LY8A 2Y2KA 3VH5W 3VH5A 4Z5TA 4ZUXD 3KWQA 3MGPA 2F2AC 3WTPD 4J8XC 3TU4A 5BNVB 2J8PA 4JJND 5B1MA 3LELD 4NE3A 5AVBC 3MVDD 3C1CA 3AYWA 4WJ3C 2Y2IA 1P3AB 2AROD 2HIOB 2BYKB 3AFAB 1KX4A 5CPIA 4CSRB 4HGAB 4QLCD 3W99B 5F99D 1M19A 3W98A 4WU9A 3W96B 5GSUC 4YM6A 5B32A 1F66A 2ZM5A 1P3IA 4H9PA 1B6WA 3MGRB 3REHD 1ZLAB 1M18A 5B33C 3W97A 2CWEA 1P3MC 1P3AD 3VH6T 1P3FD 3AFAD 3AZNB 3B6FB 3LZ1C 3AZGD 3AZED 2G5HC 3W99D 4G92B 1KX3A 3WA9C 3B6GA 4M6BA 3X1TC 4G91C 3W96D 1HQ3C 3X1SD 1U35B 2HUEB 1P3BC 3UT9B 2AROA 5DNMD 3B0DC 5AV8A 5B24A 3MGRD 3AV1B 3KXBB 1JFIB 5B31D 3KUYB 2Y2HA 2PYOB 3AZIB 3MGQD 3EPJA 3UTAB 3AZFD 5CPKD 5GT0C 5E5AA 3WKJB 4J8UA 4UUZB 3AZND 1WWIA 4WV4B 3REIB 3B6FD 5GT3B 5B2IC 1M1AA 4JJNC 5B2JD 3NQJA 1EQZC 3UT9D 1AOID 2HIOA 4J8XB 4CSRA 5AV9A 3AV1D 5B1LB 1TAFB 3AZMC 2NZDA 4QLCC 3KUYD 5JRGD 3AZID 4H9NB 3W96A 3LZ0A 4DRAA 3WKJD 4LD9D 3WAAB 4X23C 5BT1D 1P3LB 1Q9CA 5GT3D 1ZLAA 3VH5T 2Y2QA 3W98B 5GSUB 2Y2MA 4WU9B 3AZKA 5B40C 3C1BC 3P5JB 1F1EA 2NQBC 5BS7A 1P3GC 5AV5B 1P3FC 3KFUG 5B33B 3B6FA 3MNNC 4Z5TD 3KWQD 4DQYB 1P3PA 3AZGC 4AWLB 5CP6C 5B1MD 2F8NA 3C1CD 2DF4C 1TZYC 5AVCC 5B0YB 3AZLC 1U35A 1KX4D 4WZSB 5CPID 5AY8A 3LZ1B 5DNMC 1P3LD 1KX3B 3KXBA 4J8WC 1JFIA 3W98D 5B31C 4WU9D 2FJ7A 3KUYA 2PYOA 1N1JB 1KX5B 5CPKC 4E44A 3UTAA 1F66D 5AV5D 1P3ID 4UUZA 5B24B 3MGSC 3REIA 1M18D 4H9OB 2IO5C 3W97D 5FUGA 5JA4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H9Q A;  5E5A B;  5CPJ C;  4J8V B;  5B2I B;  3REL B;  5B0Z C;  4J8X A;  1M1A B;  1KX3 D;  5B1L A;  1TAF A;  4XZQ C;  3AZJ C;  3B6G D;  5JRG C;  4R8P C;  1EQZ B;  3NQJ B;  4H9N A;  5BNX B;  3A6N B;  5B32 G;  5AV8 D;  4LD9 C;  3WAA A;  5B24 D;  5BT1 C;  5AV9 B;  2CV5 B;  1P34 B;  2NZD B;  1P3L A;  3AZH B;  4NE6 A;  5GSU A;  4XUJ C;  3NQU B;  3REK C;  4KGC C;  3LZ0 B;  5E5A D;  4X23 B;  4J8U D;  4EO5 C;  5GXQ C;  3LJA C;  5AV5 A;  4J8V D;  3REJ C;  3O62 B;  5B33 A;  3REL D;  5KDM A;  1M1A D;  4Z5T C;  5B40 B;  3MGP C;  3AN2 C;  3TU4 C;  3AZK B;  3B0B A;  3C1C C;  3AYW C;  3AV2 B;  4KUD B;  3A6N D;  5B0Y A;  2HIO D;  3LZ1 A;  5AV9 D;  2YFV B;  2CV5 D;  1P3P B;  2NZD D;  3B0C W;  3AZH D;  5AV6 B;  1M19 C;  3X1T A;  2F8N B;  1HQ3 A;  1TZY B;  4YM6 C;  3LZ0 D;  1N1J A;  1P3K C;  1ID3 B;  1KX5 A;  5B32 C;  5AY8 B;  3X1U C;  2RVQ C;  1P3I C;  1ZLA D;  3AZK D;  2FJ7 B;  4H9O A;  3W97 C;  1P3O B;  3X1V C;  5JA4 A;  3AV2 D;  5DNN B;  1S32 C;  4YS3 B;  4J8V A;  1P3P D;  5B2I A;  3REL A;  1BH8 B;  4ZUX C;  4H9R B;  5AV6 D;  3WTP C;  5FUG B;  3B6G C;  4Z66 B;  2F8N D;  4H9Q B;  2BYM B;  3LEL C;  3UTB B;  3MVD C;  1EQZ A;  1U35 D;  1ID3 D;  1A7W A;  5BNX A;  5AY8 D;  4WU8 B;  2ARO C;  5AV8 C;  3A6N A;  3AZM A;  3AZJ B;  3KXB D;  2CV5 A;  1P34 A;  4R8P B;  3AZH A;  2FJ7 D;  1HTA A;  5B31 G;  5AVB B;  5F99 C;  2PYO D;  4H9S C;  1P3O D;  3NQU A;  4CAY B;  3UTA D;  4J8U C;  4X23 A;  5C3I C;  3WTP E;  3REI D;  3O62 A;  3REH C;  5B40 A;  3C1B A;  1P3G A;  4Z2M H;  3AV2 A;  4KUD A;  1P3A C;  3AFA C;  3MNN A;  4J8X D;  5KDM B;  3AN2 B;  4ZBJ C;  2YFV A;  5B1L D;  3AZE C;  1WWS A;  1R4V A;  4HGA C;  3W99 C;  5AV6 A;  1P3M B;  1TZY A;  3W96 C;  5AVC A;  3X1S C;  1ID3 A;  4KHA A;  3WAA D;  4J8W A;  3MGR C;  1ZLA C;  3WA9 B;  3X1T B;  4G91 B;  5GSU D;  1HQ3 B;  1P3K B;  1BFM A;  1P3B B;  5G49 B;  1P3O A;  3B0D B;  3MGQ C;  3AZF C;  3KSY A;  5DNN A;  3AZN C;  5B33 D;  3B6F C;  4YS3 A;  1KU5 A;  3R45 A;  3B0C T;  4G92 C;  1BH8 A;  1B67 A;  4H9R A;  1P3M D;  5GT0 B;  4Z66 A;  3V9R A;  2BYM A;  5B2J C;  3UTB A;  1S32 B;  5B0Y D;  4WNN B;  2HUE C;  3UT9 C;  4WU8 A;  3LZ1 D;  1AOI C;  4ZUX B;  3AV1 C;  4XZQ A;  3KXB C;  3AZJ A;  3X1T D;  4JJN B;  4R8P A;  1HQ3 D;  3MVD B;  3KUY C;  5AVB A;  3AZI C;  1P3B D;  1KX5 D;  3UTA C;  3WKJ C;  4CAY A;  3AZM B;  5BO0 B;  4QLC B;  1ULY A;  5GT3 C;  4XUJ A;  3REK A;  4KGC A;  3REJ A;  3REH B;  5B2I D;  3AN2 A;  3KWQ C;  3C1B B;  1H3O B;  2JSS A;  5B1L C;  2NQB B;  1BH9 B;  5B1M C;  1P3G B;  1EQZ D;  1P3M A;  1P3F B;  2YFW B;  1KX4 C;  3WAA C;  4ZBJ B;  5CPI C;  3MNN B;  3AZM D;  3AZG B;  3AZE B;  1P34 D;  5CP6 B;  2F8N H;  1P3L C;  3WA9 A;  3W98 C;  3X1S B;  2L5A A;  4WU9 C;  3AZL B;  5AVC B;  1P3K A;  1P3B A;  3X1U A;  4X23 D;  5G49 A;  4KHA B;  5DNM B;  1F66 C;  5AV5 C;  3O62 D;  4J8W B;  5B31 B;  1M18 C;  5B40 D;  3C1B D;  4AWL C;  3X1V A;  2NQB D;  3MGQ B;  3AZF B;  5CPK B;  1P3G D;  4E45 A;  5GT0 A;  4KUD D;  5B0Y C;  1S32 A;  4WNN A;  3MGS B;  3MNN D;  3R45 B;  5CP6 D;  2IO5 B;  4ZUX A;  1KX3 C;  3WTP A;  4JJN A;  5CPJ B;  5B2J B;  3LEL A;  1TZY D;  3V9R B;  5AVC D;  3MVD A;  3AZL D;  1KX5 C;  1AOI B;  5B0Z B;  5B24 C;  4J8W D;  4XZQ B;  5BO0 A;  4QLC A;  5JRG B;  5F99 A;  4H9S A;  4NFT A;  4LD9 B;  5E5A C;  5DNN D;  3MGS D;  4YS3 D;  4J8V C;  3REH A;  3REL C;  1M1A C;  4XUJ B;  3REK B;  4KGC B;  5BNV A;  1H3O A;  5CPJ D;  4Z66 D;  2F8N G;  4EO5 B;  2NQB A;  1BH9 A;  5GXQ B;  3UTB D;  3LJA B;  3REJ B;  1P3A A;  1P3F A;  3A6N C;  2BYK A;  2YFW A;  3AFA A;  5B0Z D;  4WU8 D;  2HIO C;  4Z5T B;  3KWQ B;  3MGP B;  3TU4 B;  5AV9 C;  4XZQ D;  3AZJ D;  3AZG A;  3AZE A;  2CV5 C;  1P34 C;  5CP6 A;  3W99 A;  5B1M B;  4R8P D;  3AZH C;  2NZD C;  5AVB D;  3C1C B;  3AYW B;  3X1S A;  3VH6 W;  3VH6 A;  3AZL A;  1KX4 B;  3LZ0 C;  5CHL B;  5CPI B;  4NE5 A;  5DNM A;  3MGR A;  3O62 C;  1M19 B;  5B31 A;  4XUJ D;  3REK D;  4KGC D;  4YM6 B;  3AZK C;  5GXQ D;  5B32 B;  3X1U B;  3MGQ A;  3AZF A;  5BS7 C;  5CPK A;  1F66 B;  3LJA D;  3AV2 C;  3REJ D;  1P3I B;  4KUD C;  4H9P B;  3AZN A;  4DRB A;  1M18 B;  3MGS A;  3MGP D;  3AN2 D;  3TU4 D;  1P3P C;  3W97 B;  3X1V B;  5AV6 C;  3AYW D;  5CPJ A;  5B2J A;  1U35 C;  1ID3 C;  3UT9 A;  1AOI A;  5AY8 C;  5B0Z A;  3AV1 A;  1M19 D;  3WTP B;  3B6G B;  3WA9 D;  5JRG A;  4YM6 D;  3LEL B;  3AZI A;  2FJ7 C;  2PYO C;  1P3K D;  2F8N K;  5B32 D;  3X1U D;  1P3O C;  2RVQ D;  2ARO B;  5AV8 B;  3WKJ A;  4LD9 A;  5DNN C;  4YS3 C;  3REI C;  4Z2M G;  5GT3 A;  5F99 B;  3X1V D;  4Z66 C;  5GT0 D;  4J8U B;  5C3I B;  5GXQ A;  3UTB C;  1S32 D;  3LJA A;  4WU8 C;  2LY8 A;  3VH5 W;  3VH5 A;  4Z5T A;  4ZUX D;  3KWQ A;  3MGP A;  3WTP D;  4J8X C;  3TU4 A;  5BNV B;  4JJN D;  5B1M A;  3LEL D;  4NE3 A;  5AVB C;  3MVD D;  3C1C A;  3AYW A;  1P3A B;  2ARO D;  2HIO B;  2BYK B;  3AFA B;  1KX4 A;  5CPI A;  4CSR B;  4HGA B;  4QLC D;  3W99 B;  5F99 D;  1M19 A;  3W98 A;  4WU9 A;  3W96 B;  5GSU C;  4YM6 A;  5B32 A;  1F66 A;  1P3I A;  4H9P A;  1B6W A;  3MGR B;  3REH D;  1ZLA B;  1M18 A;  5B33 C;  3W97 A;  2CWE A;  1P3M C;  1P3A D;  3VH6 T;  1P3F D;  3AFA D;  3AZN B;  3B6F B;  3LZ1 C;  3AZG D;  3AZE D;  4G92 B;  3W99 D;  1KX3 A;  3WA9 C;  3B6G A;  4M6B A;  3X1T C;  4G91 C;  3W96 D;  1HQ3 C;  3X1S D;  1U35 B;  2HUE B;  1P3B C;  3UT9 B;  2ARO A;  5DNM D;  3B0D C;  5AV8 A;  5B24 A;  3MGR D;  3AV1 B;  3KXB B;  1JFI B;  5B31 D;  3KUY B;  2PYO B;  3AZI B;  3MGQ D;  3AZF D;  3UTA B;  5CPK D;  3WKJ B;  5GT0 C;  5E5A A;  4J8U A;  4UUZ B;  3AZN D;  1WWI A;  4WV4 B;  3REI B;  3B6F D;  5GT3 B;  5B2I C;  1M1A A;  4JJN C;  5B2J D;  3NQJ A;  1EQZ C;  3UT9 D;  1AOI D;  2HIO A;  4J8X B;  4CSR A;  5AV9 A;  3AV1 D;  5B1L B;  1TAF B;  3AZM C;  2NZD A;  4QLC C;  3KUY D;  5JRG D;  3AZI D;  4H9N B;  3W96 A;  3LZ0 A;  4DRA A;  3WKJ D;  4LD9 D;  3WAA B;  4X23 C;  5BT1 D;  1P3L B;  1Q9C A;  5GT3 D;  1ZLA A;  3VH5 T;  3W98 B;  5GSU B;  4WU9 B;  3AZK A;  5B40 C;  3C1B C;  1F1E A;  2NQB C;  5BS7 A;  1P3G C;  5AV5 B;  1P3F C;  5B33 B;  3B6F A;  3MNN C;  4Z5T D;  3KWQ D;  1P3P A;  3AZG C;  4AWL B;  5CP6 C;  5B1M D;  2F8N A;  3C1C D;  1TZY C;  5AVC C;  5B0Y B;  3AZL C;  1U35 A;  1KX4 D;  4WZS B;  5CPI D;  5AY8 A;  3LZ1 B;  5DNM C;  1P3L D;  1KX3 B;  3KXB A;  4J8W C;  1JFI A;  3W98 D;  5B31 C;  4WU9 D;  2FJ7 A;  3KUY A;  2PYO A;  1N1J B;  1KX5 B;  5CPK C;  4E44 A;  3UTA A;  1F66 D;  5AV5 D;  1P3I D;  4UUZ A;  5B24 B;  3MGS C;  3REI A;  1M18 D;  4H9O B;  2IO5 C;  3W97 D;  5FUG A;  5JA4 B; 
#chains in the Genus database with same CATH topology
 4H9Q A;  5E5A B;  5CPJ C;  3EG5 B;  4J8V B;  2ZY4 A;  5B2I B;  3REL B;  5B0Z C;  4J8X A;  1M1A B;  1KX3 D;  5B1L A;  1PZR A;  1TAF A;  4XZQ C;  3AZJ C;  3B6G D;  1Z2C B;  5JRG C;  4R8P C;  1EQZ B;  3NQJ B;  4H9N A;  5BNX B;  3A6N B;  5B32 G;  5AV8 D;  4LD9 C;  3WAA A;  5B24 D;  5BT1 C;  5AV9 B;  2CV5 B;  1P34 B;  2NZD B;  1P3L A;  2ZY3 A;  3AZH B;  2G5I C;  4NE6 A;  5GSU A;  4XUJ C;  3NQU B;  3REK C;  4KGC C;  3LZ0 B;  3H0L C;  5E5A D;  4X23 B;  4J8U D;  4EO5 C;  5GXQ C;  2Y2N A;  5AV5 A;  3LJA C;  4J8V D;  3REJ C;  3O62 B;  5B33 A;  3REL D;  5KDM A;  1M1A D;  4Z5T C;  5B40 B;  3MGP C;  3AN2 C;  3TU4 C;  3AZK B;  3B0B A;  3C1C C;  3AYW C;  3AV2 B;  4KUD B;  3A6N D;  2Y2P A;  5B0Y A;  2HIO D;  3LZ1 A;  5AV9 D;  2YFV B;  2CV5 D;  1P3P B;  2NZD D;  3B0C W;  3AZH D;  5AV6 B;  1M19 C;  3X1T A;  2F8N B;  1HQ3 A;  1TZY B;  4YM6 C;  3LZ0 D;  1N1J A;  2W8S A;  1P3K C;  1ID3 B;  1KX5 A;  5B32 C;  5AY8 B;  3X1U C;  2RVQ C;  1P3I C;  1ZLA D;  3AZK D;  2FJ7 B;  4H9O A;  3W97 C;  1P3O B;  3X1V C;  5JA4 A;  3AV2 D;  3H0M C;  5DNN B;  1S32 C;  2Y2L A;  4YS3 B;  4J8V A;  1P3P D;  5B2I A;  3REL A;  1BH8 B;  4ZUX C;  4H9R B;  5AV6 D;  3WTP C;  5FUG B;  3B6G C;  4Z66 B;  2F8N D;  4H9Q B;  2BYM B;  3LEL C;  3UTB B;  3MVD C;  1EQZ A;  1U35 D;  1ID3 D;  1A7W A;  5BNX A;  5AY8 D;  4WU8 B;  2ARO C;  5AV8 C;  3A6N A;  2VQR A;  3AZM A;  3AZJ B;  3KXB D;  2CV5 A;  1P34 A;  4R8P B;  3AZH A;  2FJ7 D;  1HTA A;  2ZY2 A;  5B31 G;  5AVB B;  5F99 C;  2PYO D;  4H9S C;  1P3O D;  3NQU A;  4CAY B;  3UTA D;  2RIQ A;  4J8U C;  4X23 A;  2XD5 A;  5C3I C;  3WTP E;  1T3U A;  3REI D;  3F6T A;  3O62 A;  3REH C;  1W2E A;  2JE5 A;  5B40 A;  3C1B A;  1P3G A;  4Z2M H;  3AV2 A;  4KUD A;  1P3A C;  3AFA C;  3MNN A;  4J8X D;  5KDM B;  2UWX A;  3AN2 B;  3FDD A;  4ZBJ C;  2YFV A;  5B1L D;  3AZE C;  1WWS A;  1R4V A;  4HGA C;  3W99 C;  3EPK A;  5AV6 A;  1P3M B;  1TZY A;  3W96 C;  5AVC A;  3X1S C;  1ID3 A;  4KHA A;  3WAA D;  4J8W A;  3MGR C;  1ZLA C;  3WA9 B;  3X1T B;  4G91 B;  5GSU D;  1HQ3 B;  1P3K B;  1BFM A;  1P3B B;  5G49 B;  1P3O A;  3B0D B;  3MGQ C;  3AZF C;  3KSY A;  5DNN A;  3AZN C;  5B33 D;  3B6F C;  4YS3 A;  1KU5 A;  3R45 A;  3IP4 C;  3B0C T;  4G92 C;  1BH8 A;  1B67 A;  4H9R A;  1P3M D;  5GT0 B;  4Z66 A;  3V9R A;  2BYM A;  5B2J C;  3UTB A;  1S32 B;  5B0Y D;  4WNN B;  2Y2O A;  2HUE C;  3UT9 C;  4WU8 A;  3LZ1 D;  1AOI C;  2XD1 A;  4ZUX B;  3A1K A;  4XZQ A;  3KXB C;  3AZJ A;  3AV1 C;  3X1T D;  4JJN B;  4R8P A;  1HQ3 D;  3MVD B;  3KUY C;  5AVB A;  3AZI C;  1P3B D;  1KX5 D;  3UTA C;  3WKJ C;  4CAY A;  3AZM B;  5BO0 B;  4QLC B;  1ULY A;  5GT3 C;  4XUJ A;  3REK A;  4KGC A;  3REJ A;  3REH B;  5B2I D;  3AN2 A;  3KWQ C;  3C1B B;  1H3O B;  2JSS A;  5B1L C;  2NQB B;  1BH9 B;  5B1M C;  1P3G B;  3EPH A;  3H0R C;  1EQZ D;  1P3M A;  1P3F B;  2YFW B;  1KX4 C;  5CPI C;  3WAA C;  4ZBJ B;  3MNN B;  3AZM D;  3AZG B;  3AZE B;  1P34 D;  5CP6 B;  2F8N H;  1P3L C;  3A1I A;  3WA9 A;  3W98 C;  3X1S B;  2L5A A;  4WU9 C;  3AZL B;  5AVC B;  1P3K A;  1P3B A;  3X1U A;  4X23 D;  5G49 A;  4KHA B;  5DNM B;  2ZY5 A;  1F66 C;  3AL0 C;  5AV5 C;  3O62 D;  4J8W B;  5B31 B;  1M18 C;  5B40 D;  3C1B D;  4AWL C;  2Y2G A;  3X1V A;  2NQB D;  3MGQ B;  3AZF B;  5CPK B;  1P3G D;  4E45 A;  5GT0 A;  4KUD D;  5B0Y C;  1S32 A;  4UPK A;  4WNN A;  3MGS B;  3MNN D;  3R45 B;  5CP6 D;  2IO5 B;  4ZUX A;  1KX3 C;  3WTP A;  4JJN A;  5CPJ B;  5B2J B;  3LEL A;  1TZY D;  3V9R B;  5AVC D;  3MVD A;  3AZL D;  1KX5 C;  1AOI B;  5B0Z B;  5B24 C;  4J8W D;  4XZQ B;  5BO0 A;  4QLC A;  5JRG B;  5F99 A;  4H9S A;  4NFT A;  4LD9 B;  5E5A C;  5DNN D;  3MGS D;  4YS3 D;  4J8V C;  3REH A;  3REL C;  1M1A C;  4XUJ B;  3REK B;  4KGC B;  5BNV A;  1H3O A;  5CPJ D;  4Z66 D;  2F8N G;  4EO5 B;  2NQB A;  1BH9 A;  5GXQ B;  3UTB D;  3LJA B;  3REJ B;  1P3A A;  2BG1 A;  1P3F A;  3A6N C;  2BYK A;  2YFW A;  3AFA A;  5B0Z D;  4WU8 D;  2HIO C;  4Z5T B;  3KWQ B;  3MGP B;  3TU4 B;  5AV9 C;  4XZQ D;  3AZJ D;  3AZG A;  3AZE A;  2CV5 C;  1P34 C;  5CP6 A;  3W99 A;  5B1M B;  4R8P D;  3AZH C;  2NZD C;  5AVB D;  3C1C B;  3AYW B;  2JCH A;  3VH6 W;  3X1S A;  3VH6 A;  3AZL A;  1KX4 B;  3LZ0 C;  5CHL B;  5CPI B;  4NE5 A;  5DNM A;  2DQN C;  3MGR A;  3O62 C;  1M19 B;  5B31 A;  4XUJ D;  3REK D;  4KGC D;  4YM6 B;  3AZK C;  5GXQ D;  5B32 B;  3X1U B;  3MGQ A;  3AZF A;  5BS7 C;  5CPK A;  1F66 B;  3LJA D;  3AV2 C;  3REJ D;  1P3I B;  4KUD C;  4H9P B;  3AZN A;  4DRB A;  1M18 B;  3MGS A;  3MGP D;  3AN2 D;  3TU4 D;  1P3P C;  3W97 B;  3X1V B;  5AV6 C;  3AYW D;  5CPJ A;  5B2J A;  1U35 C;  1ID3 C;  3UT9 A;  1AOI A;  5AY8 C;  5B0Z A;  3AV1 A;  1M19 D;  3WTP B;  3B6G B;  3WA9 D;  5JRG A;  4YM6 D;  3LEL B;  3AZI A;  2FJ7 C;  2PYO C;  1P3K D;  2F8N K;  5B32 D;  3X1U D;  1P3O C;  2FFF B;  2ARO B;  2RVQ D;  5AV8 B;  3WKJ A;  4LD9 A;  5DNN C;  4YS3 C;  3REI C;  4Z2M G;  5GT3 A;  5F99 B;  3X1V D;  4Z66 C;  3EPL A;  5GT0 D;  4J8U B;  2Y2J A;  5C3I B;  5GXQ A;  3UTB C;  1S32 D;  3LJA A;  4WU8 C;  2LY8 A;  2Y2K A;  3VH5 W;  3VH5 A;  4Z5T A;  4ZUX D;  3KWQ A;  3MGP A;  2F2A C;  3WTP D;  4J8X C;  3TU4 A;  5BNV B;  2J8P A;  4JJN D;  5B1M A;  3LEL D;  4NE3 A;  5AVB C;  3MVD D;  3C1C A;  3AYW A;  4WJ3 C;  2Y2I A;  1P3A B;  2ARO D;  2HIO B;  2BYK B;  3AFA B;  1KX4 A;  5CPI A;  4CSR B;  4HGA B;  4QLC D;  3W99 B;  5F99 D;  1M19 A;  3W98 A;  4WU9 A;  3W96 B;  5GSU C;  4YM6 A;  5B32 A;  1F66 A;  2ZM5 A;  1P3I A;  4H9P A;  1B6W A;  3MGR B;  3REH D;  1ZLA B;  1M18 A;  5B33 C;  3W97 A;  2CWE A;  1P3M C;  1P3A D;  3VH6 T;  1P3F D;  3AFA D;  3AZN B;  3B6F B;  3LZ1 C;  3AZG D;  3AZE D;  2G5H C;  3W99 D;  4G92 B;  1KX3 A;  3WA9 C;  3B6G A;  4M6B A;  3X1T C;  4G91 C;  3W96 D;  1HQ3 C;  3X1S D;  1U35 B;  2HUE B;  1P3B C;  3UT9 B;  2ARO A;  5DNM D;  3B0D C;  5AV8 A;  5B24 A;  3MGR D;  3AV1 B;  3KXB B;  1JFI B;  5B31 D;  3KUY B;  2Y2H A;  2PYO B;  3AZI B;  3MGQ D;  3EPJ A;  3UTA B;  3AZF D;  5CPK D;  5GT0 C;  5E5A A;  3WKJ B;  4J8U A;  4UUZ B;  3AZN D;  1WWI A;  4WV4 B;  3REI B;  3B6F D;  5GT3 B;  5B2I C;  1M1A A;  4JJN C;  5B2J D;  3NQJ A;  1EQZ C;  3UT9 D;  1AOI D;  2HIO A;  4J8X B;  4CSR A;  5AV9 A;  3AV1 D;  5B1L B;  1TAF B;  3AZM C;  2NZD A;  4QLC C;  3KUY D;  5JRG D;  3AZI D;  4H9N B;  3W96 A;  3LZ0 A;  4DRA A;  3WKJ D;  4LD9 D;  3WAA B;  4X23 C;  5BT1 D;  1P3L B;  1Q9C A;  5GT3 D;  1ZLA A;  3VH5 T;  2Y2Q A;  3W98 B;  5GSU B;  2Y2M A;  4WU9 B;  3AZK A;  5B40 C;  3C1B C;  3P5J B;  1F1E A;  2NQB C;  5BS7 A;  1P3G C;  5AV5 B;  1P3F C;  3KFU G;  5B33 B;  3B6F A;  3MNN C;  4Z5T D;  3KWQ D;  4DQY B;  1P3P A;  3AZG C;  4AWL B;  5CP6 C;  5B1M D;  2F8N A;  3C1C D;  2DF4 C;  1TZY C;  5AVC C;  5B0Y B;  3AZL C;  1U35 A;  1KX4 D;  4WZS B;  5CPI D;  5AY8 A;  3LZ1 B;  5DNM C;  1P3L D;  1KX3 B;  3KXB A;  4J8W C;  1JFI A;  3W98 D;  5B31 C;  4WU9 D;  2FJ7 A;  3KUY A;  2PYO A;  1N1J B;  1KX5 B;  5CPK C;  4E44 A;  3UTA A;  1F66 D;  5AV5 D;  1P3I D;  4UUZ A;  5B24 B;  3MGS C;  3REI A;  1M18 D;  4H9O B;  2IO5 C;  3W97 D;  5FUG A;  5JA4 B; 
#chains in the Genus database with same CATH homology
 4H9Q A;  5E5A B;  5CPJ C;  3EG5 B;  4J8V B;  2ZY4 A;  5B2I B;  3REL B;  5B0Z C;  4J8X A;  1M1A B;  1KX3 D;  5B1L A;  1PZR A;  1TAF A;  4XZQ C;  3AZJ C;  3B6G D;  1Z2C B;  5JRG C;  4R8P C;  1EQZ B;  3NQJ B;  4H9N A;  5BNX B;  3A6N B;  5B32 G;  5AV8 D;  4LD9 C;  3WAA A;  5B24 D;  5BT1 C;  5AV9 B;  2CV5 B;  1P34 B;  2NZD B;  1P3L A;  2ZY3 A;  3AZH B;  2G5I C;  4NE6 A;  5GSU A;  4XUJ C;  3NQU B;  3REK C;  4KGC C;  3LZ0 B;  3H0L C;  5E5A D;  4X23 B;  4J8U D;  4EO5 C;  5GXQ C;  2Y2N A;  5AV5 A;  3LJA C;  4J8V D;  3REJ C;  3O62 B;  5B33 A;  3REL D;  5KDM A;  1M1A D;  4Z5T C;  5B40 B;  3MGP C;  3AN2 C;  3TU4 C;  3AZK B;  3B0B A;  3C1C C;  3AYW C;  3AV2 B;  4KUD B;  3A6N D;  2Y2P A;  5B0Y A;  2HIO D;  3LZ1 A;  5AV9 D;  2YFV B;  2CV5 D;  1P3P B;  2NZD D;  3B0C W;  3AZH D;  5AV6 B;  1M19 C;  3X1T A;  2F8N B;  1HQ3 A;  1TZY B;  4YM6 C;  3LZ0 D;  1N1J A;  2W8S A;  1P3K C;  1ID3 B;  1KX5 A;  5B32 C;  5AY8 B;  3X1U C;  2RVQ C;  1P3I C;  1ZLA D;  3AZK D;  2FJ7 B;  4H9O A;  3W97 C;  1P3O B;  3X1V C;  5JA4 A;  3AV2 D;  3H0M C;  5DNN B;  1S32 C;  2Y2L A;  4YS3 B;  4J8V A;  1P3P D;  5B2I A;  3REL A;  1BH8 B;  4ZUX C;  4H9R B;  5AV6 D;  3WTP C;  5FUG B;  3B6G C;  4Z66 B;  2F8N D;  4H9Q B;  2BYM B;  3LEL C;  3UTB B;  3MVD C;  1EQZ A;  1U35 D;  1ID3 D;  1A7W A;  5BNX A;  5AY8 D;  4WU8 B;  2ARO C;  5AV8 C;  3A6N A;  2VQR A;  3AZM A;  3AZJ B;  3KXB D;  2CV5 A;  1P34 A;  4R8P B;  3AZH A;  2FJ7 D;  1HTA A;  2ZY2 A;  5B31 G;  5AVB B;  5F99 C;  2PYO D;  4H9S C;  1P3O D;  3NQU A;  4CAY B;  3UTA D;  2RIQ A;  4J8U C;  4X23 A;  2XD5 A;  5C3I C;  3WTP E;  1T3U A;  3REI D;  3F6T A;  3O62 A;  3REH C;  1W2E A;  2JE5 A;  5B40 A;  3C1B A;  1P3G A;  4Z2M H;  3AV2 A;  4KUD A;  1P3A C;  3AFA C;  3MNN A;  4J8X D;  5KDM B;  2UWX A;  3AN2 B;  3FDD A;  4ZBJ C;  2YFV A;  5B1L D;  3AZE C;  1WWS A;  1R4V A;  4HGA C;  3W99 C;  3EPK A;  5AV6 A;  1P3M B;  1TZY A;  3W96 C;  5AVC A;  3X1S C;  1ID3 A;  4KHA A;  3WAA D;  4J8W A;  3MGR C;  1ZLA C;  3WA9 B;  3X1T B;  4G91 B;  5GSU D;  1HQ3 B;  1P3K B;  1BFM A;  1P3B B;  5G49 B;  1P3O A;  3B0D B;  3MGQ C;  3AZF C;  3KSY A;  5DNN A;  3AZN C;  5B33 D;  3B6F C;  4YS3 A;  1KU5 A;  3R45 A;  3IP4 C;  3B0C T;  4G92 C;  1BH8 A;  1B67 A;  4H9R A;  1P3M D;  5GT0 B;  4Z66 A;  3V9R A;  2BYM A;  5B2J C;  3UTB A;  1S32 B;  5B0Y D;  4WNN B;  2Y2O A;  2HUE C;  3UT9 C;  4WU8 A;  3LZ1 D;  1AOI C;  2XD1 A;  4ZUX B;  3A1K A;  4XZQ A;  3KXB C;  3AZJ A;  3AV1 C;  3X1T D;  4JJN B;  4R8P A;  1HQ3 D;  3MVD B;  3KUY C;  5AVB A;  3AZI C;  1P3B D;  1KX5 D;  3UTA C;  3WKJ C;  4CAY A;  3AZM B;  5BO0 B;  4QLC B;  1ULY A;  5GT3 C;  4XUJ A;  3REK A;  4KGC A;  3REJ A;  3REH B;  5B2I D;  3AN2 A;  3KWQ C;  3C1B B;  1H3O B;  2JSS A;  5B1L C;  2NQB B;  1BH9 B;  5B1M C;  1P3G B;  3EPH A;  3H0R C;  1EQZ D;  1P3M A;  1P3F B;  2YFW B;  1KX4 C;  5CPI C;  3WAA C;  4ZBJ B;  3MNN B;  3AZM D;  3AZG B;  3AZE B;  1P34 D;  5CP6 B;  2F8N H;  1P3L C;  3A1I A;  3WA9 A;  3W98 C;  3X1S B;  2L5A A;  4WU9 C;  3AZL B;  5AVC B;  1P3K A;  1P3B A;  3X1U A;  4X23 D;  5G49 A;  4KHA B;  5DNM B;  2ZY5 A;  1F66 C;  3AL0 C;  5AV5 C;  3O62 D;  4J8W B;  5B31 B;  1M18 C;  5B40 D;  3C1B D;  4AWL C;  2Y2G A;  3X1V A;  2NQB D;  3MGQ B;  3AZF B;  5CPK B;  1P3G D;  4E45 A;  5GT0 A;  4KUD D;  5B0Y C;  1S32 A;  4UPK A;  4WNN A;  3MGS B;  3MNN D;  3R45 B;  5CP6 D;  2IO5 B;  4ZUX A;  1KX3 C;  3WTP A;  4JJN A;  5CPJ B;  5B2J B;  3LEL A;  1TZY D;  3V9R B;  5AVC D;  3MVD A;  3AZL D;  1KX5 C;  1AOI B;  5B0Z B;  5B24 C;  4J8W D;  4XZQ B;  5BO0 A;  4QLC A;  5JRG B;  5F99 A;  4H9S A;  4NFT A;  4LD9 B;  5E5A C;  5DNN D;  3MGS D;  4YS3 D;  4J8V C;  3REH A;  3REL C;  1M1A C;  4XUJ B;  3REK B;  4KGC B;  5BNV A;  1H3O A;  5CPJ D;  4Z66 D;  2F8N G;  4EO5 B;  2NQB A;  1BH9 A;  5GXQ B;  3UTB D;  3LJA B;  3REJ B;  1P3A A;  2BG1 A;  1P3F A;  3A6N C;  2BYK A;  2YFW A;  3AFA A;  5B0Z D;  4WU8 D;  2HIO C;  4Z5T B;  3KWQ B;  3MGP B;  3TU4 B;  5AV9 C;  4XZQ D;  3AZJ D;  3AZG A;  3AZE A;  2CV5 C;  1P34 C;  5CP6 A;  3W99 A;  5B1M B;  4R8P D;  3AZH C;  2NZD C;  5AVB D;  3C1C B;  3AYW B;  2JCH A;  3VH6 W;  3X1S A;  3VH6 A;  3AZL A;  1KX4 B;  3LZ0 C;  5CHL B;  5CPI B;  4NE5 A;  5DNM A;  2DQN C;  3MGR A;  3O62 C;  1M19 B;  5B31 A;  4XUJ D;  3REK D;  4KGC D;  4YM6 B;  3AZK C;  5GXQ D;  5B32 B;  3X1U B;  3MGQ A;  3AZF A;  5BS7 C;  5CPK A;  1F66 B;  3LJA D;  3AV2 C;  3REJ D;  1P3I B;  4KUD C;  4H9P B;  3AZN A;  4DRB A;  1M18 B;  3MGS A;  3MGP D;  3AN2 D;  3TU4 D;  1P3P C;  3W97 B;  3X1V B;  5AV6 C;  3AYW D;  5CPJ A;  5B2J A;  1U35 C;  1ID3 C;  3UT9 A;  1AOI A;  5AY8 C;  5B0Z A;  3AV1 A;  1M19 D;  3WTP B;  3B6G B;  3WA9 D;  5JRG A;  4YM6 D;  3LEL B;  3AZI A;  2FJ7 C;  2PYO C;  1P3K D;  2F8N K;  5B32 D;  3X1U D;  1P3O C;  2FFF B;  2ARO B;  2RVQ D;  5AV8 B;  3WKJ A;  4LD9 A;  5DNN C;  4YS3 C;  3REI C;  4Z2M G;  5GT3 A;  5F99 B;  3X1V D;  4Z66 C;  3EPL A;  5GT0 D;  4J8U B;  2Y2J A;  5C3I B;  5GXQ A;  3UTB C;  1S32 D;  3LJA A;  4WU8 C;  2LY8 A;  2Y2K A;  3VH5 W;  3VH5 A;  4Z5T A;  4ZUX D;  3KWQ A;  3MGP A;  2F2A C;  3WTP D;  4J8X C;  3TU4 A;  5BNV B;  2J8P A;  4JJN D;  5B1M A;  3LEL D;  4NE3 A;  5AVB C;  3MVD D;  3C1C A;  3AYW A;  4WJ3 C;  2Y2I A;  1P3A B;  2ARO D;  2HIO B;  2BYK B;  3AFA B;  1KX4 A;  5CPI A;  4CSR B;  4HGA B;  4QLC D;  3W99 B;  5F99 D;  1M19 A;  3W98 A;  4WU9 A;  3W96 B;  5GSU C;  4YM6 A;  5B32 A;  1F66 A;  2ZM5 A;  1P3I A;  4H9P A;  1B6W A;  3MGR B;  3REH D;  1ZLA B;  1M18 A;  5B33 C;  3W97 A;  2CWE A;  1P3M C;  1P3A D;  3VH6 T;  1P3F D;  3AFA D;  3AZN B;  3B6F B;  3LZ1 C;  3AZG D;  3AZE D;  2G5H C;  3W99 D;  4G92 B;  1KX3 A;  3WA9 C;  3B6G A;  4M6B A;  3X1T C;  4G91 C;  3W96 D;  1HQ3 C;  3X1S D;  1U35 B;  2HUE B;  1P3B C;  3UT9 B;  2ARO A;  5DNM D;  3B0D C;  5AV8 A;  5B24 A;  3MGR D;  3AV1 B;  3KXB B;  1JFI B;  5B31 D;  3KUY B;  2Y2H A;  2PYO B;  3AZI B;  3MGQ D;  3EPJ A;  3UTA B;  3AZF D;  5CPK D;  5GT0 C;  5E5A A;  3WKJ B;  4J8U A;  4UUZ B;  3AZN D;  1WWI A;  4WV4 B;  3REI B;  3B6F D;  5GT3 B;  5B2I C;  1M1A A;  4JJN C;  5B2J D;  3NQJ A;  1EQZ C;  3UT9 D;  1AOI D;  2HIO A;  4J8X B;  4CSR A;  5AV9 A;  3AV1 D;  5B1L B;  1TAF B;  3AZM C;  2NZD A;  4QLC C;  3KUY D;  5JRG D;  3AZI D;  4H9N B;  3W96 A;  3LZ0 A;  4DRA A;  3WKJ D;  4LD9 D;  3WAA B;  4X23 C;  5BT1 D;  1P3L B;  1Q9C A;  5GT3 D;  1ZLA A;  3VH5 T;  2Y2Q A;  3W98 B;  5GSU B;  2Y2M A;  4WU9 B;  3AZK A;  5B40 C;  3C1B C;  3P5J B;  1F1E A;  2NQB C;  5BS7 A;  1P3G C;  5AV5 B;  1P3F C;  3KFU G;  5B33 B;  3B6F A;  3MNN C;  4Z5T D;  3KWQ D;  4DQY B;  1P3P A;  3AZG C;  4AWL B;  5CP6 C;  5B1M D;  2F8N A;  3C1C D;  2DF4 C;  1TZY C;  5AVC C;  5B0Y B;  3AZL C;  1U35 A;  1KX4 D;  4WZS B;  5CPI D;  5AY8 A;  3LZ1 B;  5DNM C;  1P3L D;  1KX3 B;  3KXB A;  4J8W C;  1JFI A;  3W98 D;  5B31 C;  4WU9 D;  2FJ7 A;  3KUY A;  2PYO A;  1N1J B;  1KX5 B;  5CPK C;  4E44 A;  3UTA A;  1F66 D;  5AV5 D;  1P3I D;  4UUZ A;  5B24 B;  3MGS C;  3REI A;  1M18 D;  4H9O B;  2IO5 C;  3W97 D;  5FUG A;  5JA4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...