3B6FB

Nucleosome core particle treated with cisplatin
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
79
structure length
79
Chain Sequence
DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords 147-MER DNA
publication title Site selectivity of platinum anticancer therapeutics
pubmed doi rcsb
source organism Homo sapiens
total genus 21
structure length 79
sequence length 79
chains with identical sequence F
ec nomenclature
pdb deposition date 2007-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3b6fB00
3KUYD 4ZUXB 3A6ND 4XUJC 3MGSD 3REKB 2FJ7C 1AOIB 5B40C 3MNNA 5DNNB 3AZMB 5KDMA 5B31C 3O62A 3X1UB 3WA9A 3AZID 1HQ3B 3AFAB 3UTBA 1F66A 5BS7C 3UT9D 5B24D 5B2JD 1P34A 5BNVB 3AZGA 1TAFA 2CV5B 2CWEA 5B1LC 3AYWD 5GSUC 4NE3A 4R8PB 3AZJC 2FJ7D 5B40D 5GXQB 1KX4B 1BH8A 5FUGA 1TZYC 4QLCC 3LZ1A 2NZDC 4YS3B 4DRBA 3WTPE 2L5AA 3A6NA 3MGSA 3KUYA 5CPKD 3LZ0C 3MGPC 3W98B 4KUDB 3AZIA 5E5AB 5GSUD 5AV5B 3KXBC 3UTAB 1M19D 3UT9A 5JA4A 4WU8B 5B24A 4KHAB 4X23C 3C1BC 1ID3C 3AZJD 5B2JA 5CPJD 1P3AC 3W96B 3R45A 4QLCD 3AYWA 2YFWB 4Z2MH 2NZDD 5B32C 1ZLAC 1HTAA 4HGAC 5B1MB 4Z66B 4J8XC 3REHB 3V9RA 4J8WC 3VH5T 5JRGC 2FJ7A 5B40A 3B6FC 3LZ0D 4J8UB 3WAAB 1F1EA 3KXBD 3AZEB 5BS7A 2YFVB 4XZQC 1H3OA 3AN2B 1R4VA 2HIOB 3X1SB 3WTPC 4X23D 3C1BD 5CPKA 1ID3D 4ZBJB 4WU9B 1P3BD 4YM6B 3MNNC 5GSUA 4CSRB 4WZSB 3O62C 1ZLAD 3WA9C 4J8XD 1M19A 3W97B 3UTBC 3LELB 5JRGD 3AZJA 3AV1B 4H9RB 5CPJA 1EQZC 3B6FD 5CP6C 3AZLB 4QLCA 1WWIA 1M18C 2NZDA 2NQBC 3LJAB 2F8NK 3MGRB 1WWSA 3B0BA 3WTPD 3AZFB 3LZ0A 5GT3D 4J8VD 4NFTA 3VH6W 5B0ZB 3KXBA 2F8ND 3TU4C 5GT0B 5AV6B 5G49A 1P3FB 3LZ1C 1P3GB 1M1AD 3C1BA 1P3OC 4X23A 1ID3A 4KGCB 3B6GD 5B33D 1EQZD 5CP6D 5CPIB 4CAYA 2PYOD 1P3BA 4Z5TB 2HUEB 4UUZB 1M18D 2NQBD 1ZLAA 1P34B 4J8XA 1P3KD 5AVBB 4LD9B 3MVDD 5JRGA 3B6FA 3UT9C 5B24C 3REJB 3C1CC 3AZKB 3TU4D 1KX3B 1P3IB 3X1VB 5AY8B 1P3MB 5AV8B 3REKC 3WTPA 1P3OD 1AOIC 4M6BA 2F8NH 4G91B 5GT3A 4J8VA 2BYMA 3VH5W 3X1UC 4Z2MG 5AV9D 3AFAC 2F8NA 4H9PB 5B31G 1BH9B 4NE6A 1M1AA 2BYKB 3NQUA 3AZNB 3B6GA 1N1JA 5B33A 3RELB 1EQZA 5CP6A 4JJNB 4E44A 2PYOA 2AROB 5BNXB 5DNMD 3C1CD 5CPKC 1M18A 2NQBA 3W99D 1P3KA 4ZUXD 4R8PC 1ULYA 3MVDA 3REKD 1AOID 1M19C 1KX4C 4WNNB 3VH6T 5DNND 3AZMD 5CPJC 3X1UD 4XUJB 1HQ3D 3NQJB 3AFAD 3TU4A 5AVCB 4YS3C 5BO0A 1B6WA 5B31B 1P3OA 1S32B 2CV5D 4KUDC 2JSSA 5AV9A 3KWQB 3UTAC 1P3PB 4WU8C 4H9QB 4R8PD 3AZHB 5B1LB 4H9OB 5GXQD 1KX4D 3W96C 3AV2B 3C1CA 5DNMA 1B67A 3W99A 1P3BC 3WKJB 4YS3D 5C3IC 4ZUXA 1TZYB 4H9NB 5B32G 3REKA 1AOIA 3VH5A 5DNNA 3AZMA 2IO5C 3W98D 4KUDD 3X1UA 1HQ3A 5E5AD 3AFAA 1KX5B 5AV5D 3AZEC 3UTAD 3AN2C 4WU8D 3MGPB 4DRAA 5BNVA 4ZBJC 4EO5C 4AWLB 2CV5A 3W96D 4YM6C 5GT3C 4J8VC 5B1MD 4Z66D 3REHD 3X1TB 1P3AB 4R8PA 3LELC 2F8NG 5GXQA 1KX4A 1M1AC 5B32B 3AZLC 4HGAB 3B6GC 4J8UD 4J8WB 5B33C 3WAAD 2PYOC 3MGQB 1P3LB 3AZED 4YS3A 3AN2D 3MGRC 2HIOD 3X1SD 1JFIB 2RVQC 1P3KC 4WU9D 5B2IB 3MVDC 3W98A 4XZQB 4KUDA 5CHLB 4YM6D 1U35B 5E5AA 5B0ZC 5AV5A 3REIB 5F99B 3UTAA 5GT0C 5AV6C 1P3GC 3W97D 4WU8A 4KHAA 3LELD 3AV1D 3MNNB 5CPIC 3AZLD 5KDMB 3W96A 3O62B 3WA9B 4Z5TC 2HUEC 3UTBB 1F66B 2YFWA 4Z66A 4WV4B 5B1MA 5B0YC 5AV9C 3LJAD 3REHA 5AVBC 3MGRD 3AZFD 3AZGB 1TAFB 2RVQD 5BT1D 4J8UA 3WAAA 5B0ZD 3AZEA 1KX3C 5DNMC 5GT0D 2YFVA 5AV6D 1P3IC 3AN2A 1P3FD 1P3GD 3X1VC 5AY8C 1P3MC 2HIOA 3X1SA 3W99C 4G92C 4KGCD 1BH8B 4ZUXC 4WU9A 5CPID 5FUGB 4Z5TD 4YM6A 3LZ1B 5DNNC 4CSRA 3AZMC 4NE5A 1P34D 3KUYB 3A6NB 3MGSB 3W97A 1HQ3C 5B0YD 5AVBD 4LD9D 3LELA 3AZNC 3AV1A 4H9RA 4JJNC 3AZLA 3REJD 2AROC 3AZIB 3AZKD 2CV5C 1KX3D 3UT9B 5JA4B 3LJAA 1P3ID 5B24B 3MGRA 3X1VD 5AY8D 1P3MD 5AV8D 5B2JB 3AZFA 3R45B 3AYWB 5GXQC 3VH6A 5B0ZA 5AVCC 3B0CT 3B0DB 5GT0A 5AV6A 3V9RB 1P3FA 1P3GA 1A7WA 2FJ7B 5B40B 3AZND 4KGCA 1S32C 3RELD 5CPIA 4JJND 1Q9CA 2AROD 4Z5TA 3KWQC 4UUZA 3W98C 1H3OB 1P3PC 5E5AC 5B0YA 5AVBA 5AV5C 4LD9A 3AZHC 5CPKB 3AV2C 3REJA 4E45A 3AZKA 5GSUB 4XUJD 1KX3A 1M19B 5AVCD 1P3IA 3WKJC 3KSYA 3X1VA 5AY8A 1P3MA 5AV8A 5B31D 3AZJB 5CPJB 5B1MC 4Z66C 3REHC 1S32D 4QLCB 1KX5C 2NZDB 3KWQD 4H9PA 2LY8A 4J8UC 1BH9A 3WAAC 1P3PD 2BYKA 5B1LD 3AZNA 3AZHD 3LZ0B 3RELA 4AWLC 4JJNA 2HIOC 3X1SC 3AV2D 2AROA 5BNXA 3KXBB 4WU9C 5G49B 3WKJD 3X1TC 3C1BB 4X23B 1ID3B 1TZYD 3W97C 4WNNA 4CAYB 1P3BB 3AV1C 5C3IB 4XUJA 3NQJA 1KX5D 3MGQC 1P3LC 1ZLAB 4J8XB 5AVCA 2IO5B 5JRGB 5B31A 3MGPD 1BFMA 3B6FB 1S32A 3LJAC 5B2IC 3AZFC 1U35C 5BT1C 4H9SC 3KWQA 3REIC 5F99C 4EO5B 1P3PA 3X1TD 4H9QA 1P3AD 3WTPB 3AZHA 5B1LA 4H9OA 1P3FC 5GT3B 3B0CW 5B32D 4J8VB 2BYMB 3AV2A 4KGCC 4J8WD 1F66C 2F8NB 3MGQD 1P3LD 1M1AB 3WKJA 3NQUB 1TZYA 4H9NA 3B6GB 1N1JB 5B33B 1P34C 1EQZB 5CP6B 3AZGC 2PYOB 4LD9C 5B2ID 4XZQD 1U35D 1M18B 1KX5A 2NQBB 3REID 3REJC 5F99D 1P3KB 3AZKC 3MVDB 3MGPA 3MNND 5AV8C 3O62D 3WA9D 4G91C 3UTBD 1F66D 3TU4B 3KUYC 3A6NC 3MGSC 5BO0B 3X1TA 1P3AA 1P3OB 3AZGD 5B32A 3AZIC 5AV9B 5B0YB 4J8WA 3RELC 3MGQA 1P3LA 5B2JC 1JFIA 1KU5A 5B2IA 3C1CB 5DNMB 4XZQA 3AYWC 3LZ1D 1U35A 4G92B 4H9SA 3W99B 3REIA 5F99A 3B0DC
chains in the Genus database with same CATH superfamily
3KUYD 4ZUXB 3A6ND 4XUJC 3MGSD 3REKB 2FJ7C 1AOIB 5B40C 3MNNA 5DNNB 3AZMB 5KDMA 5B31C 3O62A 3X1UB 3WA9A 3AZID 1HQ3B 3AFAB 3UTBA 1F66A 5BS7C 3UT9D 5B24D 2JCHA 5B2JD 1P34A 5BNVB 3AZGA 1TAFA 2CV5B 2CWEA 5B1LC 3AYWD 5GSUC 4NE3A 4R8PB 3AZJC 2FJ7D 5B40D 3H0RC 5GXQB 1KX4B 1BH8A 5FUGA 1TZYC 4QLCC 3LZ1A 3EPKA 2NZDC 4YS3B 4DRBA 3WTPE 2L5AA 3A6NA 3MGSA 3KUYA 2JE5A 5CPKD 3LZ0C 3EPLA 3MGPC 3W98B 2XD1A 4KUDB 3AZIA 5E5AB 5GSUD 5AV5B 3KXBC 3FDDA 3UTAB 1M19D 3UT9A 5JA4A 4WU8B 5B24A 4KHAB 4X23C 3C1BC 1ID3C 3AZJD 5B2JA 5CPJD 2Y2OA 1P3AC 3W96B 3R45A 4QLCD 2Y2HA 3AYWA 2YFWB 4Z2MH 2NZDD 5B32C 1ZLAC 1HTAA 4HGAC 5B1MB 4Z66B 4J8XC 3REHB 3V9RA 4J8WC 3VH5T 5JRGC 2FJ7A 5B40A 3B6FC 3LZ0D 4J8UB 3WAAB 1F1EA 3KXBD 3AZEB 5BS7A 2YFVB 4XZQC 1H3OA 3AN2B 1R4VA 2HIOB 3X1SB 3WTPC 4X23D 3C1BD 5CPKA 1ID3D 4ZBJB 4WU9B 2Y2GA 1P3BD 2Y2NA 4YM6B 3F6TA 3MNNC 5GSUA 4CSRB 4WZSB 3O62C 1ZLAD 3WA9C 4J8XD 1M19A 3W97B 3UTBC 3LELB 5JRGD 3AZJA 3AV1B 4H9RB 5CPJA 1EQZC 3B6FD 5CP6C 3AZLB 4QLCA 3EG5B 1WWIA 1W2EA 1M18C 2NZDA 2NQBC 3LJAB 2F8NK 3MGRB 1WWSA 3B0BA 3WTPD 3AZFB 3LZ0A 5GT3D 4J8VD 4NFTA 3VH6W 5B0ZB 3KXBA 2F8ND 3TU4C 5GT0B 5AV6B 5G49A 1P3FB 3LZ1C 1P3GB 1M1AD 3C1BA 1P3OC 4X23A 1ID3A 4KGCB 3B6GD 5B33D 1EQZD 5CP6D 5CPIB 4CAYA 2PYOD 1P3BA 4Z5TB 2HUEB 4UUZB 1M18D 2NQBD 1ZLAA 1P34B 4J8XA 1P3KD 5AVBB 4LD9B 3MVDD 5JRGA 4WJ3C 3B6FA 3UT9C 5B24C 3REJB 3C1CC 3AZKB 3TU4D 1KX3B 1P3IB 3X1VB 5AY8B 1P3MB 5AV8B 3REKC 3WTPA 1P3OD 1AOIC 4M6BA 2F8NH 4G91B 1PZRA 5GT3A 4J8VA 2BYMA 3VH5W 3X1UC 4Z2MG 2ZY5A 5AV9D 3AFAC 2Y2PA 3EPJA 2F8NA 4H9PB 5B31G 1BH9B 4NE6A 1M1AA 2BYKB 3NQUA 3AZNB 3B6GA 1N1JA 5B33A 3RELB 1EQZA 5CP6A 4JJNB 4E44A 2PYOA 2AROB 5BNXB 5DNMD 3C1CD 5CPKC 1M18A 2NQBA 3W99D 1P3KA 1T3UA 4ZUXD 4R8PC 1ULYA 3MVDA 3REKD 1AOID 1M19C 1KX4C 4WNNB 3VH6T 5DNND 3AZMD 5CPJC 3X1UD 4XUJB 1HQ3D 3NQJB 3AFAD 3TU4A 5AVCB 4YS3C 5BO0A 1B6WA 5B31B 1P3OA 1S32B 2ZY2A 2CV5D 4KUDC 2JSSA 5AV9A 3KWQB 3UTAC 2Y2KA 4WU8C 1P3PB 4H9QB 4R8PD 3AZHB 5B1LB 4H9OB 5GXQD 2VQRA 1KX4D 2W8SA 3W96C 3AV2B 3C1CA 5DNMA 1B67A 2Y2LA 3W99A 1P3BC 3WKJB 4YS3D 5C3IC 4ZUXA 1TZYB 4H9NB 5B32G 3REKA 1AOIA 3VH5A 5DNNA 3AZMA 2IO5C 3W98D 4KUDD 3X1UA 1HQ3A 5E5AD 3AFAA 1KX5B 5AV5D 3AZEC 3UTAD 3AN2C 4WU8D 3MGPB 4DRAA 5BNVA 4ZBJC 4EO5C 4AWLB 3KFUG 2CV5A 3W96D 4YM6C 5GT3C 2Y2QA 4J8VC 5B1MD 4Z66D 3REHD 3X1TB 1P3AB 4R8PA 3LELC 2F8NG 2J8PA 5GXQA 1KX4A 1M1AC 5B32B 3AZLC 4HGAB 3B6GC 4J8UD 4J8WB 5B33C 3WAAD 2PYOC 3MGQB 1P3LB 3AZED 4DQYB 3AN2D 4YS3A 3MGRC 2HIOD 3X1SD 1JFIB 2RVQC 1P3KC 4WU9D 5B2IB 3MVDC 3W98A 4XZQB 4KUDA 5CHLB 4YM6D 1U35B 5E5AA 2Y2MA 5B0ZC 5AV5A 3REIB 5F99B 3UTAA 5GT0C 5AV6C 3A1KA 1P3GC 3W97D 4WU8A 4KHAA 3LELD 3AV1D 3MNNB 5CPIC 3AZLD 5KDMB 3W96A 3O62B 3WA9B 4Z5TC 2HUEC 3UTBB 1F66B 2YFWA 4WV4B 5B1MA 5AV9C 5B0YC 4Z66A 3LJAD 3REHA 5AVBC 3MGRD 3AZFD 3AZGB 1TAFB 2RVQD 5BT1D 4J8UA 3WAAA 5B0ZD 3AZEA 1KX3C 5DNMC 5GT0D 2YFVA 5AV6D 1P3IC 3AN2A 1P3FD 1P3GD 3X1VC 5AY8C 1P3MC 2HIOA 3X1SA 3W99C 4G92C 4KGCD 1BH8B 4ZUXC 4WU9A 5CPID 5FUGB 4Z5TD 4YM6A 3LZ1B 3H0MC 4CSRA 5DNNC 3AZMC 4NE5A 1P34D 3KUYB 3A6NB 3MGSB 3W97A 1HQ3C 5B0YD 5AVBD 4LD9D 3LELA 3AZNC 3AV1A 4H9RA 4JJNC 3AZLA 3REJD 2AROC 3AZIB 3AZKD 2DF4C 2CV5C 1KX3D 3UT9B 5JA4B 3LJAA 1P3ID 5B24B 3IP4C 3MGRA 5AY8D 3X1VD 5AV8D 5B2JB 1P3MD 3AZFA 3R45B 3AYWB 5GXQC 3VH6A 5B0ZA 5AVCC 3B0CT 3B0DB 5GT0A 5AV6A 3V9RB 1P3FA 1P3GA 1A7WA 2FJ7B 5B40B 3AZND 4KGCA 1S32C 3RELD 5CPIA 4JJND 1Q9CA 2AROD 4Z5TA 3KWQC 4UUZA 3W98C 1H3OB 1P3PC 5E5AC 5B0YA 5AVBA 5AV5C 4LD9A 3AZHC 5CPKB 3AV2C 3REJA 1Z2CB 4E45A 3AZKA 5GSUB 4XUJD 1KX3A 1M19B 5AVCD 1P3IA 3WKJC 3KSYA 3X1VA 5AY8A 1P3MA 5AV8A 5B31D 3AZJB 5CPJB 5B1MC 4Z66C 3REHC 1S32D 4QLCB 3A1IA 1KX5C 2NZDB 3KWQD 4H9PA 2LY8A 4J8UC 1BH9A 3WAAC 1P3PD 2BYKA 5B1LD 3AZNA 3AZHD 3LZ0B 3RELA 4AWLC 4JJNA 2HIOC 3X1SC 3AV2D 3H0LC 2AROA 5BNXA 3KXBB 4WU9C 5G49B 3WKJD 3X1TC 3C1BB 2ZY4A 4X23B 1ID3B 1TZYD 3W97C 4WNNA 4CAYB 1P3BB 3AV1C 4UPKA 5C3IB 4XUJA 3NQJA 1KX5D 3MGQC 1P3LC 1ZLAB 4J8XB 5AVCA 2IO5B 5JRGB 5B31A 3MGPD 1BFMA 3B6FB 1S32A 3LJAC 5B2IC 2G5HC 3AZFC 1U35C 5BT1C 4H9SC 3KWQA 3REIC 5F99C 4EO5B 3EPHA 1P3PA 4H9QA 3X1TD 1P3AD 3WTPB 3AL0C 2FFFB 3AZHA 5B1LA 4H9OA 2BG1A 1P3FC 5GT3B 3B0CW 5B32D 4J8VB 2BYMB 3AV2A 4KGCC 4J8WD 1F66C 2G5IC 2F8NB 3MGQD 1P3LD 1M1AB 3WKJA 3P5JB 3NQUB 1TZYA 4H9NA 3B6GB 1N1JB 2Y2JA 5B33B 1P34C 1EQZB 5CP6B 3AZGC 2PYOB 4LD9C 5B2ID 4XZQD 1U35D 1M18B 1KX5A 2NQBB 3REID 3REJC 5F99D 1P3KB 3AZKC 2RIQA 3MVDB 3MGPA 3MNND 5AV8C 3O62D 3WA9D 2XD5A 4G91C 3UTBD 1F66D 3TU4B 2DQNC 2ZM5A 3KUYC 3A6NC 3MGSC 5BO0B 3X1TA 1P3AA 1P3OB 3AZGD 5B32A 3AZIC 5AV9B 2ZY3A 5B0YB 4J8WA 3RELC 3MGQA 1P3LA 2F2AC 5B2JC 1JFIA 2Y2IA 1KU5A 5B2IA 3C1CB 5DNMB 4XZQA 2UWXA 3AYWC 3LZ1D 1U35A 4G92B 4H9SA 3W99B 3REIA 5F99A 3B0DC
chains in the Genus database with same CATH topology
3KUYD 4ZUXB 3A6ND 4XUJC 3MGSD 3REKB 2FJ7C 1AOIB 5B40C 3MNNA 5DNNB 3AZMB 5KDMA 5B31C 3O62A 3X1UB 3WA9A 3AZID 1HQ3B 3AFAB 3UTBA 1F66A 5BS7C 3UT9D 5B24D 2JCHA 5B2JD 1P34A 5BNVB 3AZGA 1TAFA 2CV5B 2CWEA 5B1LC 3AYWD 5GSUC 4NE3A 4R8PB 3AZJC 2FJ7D 5B40D 3H0RC 5GXQB 1KX4B 1BH8A 5FUGA 1TZYC 4QLCC 3LZ1A 3EPKA 2NZDC 4YS3B 4DRBA 3WTPE 2L5AA 3A6NA 3MGSA 3KUYA 2JE5A 5CPKD 3LZ0C 3EPLA 3MGPC 3W98B 2XD1A 4KUDB 3AZIA 5E5AB 5GSUD 5AV5B 3KXBC 3FDDA 3UTAB 1M19D 3UT9A 5JA4A 4WU8B 5B24A 4KHAB 4X23C 3C1BC 1ID3C 3AZJD 5B2JA 5CPJD 2Y2OA 1P3AC 3W96B 3R45A 4QLCD 2Y2HA 3AYWA 2YFWB 4Z2MH 2NZDD 5B32C 1ZLAC 1HTAA 4HGAC 5B1MB 4Z66B 4J8XC 3REHB 3V9RA 4J8WC 3VH5T 5JRGC 2FJ7A 5B40A 3B6FC 3LZ0D 4J8UB 3WAAB 1F1EA 3KXBD 3AZEB 5BS7A 2YFVB 4XZQC 1H3OA 3AN2B 1R4VA 2HIOB 3X1SB 3WTPC 4X23D 3C1BD 5CPKA 1ID3D 4ZBJB 4WU9B 2Y2GA 1P3BD 2Y2NA 4YM6B 3F6TA 3MNNC 5GSUA 4CSRB 4WZSB 3O62C 1ZLAD 3WA9C 4J8XD 1M19A 3W97B 3UTBC 3LELB 5JRGD 3AZJA 3AV1B 4H9RB 5CPJA 1EQZC 3B6FD 5CP6C 3AZLB 4QLCA 3EG5B 1WWIA 1W2EA 1M18C 2NZDA 2NQBC 3LJAB 2F8NK 3MGRB 1WWSA 3B0BA 3WTPD 3AZFB 3LZ0A 5GT3D 4J8VD 4NFTA 3VH6W 5B0ZB 3KXBA 2F8ND 3TU4C 5GT0B 5AV6B 5G49A 1P3FB 3LZ1C 1P3GB 1M1AD 3C1BA 1P3OC 4X23A 1ID3A 4KGCB 3B6GD 5B33D 1EQZD 5CP6D 5CPIB 4CAYA 2PYOD 1P3BA 4Z5TB 2HUEB 4UUZB 1M18D 2NQBD 1ZLAA 1P34B 4J8XA 1P3KD 5AVBB 4LD9B 3MVDD 5JRGA 4WJ3C 3B6FA 3UT9C 5B24C 3REJB 3C1CC 3AZKB 3TU4D 1KX3B 1P3IB 3X1VB 5AY8B 1P3MB 5AV8B 3REKC 3WTPA 1P3OD 1AOIC 4M6BA 2F8NH 4G91B 1PZRA 5GT3A 4J8VA 2BYMA 3VH5W 3X1UC 4Z2MG 2ZY5A 5AV9D 3AFAC 2Y2PA 3EPJA 2F8NA 4H9PB 5B31G 1BH9B 4NE6A 1M1AA 2BYKB 3NQUA 3AZNB 3B6GA 1N1JA 5B33A 3RELB 1EQZA 5CP6A 4JJNB 4E44A 2PYOA 2AROB 5BNXB 5DNMD 3C1CD 5CPKC 1M18A 2NQBA 3W99D 1P3KA 1T3UA 4ZUXD 4R8PC 1ULYA 3MVDA 3REKD 1AOID 1M19C 1KX4C 4WNNB 3VH6T 5DNND 3AZMD 5CPJC 3X1UD 4XUJB 1HQ3D 3NQJB 3AFAD 3TU4A 5AVCB 4YS3C 5BO0A 1B6WA 5B31B 1P3OA 1S32B 2ZY2A 2CV5D 4KUDC 2JSSA 5AV9A 3KWQB 3UTAC 2Y2KA 4WU8C 1P3PB 4H9QB 4R8PD 3AZHB 5B1LB 4H9OB 5GXQD 2VQRA 1KX4D 2W8SA 3W96C 3AV2B 3C1CA 5DNMA 1B67A 2Y2LA 3W99A 1P3BC 3WKJB 4YS3D 5C3IC 4ZUXA 1TZYB 4H9NB 5B32G 3REKA 1AOIA 3VH5A 5DNNA 3AZMA 2IO5C 3W98D 4KUDD 3X1UA 1HQ3A 5E5AD 3AFAA 1KX5B 5AV5D 3AZEC 3UTAD 3AN2C 4WU8D 3MGPB 4DRAA 5BNVA 4ZBJC 4EO5C 4AWLB 3KFUG 2CV5A 3W96D 4YM6C 5GT3C 2Y2QA 4J8VC 5B1MD 4Z66D 3REHD 3X1TB 1P3AB 4R8PA 3LELC 2F8NG 2J8PA 5GXQA 1KX4A 1M1AC 5B32B 3AZLC 4HGAB 3B6GC 4J8UD 4J8WB 5B33C 3WAAD 2PYOC 3MGQB 1P3LB 3AZED 4DQYB 3AN2D 4YS3A 3MGRC 2HIOD 3X1SD 1JFIB 2RVQC 1P3KC 4WU9D 5B2IB 3MVDC 3W98A 4XZQB 4KUDA 5CHLB 4YM6D 1U35B 5E5AA 2Y2MA 5B0ZC 5AV5A 3REIB 5F99B 3UTAA 5GT0C 5AV6C 3A1KA 1P3GC 3W97D 4WU8A 4KHAA 3LELD 3AV1D 3MNNB 5CPIC 3AZLD 5KDMB 3W96A 3O62B 3WA9B 4Z5TC 2HUEC 3UTBB 1F66B 2YFWA 4WV4B 5B1MA 5AV9C 5B0YC 4Z66A 3LJAD 3REHA 5AVBC 3MGRD 3AZFD 3AZGB 1TAFB 2RVQD 5BT1D 4J8UA 3WAAA 5B0ZD 3AZEA 1KX3C 5DNMC 5GT0D 2YFVA 5AV6D 1P3IC 3AN2A 1P3FD 1P3GD 3X1VC 5AY8C 1P3MC 2HIOA 3X1SA 3W99C 4G92C 4KGCD 1BH8B 4ZUXC 4WU9A 5CPID 5FUGB 4Z5TD 4YM6A 3LZ1B 3H0MC 4CSRA 5DNNC 3AZMC 4NE5A 1P34D 3KUYB 3A6NB 3MGSB 3W97A 1HQ3C 5B0YD 5AVBD 4LD9D 3LELA 3AZNC 3AV1A 4H9RA 4JJNC 3AZLA 3REJD 2AROC 3AZIB 3AZKD 2DF4C 2CV5C 1KX3D 3UT9B 5JA4B 3LJAA 1P3ID 5B24B 3IP4C 3MGRA 5AY8D 3X1VD 5AV8D 5B2JB 1P3MD 3AZFA 3R45B 3AYWB 5GXQC 3VH6A 5B0ZA 5AVCC 3B0CT 3B0DB 5GT0A 5AV6A 3V9RB 1P3FA 1P3GA 1A7WA 2FJ7B 5B40B 3AZND 4KGCA 1S32C 3RELD 5CPIA 4JJND 1Q9CA 2AROD 4Z5TA 3KWQC 4UUZA 3W98C 1H3OB 1P3PC 5E5AC 5B0YA 5AVBA 5AV5C 4LD9A 3AZHC 5CPKB 3AV2C 3REJA 1Z2CB 4E45A 3AZKA 5GSUB 4XUJD 1KX3A 1M19B 5AVCD 1P3IA 3WKJC 3KSYA 3X1VA 5AY8A 1P3MA 5AV8A 5B31D 3AZJB 5CPJB 5B1MC 4Z66C 3REHC 1S32D 4QLCB 3A1IA 1KX5C 2NZDB 3KWQD 4H9PA 2LY8A 4J8UC 1BH9A 3WAAC 1P3PD 2BYKA 5B1LD 3AZNA 3AZHD 3LZ0B 3RELA 4AWLC 4JJNA 2HIOC 3X1SC 3AV2D 3H0LC 2AROA 5BNXA 3KXBB 4WU9C 5G49B 3WKJD 3X1TC 3C1BB 2ZY4A 4X23B 1ID3B 1TZYD 3W97C 4WNNA 4CAYB 1P3BB 3AV1C 4UPKA 5C3IB 4XUJA 3NQJA 1KX5D 3MGQC 1P3LC 1ZLAB 4J8XB 5AVCA 2IO5B 5JRGB 5B31A 3MGPD 1BFMA 3B6FB 1S32A 3LJAC 5B2IC 2G5HC 3AZFC 1U35C 5BT1C 4H9SC 3KWQA 3REIC 5F99C 4EO5B 3EPHA 1P3PA 4H9QA 3X1TD 1P3AD 3WTPB 3AL0C 2FFFB 3AZHA 5B1LA 4H9OA 2BG1A 1P3FC 5GT3B 3B0CW 5B32D 4J8VB 2BYMB 3AV2A 4KGCC 4J8WD 1F66C 2G5IC 2F8NB 3MGQD 1P3LD 1M1AB 3WKJA 3P5JB 3NQUB 1TZYA 4H9NA 3B6GB 1N1JB 2Y2JA 5B33B 1P34C 1EQZB 5CP6B 3AZGC 2PYOB 4LD9C 5B2ID 4XZQD 1U35D 1M18B 1KX5A 2NQBB 3REID 3REJC 5F99D 1P3KB 3AZKC 2RIQA 3MVDB 3MGPA 3MNND 5AV8C 3O62D 3WA9D 2XD5A 4G91C 3UTBD 1F66D 3TU4B 2DQNC 2ZM5A 3KUYC 3A6NC 3MGSC 5BO0B 3X1TA 1P3AA 1P3OB 3AZGD 5B32A 3AZIC 5AV9B 2ZY3A 5B0YB 4J8WA 3RELC 3MGQA 1P3LA 2F2AC 5B2JC 1JFIA 2Y2IA 1KU5A 5B2IA 3C1CB 5DNMB 4XZQA 2UWXA 3AYWC 3LZ1D 1U35A 4G92B 4H9SA 3W99B 3REIA 5F99A 3B0DC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KUY D;  4ZUX B;  3A6N D;  4XUJ C;  3MGS D;  3REK B;  2FJ7 C;  1AOI B;  5B40 C;  3MNN A;  5DNN B;  3AZM B;  5KDM A;  5B31 C;  3O62 A;  3X1U B;  3WA9 A;  3AZI D;  1HQ3 B;  3AFA B;  3UTB A;  1F66 A;  5BS7 C;  3UT9 D;  5B24 D;  5B2J D;  1P34 A;  5BNV B;  3AZG A;  1TAF A;  2CV5 B;  2CWE A;  5B1L C;  3AYW D;  5GSU C;  4NE3 A;  4R8P B;  3AZJ C;  2FJ7 D;  5B40 D;  5GXQ B;  1KX4 B;  1BH8 A;  5FUG A;  1TZY C;  4QLC C;  3LZ1 A;  2NZD C;  4YS3 B;  4DRB A;  3WTP E;  2L5A A;  3A6N A;  3MGS A;  3KUY A;  5CPK D;  3LZ0 C;  3MGP C;  3W98 B;  4KUD B;  3AZI A;  5E5A B;  5GSU D;  5AV5 B;  3KXB C;  3UTA B;  1M19 D;  3UT9 A;  5JA4 A;  4WU8 B;  5B24 A;  4KHA B;  4X23 C;  3C1B C;  1ID3 C;  3AZJ D;  5B2J A;  5CPJ D;  1P3A C;  3W96 B;  3R45 A;  4QLC D;  3AYW A;  2YFW B;  4Z2M H;  2NZD D;  5B32 C;  1ZLA C;  1HTA A;  4HGA C;  5B1M B;  4Z66 B;  4J8X C;  3REH B;  3V9R A;  4J8W C;  3VH5 T;  5JRG C;  2FJ7 A;  5B40 A;  3B6F C;  3LZ0 D;  4J8U B;  3WAA B;  1F1E A;  3KXB D;  3AZE B;  5BS7 A;  2YFV B;  4XZQ C;  1H3O A;  3AN2 B;  1R4V A;  2HIO B;  3X1S B;  3WTP C;  4X23 D;  3C1B D;  5CPK A;  1ID3 D;  4ZBJ B;  4WU9 B;  1P3B D;  4YM6 B;  3MNN C;  5GSU A;  4CSR B;  4WZS B;  3O62 C;  1ZLA D;  3WA9 C;  4J8X D;  1M19 A;  3W97 B;  3UTB C;  3LEL B;  5JRG D;  3AZJ A;  3AV1 B;  4H9R B;  5CPJ A;  1EQZ C;  3B6F D;  5CP6 C;  3AZL B;  4QLC A;  1WWI A;  1M18 C;  2NZD A;  2NQB C;  3LJA B;  2F8N K;  3MGR B;  1WWS A;  3B0B A;  3WTP D;  3AZF B;  3LZ0 A;  5GT3 D;  4J8V D;  4NFT A;  3VH6 W;  5B0Z B;  3KXB A;  2F8N D;  3TU4 C;  5GT0 B;  5AV6 B;  5G49 A;  1P3F B;  3LZ1 C;  1P3G B;  1M1A D;  3C1B A;  1P3O C;  4X23 A;  1ID3 A;  4KGC B;  3B6G D;  5B33 D;  1EQZ D;  5CP6 D;  5CPI B;  4CAY A;  2PYO D;  1P3B A;  4Z5T B;  2HUE B;  4UUZ B;  1M18 D;  2NQB D;  1ZLA A;  1P34 B;  4J8X A;  1P3K D;  5AVB B;  4LD9 B;  3MVD D;  5JRG A;  3B6F A;  3UT9 C;  5B24 C;  3REJ B;  3C1C C;  3AZK B;  3TU4 D;  1KX3 B;  1P3I B;  3X1V B;  5AY8 B;  1P3M B;  5AV8 B;  3REK C;  3WTP A;  1P3O D;  1AOI C;  4M6B A;  2F8N H;  4G91 B;  5GT3 A;  4J8V A;  2BYM A;  3VH5 W;  3X1U C;  4Z2M G;  5AV9 D;  3AFA C;  2F8N A;  4H9P B;  5B31 G;  1BH9 B;  4NE6 A;  1M1A A;  2BYK B;  3NQU A;  3AZN B;  3B6G A;  1N1J A;  5B33 A;  3REL B;  1EQZ A;  5CP6 A;  4JJN B;  4E44 A;  2PYO A;  2ARO B;  5BNX B;  5DNM D;  3C1C D;  5CPK C;  1M18 A;  2NQB A;  3W99 D;  1P3K A;  4ZUX D;  4R8P C;  1ULY A;  3MVD A;  3REK D;  1AOI D;  1M19 C;  1KX4 C;  4WNN B;  3VH6 T;  5DNN D;  3AZM D;  5CPJ C;  3X1U D;  4XUJ B;  1HQ3 D;  3NQJ B;  3AFA D;  3TU4 A;  5AVC B;  4YS3 C;  5BO0 A;  1B6W A;  5B31 B;  1P3O A;  1S32 B;  2CV5 D;  4KUD C;  2JSS A;  5AV9 A;  3KWQ B;  3UTA C;  1P3P B;  4WU8 C;  4H9Q B;  4R8P D;  3AZH B;  5B1L B;  4H9O B;  5GXQ D;  1KX4 D;  3W96 C;  3AV2 B;  3C1C A;  5DNM A;  1B67 A;  3W99 A;  1P3B C;  3WKJ B;  4YS3 D;  5C3I C;  4ZUX A;  1TZY B;  4H9N B;  5B32 G;  3REK A;  1AOI A;  3VH5 A;  5DNN A;  3AZM A;  2IO5 C;  3W98 D;  4KUD D;  3X1U A;  1HQ3 A;  5E5A D;  3AFA A;  1KX5 B;  5AV5 D;  3AZE C;  3UTA D;  3AN2 C;  4WU8 D;  3MGP B;  4DRA A;  5BNV A;  4ZBJ C;  4EO5 C;  4AWL B;  2CV5 A;  3W96 D;  4YM6 C;  5GT3 C;  4J8V C;  5B1M D;  4Z66 D;  3REH D;  3X1T B;  1P3A B;  4R8P A;  3LEL C;  2F8N G;  5GXQ A;  1KX4 A;  1M1A C;  5B32 B;  3AZL C;  4HGA B;  3B6G C;  4J8U D;  4J8W B;  5B33 C;  3WAA D;  2PYO C;  3MGQ B;  1P3L B;  3AZE D;  4YS3 A;  3AN2 D;  3MGR C;  2HIO D;  3X1S D;  1JFI B;  2RVQ C;  1P3K C;  4WU9 D;  5B2I B;  3MVD C;  3W98 A;  4XZQ B;  4KUD A;  5CHL B;  4YM6 D;  1U35 B;  5E5A A;  5B0Z C;  5AV5 A;  3REI B;  5F99 B;  3UTA A;  5GT0 C;  5AV6 C;  1P3G C;  3W97 D;  4WU8 A;  4KHA A;  3LEL D;  3AV1 D;  3MNN B;  5CPI C;  3AZL D;  5KDM B;  3W96 A;  3O62 B;  3WA9 B;  4Z5T C;  2HUE C;  3UTB B;  1F66 B;  2YFW A;  4Z66 A;  4WV4 B;  5B1M A;  5B0Y C;  5AV9 C;  3LJA D;  3REH A;  5AVB C;  3MGR D;  3AZF D;  3AZG B;  1TAF B;  2RVQ D;  5BT1 D;  4J8U A;  3WAA A;  5B0Z D;  3AZE A;  1KX3 C;  5DNM C;  5GT0 D;  2YFV A;  5AV6 D;  1P3I C;  3AN2 A;  1P3F D;  1P3G D;  3X1V C;  5AY8 C;  1P3M C;  2HIO A;  3X1S A;  3W99 C;  4G92 C;  4KGC D;  1BH8 B;  4ZUX C;  4WU9 A;  5CPI D;  5FUG B;  4Z5T D;  4YM6 A;  3LZ1 B;  5DNN C;  4CSR A;  3AZM C;  4NE5 A;  1P34 D;  3KUY B;  3A6N B;  3MGS B;  3W97 A;  1HQ3 C;  5B0Y D;  5AVB D;  4LD9 D;  3LEL A;  3AZN C;  3AV1 A;  4H9R A;  4JJN C;  3AZL A;  3REJ D;  2ARO C;  3AZI B;  3AZK D;  2CV5 C;  1KX3 D;  3UT9 B;  5JA4 B;  3LJA A;  1P3I D;  5B24 B;  3MGR A;  3X1V D;  5AY8 D;  1P3M D;  5AV8 D;  5B2J B;  3AZF A;  3R45 B;  3AYW B;  5GXQ C;  3VH6 A;  5B0Z A;  5AVC C;  3B0C T;  3B0D B;  5GT0 A;  5AV6 A;  3V9R B;  1P3F A;  1P3G A;  1A7W A;  2FJ7 B;  5B40 B;  3AZN D;  4KGC A;  1S32 C;  3REL D;  5CPI A;  4JJN D;  1Q9C A;  2ARO D;  4Z5T A;  3KWQ C;  4UUZ A;  3W98 C;  1H3O B;  1P3P C;  5E5A C;  5B0Y A;  5AVB A;  5AV5 C;  4LD9 A;  3AZH C;  5CPK B;  3AV2 C;  3REJ A;  4E45 A;  3AZK A;  5GSU B;  4XUJ D;  1KX3 A;  1M19 B;  5AVC D;  1P3I A;  3WKJ C;  3KSY A;  3X1V A;  5AY8 A;  1P3M A;  5AV8 A;  5B31 D;  3AZJ B;  5CPJ B;  5B1M C;  4Z66 C;  3REH C;  1S32 D;  4QLC B;  1KX5 C;  2NZD B;  3KWQ D;  4H9P A;  2LY8 A;  4J8U C;  1BH9 A;  3WAA C;  1P3P D;  2BYK A;  5B1L D;  3AZN A;  3AZH D;  3LZ0 B;  3REL A;  4AWL C;  4JJN A;  2HIO C;  3X1S C;  3AV2 D;  2ARO A;  5BNX A;  3KXB B;  4WU9 C;  5G49 B;  3WKJ D;  3X1T C;  3C1B B;  4X23 B;  1ID3 B;  1TZY D;  3W97 C;  4WNN A;  4CAY B;  1P3B B;  3AV1 C;  5C3I B;  4XUJ A;  3NQJ A;  1KX5 D;  3MGQ C;  1P3L C;  1ZLA B;  4J8X B;  5AVC A;  2IO5 B;  5JRG B;  5B31 A;  3MGP D;  1BFM A;  3B6F B;  1S32 A;  3LJA C;  5B2I C;  3AZF C;  1U35 C;  5BT1 C;  4H9S C;  3KWQ A;  3REI C;  5F99 C;  4EO5 B;  1P3P A;  3X1T D;  4H9Q A;  1P3A D;  3WTP B;  3AZH A;  5B1L A;  4H9O A;  1P3F C;  5GT3 B;  3B0C W;  5B32 D;  4J8V B;  2BYM B;  3AV2 A;  4KGC C;  4J8W D;  1F66 C;  2F8N B;  3MGQ D;  1P3L D;  1M1A B;  3WKJ A;  3NQU B;  1TZY A;  4H9N A;  3B6G B;  1N1J B;  5B33 B;  1P34 C;  1EQZ B;  5CP6 B;  3AZG C;  2PYO B;  4LD9 C;  5B2I D;  4XZQ D;  1U35 D;  1M18 B;  1KX5 A;  2NQB B;  3REI D;  3REJ C;  5F99 D;  1P3K B;  3AZK C;  3MVD B;  3MGP A;  3MNN D;  5AV8 C;  3O62 D;  3WA9 D;  4G91 C;  3UTB D;  1F66 D;  3TU4 B;  3KUY C;  3A6N C;  3MGS C;  5BO0 B;  3X1T A;  1P3A A;  1P3O B;  3AZG D;  5B32 A;  3AZI C;  5AV9 B;  5B0Y B;  4J8W A;  3REL C;  3MGQ A;  1P3L A;  5B2J C;  1JFI A;  1KU5 A;  5B2I A;  3C1C B;  5DNM B;  4XZQ A;  3AYW C;  3LZ1 D;  1U35 A;  4G92 B;  4H9S A;  3W99 B;  3REI A;  5F99 A;  3B0D C; 
#chains in the Genus database with same CATH topology
 3KUY D;  4ZUX B;  3A6N D;  4XUJ C;  3MGS D;  3REK B;  2FJ7 C;  1AOI B;  5B40 C;  3MNN A;  5DNN B;  3AZM B;  5KDM A;  5B31 C;  3O62 A;  3X1U B;  3WA9 A;  3AZI D;  1HQ3 B;  3AFA B;  3UTB A;  1F66 A;  5BS7 C;  3UT9 D;  5B24 D;  2JCH A;  5B2J D;  1P34 A;  5BNV B;  3AZG A;  1TAF A;  2CV5 B;  2CWE A;  5B1L C;  3AYW D;  5GSU C;  4NE3 A;  4R8P B;  3AZJ C;  2FJ7 D;  5B40 D;  3H0R C;  5GXQ B;  1KX4 B;  1BH8 A;  5FUG A;  1TZY C;  4QLC C;  3LZ1 A;  3EPK A;  2NZD C;  4YS3 B;  4DRB A;  3WTP E;  2L5A A;  3A6N A;  3MGS A;  3KUY A;  2JE5 A;  5CPK D;  3LZ0 C;  3EPL A;  3MGP C;  3W98 B;  2XD1 A;  4KUD B;  3AZI A;  5E5A B;  5GSU D;  5AV5 B;  3KXB C;  3FDD A;  3UTA B;  1M19 D;  3UT9 A;  5JA4 A;  4WU8 B;  5B24 A;  4KHA B;  4X23 C;  3C1B C;  1ID3 C;  3AZJ D;  5B2J A;  5CPJ D;  2Y2O A;  1P3A C;  3W96 B;  3R45 A;  4QLC D;  2Y2H A;  3AYW A;  2YFW B;  4Z2M H;  2NZD D;  5B32 C;  1ZLA C;  1HTA A;  4HGA C;  5B1M B;  4Z66 B;  4J8X C;  3REH B;  3V9R A;  4J8W C;  3VH5 T;  5JRG C;  2FJ7 A;  5B40 A;  3B6F C;  3LZ0 D;  4J8U B;  3WAA B;  1F1E A;  3KXB D;  3AZE B;  5BS7 A;  2YFV B;  4XZQ C;  1H3O A;  3AN2 B;  1R4V A;  2HIO B;  3X1S B;  3WTP C;  4X23 D;  3C1B D;  5CPK A;  1ID3 D;  4ZBJ B;  4WU9 B;  2Y2G A;  1P3B D;  2Y2N A;  4YM6 B;  3F6T A;  3MNN C;  5GSU A;  4CSR B;  4WZS B;  3O62 C;  1ZLA D;  3WA9 C;  4J8X D;  1M19 A;  3W97 B;  3UTB C;  3LEL B;  5JRG D;  3AZJ A;  3AV1 B;  4H9R B;  5CPJ A;  1EQZ C;  3B6F D;  5CP6 C;  3AZL B;  4QLC A;  3EG5 B;  1WWI A;  1W2E A;  1M18 C;  2NZD A;  2NQB C;  3LJA B;  2F8N K;  3MGR B;  1WWS A;  3B0B A;  3WTP D;  3AZF B;  3LZ0 A;  5GT3 D;  4J8V D;  4NFT A;  3VH6 W;  5B0Z B;  3KXB A;  2F8N D;  3TU4 C;  5GT0 B;  5AV6 B;  5G49 A;  1P3F B;  3LZ1 C;  1P3G B;  1M1A D;  3C1B A;  1P3O C;  4X23 A;  1ID3 A;  4KGC B;  3B6G D;  5B33 D;  1EQZ D;  5CP6 D;  5CPI B;  4CAY A;  2PYO D;  1P3B A;  4Z5T B;  2HUE B;  4UUZ B;  1M18 D;  2NQB D;  1ZLA A;  1P34 B;  4J8X A;  1P3K D;  5AVB B;  4LD9 B;  3MVD D;  5JRG A;  4WJ3 C;  3B6F A;  3UT9 C;  5B24 C;  3REJ B;  3C1C C;  3AZK B;  3TU4 D;  1KX3 B;  1P3I B;  3X1V B;  5AY8 B;  1P3M B;  5AV8 B;  3REK C;  3WTP A;  1P3O D;  1AOI C;  4M6B A;  2F8N H;  4G91 B;  1PZR A;  5GT3 A;  4J8V A;  2BYM A;  3VH5 W;  3X1U C;  4Z2M G;  2ZY5 A;  5AV9 D;  3AFA C;  2Y2P A;  3EPJ A;  2F8N A;  4H9P B;  5B31 G;  1BH9 B;  4NE6 A;  1M1A A;  2BYK B;  3NQU A;  3AZN B;  3B6G A;  1N1J A;  5B33 A;  3REL B;  1EQZ A;  5CP6 A;  4JJN B;  4E44 A;  2PYO A;  2ARO B;  5BNX B;  5DNM D;  3C1C D;  5CPK C;  1M18 A;  2NQB A;  3W99 D;  1P3K A;  1T3U A;  4ZUX D;  4R8P C;  1ULY A;  3MVD A;  3REK D;  1AOI D;  1M19 C;  1KX4 C;  4WNN B;  3VH6 T;  5DNN D;  3AZM D;  5CPJ C;  3X1U D;  4XUJ B;  1HQ3 D;  3NQJ B;  3AFA D;  3TU4 A;  5AVC B;  4YS3 C;  5BO0 A;  1B6W A;  5B31 B;  1P3O A;  1S32 B;  2ZY2 A;  2CV5 D;  4KUD C;  2JSS A;  5AV9 A;  3KWQ B;  3UTA C;  2Y2K A;  4WU8 C;  1P3P B;  4H9Q B;  4R8P D;  3AZH B;  5B1L B;  4H9O B;  5GXQ D;  2VQR A;  1KX4 D;  2W8S A;  3W96 C;  3AV2 B;  3C1C A;  5DNM A;  1B67 A;  2Y2L A;  3W99 A;  1P3B C;  3WKJ B;  4YS3 D;  5C3I C;  4ZUX A;  1TZY B;  4H9N B;  5B32 G;  3REK A;  1AOI A;  3VH5 A;  5DNN A;  3AZM A;  2IO5 C;  3W98 D;  4KUD D;  3X1U A;  1HQ3 A;  5E5A D;  3AFA A;  1KX5 B;  5AV5 D;  3AZE C;  3UTA D;  3AN2 C;  4WU8 D;  3MGP B;  4DRA A;  5BNV A;  4ZBJ C;  4EO5 C;  4AWL B;  3KFU G;  2CV5 A;  3W96 D;  4YM6 C;  5GT3 C;  2Y2Q A;  4J8V C;  5B1M D;  4Z66 D;  3REH D;  3X1T B;  1P3A B;  4R8P A;  3LEL C;  2F8N G;  2J8P A;  5GXQ A;  1KX4 A;  1M1A C;  5B32 B;  3AZL C;  4HGA B;  3B6G C;  4J8U D;  4J8W B;  5B33 C;  3WAA D;  2PYO C;  3MGQ B;  1P3L B;  3AZE D;  4DQY B;  3AN2 D;  4YS3 A;  3MGR C;  2HIO D;  3X1S D;  1JFI B;  2RVQ C;  1P3K C;  4WU9 D;  5B2I B;  3MVD C;  3W98 A;  4XZQ B;  4KUD A;  5CHL B;  4YM6 D;  1U35 B;  5E5A A;  2Y2M A;  5B0Z C;  5AV5 A;  3REI B;  5F99 B;  3UTA A;  5GT0 C;  5AV6 C;  3A1K A;  1P3G C;  3W97 D;  4WU8 A;  4KHA A;  3LEL D;  3AV1 D;  3MNN B;  5CPI C;  3AZL D;  5KDM B;  3W96 A;  3O62 B;  3WA9 B;  4Z5T C;  2HUE C;  3UTB B;  1F66 B;  2YFW A;  4WV4 B;  5B1M A;  5AV9 C;  5B0Y C;  4Z66 A;  3LJA D;  3REH A;  5AVB C;  3MGR D;  3AZF D;  3AZG B;  1TAF B;  2RVQ D;  5BT1 D;  4J8U A;  3WAA A;  5B0Z D;  3AZE A;  1KX3 C;  5DNM C;  5GT0 D;  2YFV A;  5AV6 D;  1P3I C;  3AN2 A;  1P3F D;  1P3G D;  3X1V C;  5AY8 C;  1P3M C;  2HIO A;  3X1S A;  3W99 C;  4G92 C;  4KGC D;  1BH8 B;  4ZUX C;  4WU9 A;  5CPI D;  5FUG B;  4Z5T D;  4YM6 A;  3LZ1 B;  3H0M C;  4CSR A;  5DNN C;  3AZM C;  4NE5 A;  1P34 D;  3KUY B;  3A6N B;  3MGS B;  3W97 A;  1HQ3 C;  5B0Y D;  5AVB D;  4LD9 D;  3LEL A;  3AZN C;  3AV1 A;  4H9R A;  4JJN C;  3AZL A;  3REJ D;  2ARO C;  3AZI B;  3AZK D;  2DF4 C;  2CV5 C;  1KX3 D;  3UT9 B;  5JA4 B;  3LJA A;  1P3I D;  5B24 B;  3IP4 C;  3MGR A;  5AY8 D;  3X1V D;  5AV8 D;  5B2J B;  1P3M D;  3AZF A;  3R45 B;  3AYW B;  5GXQ C;  3VH6 A;  5B0Z A;  5AVC C;  3B0C T;  3B0D B;  5GT0 A;  5AV6 A;  3V9R B;  1P3F A;  1P3G A;  1A7W A;  2FJ7 B;  5B40 B;  3AZN D;  4KGC A;  1S32 C;  3REL D;  5CPI A;  4JJN D;  1Q9C A;  2ARO D;  4Z5T A;  3KWQ C;  4UUZ A;  3W98 C;  1H3O B;  1P3P C;  5E5A C;  5B0Y A;  5AVB A;  5AV5 C;  4LD9 A;  3AZH C;  5CPK B;  3AV2 C;  3REJ A;  1Z2C B;  4E45 A;  3AZK A;  5GSU B;  4XUJ D;  1KX3 A;  1M19 B;  5AVC D;  1P3I A;  3WKJ C;  3KSY A;  3X1V A;  5AY8 A;  1P3M A;  5AV8 A;  5B31 D;  3AZJ B;  5CPJ B;  5B1M C;  4Z66 C;  3REH C;  1S32 D;  4QLC B;  3A1I A;  1KX5 C;  2NZD B;  3KWQ D;  4H9P A;  2LY8 A;  4J8U C;  1BH9 A;  3WAA C;  1P3P D;  2BYK A;  5B1L D;  3AZN A;  3AZH D;  3LZ0 B;  3REL A;  4AWL C;  4JJN A;  2HIO C;  3X1S C;  3AV2 D;  3H0L C;  2ARO A;  5BNX A;  3KXB B;  4WU9 C;  5G49 B;  3WKJ D;  3X1T C;  3C1B B;  2ZY4 A;  4X23 B;  1ID3 B;  1TZY D;  3W97 C;  4WNN A;  4CAY B;  1P3B B;  3AV1 C;  4UPK A;  5C3I B;  4XUJ A;  3NQJ A;  1KX5 D;  3MGQ C;  1P3L C;  1ZLA B;  4J8X B;  5AVC A;  2IO5 B;  5JRG B;  5B31 A;  3MGP D;  1BFM A;  3B6F B;  1S32 A;  3LJA C;  5B2I C;  2G5H C;  3AZF C;  1U35 C;  5BT1 C;  4H9S C;  3KWQ A;  3REI C;  5F99 C;  4EO5 B;  3EPH A;  1P3P A;  4H9Q A;  3X1T D;  1P3A D;  3WTP B;  3AL0 C;  2FFF B;  3AZH A;  5B1L A;  4H9O A;  2BG1 A;  1P3F C;  5GT3 B;  3B0C W;  5B32 D;  4J8V B;  2BYM B;  3AV2 A;  4KGC C;  4J8W D;  1F66 C;  2G5I C;  2F8N B;  3MGQ D;  1P3L D;  1M1A B;  3WKJ A;  3P5J B;  3NQU B;  1TZY A;  4H9N A;  3B6G B;  1N1J B;  2Y2J A;  5B33 B;  1P34 C;  1EQZ B;  5CP6 B;  3AZG C;  2PYO B;  4LD9 C;  5B2I D;  4XZQ D;  1U35 D;  1M18 B;  1KX5 A;  2NQB B;  3REI D;  3REJ C;  5F99 D;  1P3K B;  3AZK C;  2RIQ A;  3MVD B;  3MGP A;  3MNN D;  5AV8 C;  3O62 D;  3WA9 D;  2XD5 A;  4G91 C;  3UTB D;  1F66 D;  3TU4 B;  2DQN C;  2ZM5 A;  3KUY C;  3A6N C;  3MGS C;  5BO0 B;  3X1T A;  1P3A A;  1P3O B;  3AZG D;  5B32 A;  3AZI C;  5AV9 B;  2ZY3 A;  5B0Y B;  4J8W A;  3REL C;  3MGQ A;  1P3L A;  2F2A C;  5B2J C;  1JFI A;  2Y2I A;  1KU5 A;  5B2I A;  3C1C B;  5DNM B;  4XZQ A;  2UWX A;  3AYW C;  3LZ1 D;  1U35 A;  4G92 B;  4H9S A;  3W99 B;  3REI A;  5F99 A;  3B0D C; 
#chains in the Genus database with same CATH homology
 3KUY D;  4ZUX B;  3A6N D;  4XUJ C;  3MGS D;  3REK B;  2FJ7 C;  1AOI B;  5B40 C;  3MNN A;  5DNN B;  3AZM B;  5KDM A;  5B31 C;  3O62 A;  3X1U B;  3WA9 A;  3AZI D;  1HQ3 B;  3AFA B;  3UTB A;  1F66 A;  5BS7 C;  3UT9 D;  5B24 D;  2JCH A;  5B2J D;  1P34 A;  5BNV B;  3AZG A;  1TAF A;  2CV5 B;  2CWE A;  5B1L C;  3AYW D;  5GSU C;  4NE3 A;  4R8P B;  3AZJ C;  2FJ7 D;  5B40 D;  3H0R C;  5GXQ B;  1KX4 B;  1BH8 A;  5FUG A;  1TZY C;  4QLC C;  3LZ1 A;  3EPK A;  2NZD C;  4YS3 B;  4DRB A;  3WTP E;  2L5A A;  3A6N A;  3MGS A;  3KUY A;  2JE5 A;  5CPK D;  3LZ0 C;  3EPL A;  3MGP C;  3W98 B;  2XD1 A;  4KUD B;  3AZI A;  5E5A B;  5GSU D;  5AV5 B;  3KXB C;  3FDD A;  3UTA B;  1M19 D;  3UT9 A;  5JA4 A;  4WU8 B;  5B24 A;  4KHA B;  4X23 C;  3C1B C;  1ID3 C;  3AZJ D;  5B2J A;  5CPJ D;  2Y2O A;  1P3A C;  3W96 B;  3R45 A;  4QLC D;  2Y2H A;  3AYW A;  2YFW B;  4Z2M H;  2NZD D;  5B32 C;  1ZLA C;  1HTA A;  4HGA C;  5B1M B;  4Z66 B;  4J8X C;  3REH B;  3V9R A;  4J8W C;  3VH5 T;  5JRG C;  2FJ7 A;  5B40 A;  3B6F C;  3LZ0 D;  4J8U B;  3WAA B;  1F1E A;  3KXB D;  3AZE B;  5BS7 A;  2YFV B;  4XZQ C;  1H3O A;  3AN2 B;  1R4V A;  2HIO B;  3X1S B;  3WTP C;  4X23 D;  3C1B D;  5CPK A;  1ID3 D;  4ZBJ B;  4WU9 B;  2Y2G A;  1P3B D;  2Y2N A;  4YM6 B;  3F6T A;  3MNN C;  5GSU A;  4CSR B;  4WZS B;  3O62 C;  1ZLA D;  3WA9 C;  4J8X D;  1M19 A;  3W97 B;  3UTB C;  3LEL B;  5JRG D;  3AZJ A;  3AV1 B;  4H9R B;  5CPJ A;  1EQZ C;  3B6F D;  5CP6 C;  3AZL B;  4QLC A;  3EG5 B;  1WWI A;  1W2E A;  1M18 C;  2NZD A;  2NQB C;  3LJA B;  2F8N K;  3MGR B;  1WWS A;  3B0B A;  3WTP D;  3AZF B;  3LZ0 A;  5GT3 D;  4J8V D;  4NFT A;  3VH6 W;  5B0Z B;  3KXB A;  2F8N D;  3TU4 C;  5GT0 B;  5AV6 B;  5G49 A;  1P3F B;  3LZ1 C;  1P3G B;  1M1A D;  3C1B A;  1P3O C;  4X23 A;  1ID3 A;  4KGC B;  3B6G D;  5B33 D;  1EQZ D;  5CP6 D;  5CPI B;  4CAY A;  2PYO D;  1P3B A;  4Z5T B;  2HUE B;  4UUZ B;  1M18 D;  2NQB D;  1ZLA A;  1P34 B;  4J8X A;  1P3K D;  5AVB B;  4LD9 B;  3MVD D;  5JRG A;  4WJ3 C;  3B6F A;  3UT9 C;  5B24 C;  3REJ B;  3C1C C;  3AZK B;  3TU4 D;  1KX3 B;  1P3I B;  3X1V B;  5AY8 B;  1P3M B;  5AV8 B;  3REK C;  3WTP A;  1P3O D;  1AOI C;  4M6B A;  2F8N H;  4G91 B;  1PZR A;  5GT3 A;  4J8V A;  2BYM A;  3VH5 W;  3X1U C;  4Z2M G;  2ZY5 A;  5AV9 D;  3AFA C;  2Y2P A;  3EPJ A;  2F8N A;  4H9P B;  5B31 G;  1BH9 B;  4NE6 A;  1M1A A;  2BYK B;  3NQU A;  3AZN B;  3B6G A;  1N1J A;  5B33 A;  3REL B;  1EQZ A;  5CP6 A;  4JJN B;  4E44 A;  2PYO A;  2ARO B;  5BNX B;  5DNM D;  3C1C D;  5CPK C;  1M18 A;  2NQB A;  3W99 D;  1P3K A;  1T3U A;  4ZUX D;  4R8P C;  1ULY A;  3MVD A;  3REK D;  1AOI D;  1M19 C;  1KX4 C;  4WNN B;  3VH6 T;  5DNN D;  3AZM D;  5CPJ C;  3X1U D;  4XUJ B;  1HQ3 D;  3NQJ B;  3AFA D;  3TU4 A;  5AVC B;  4YS3 C;  5BO0 A;  1B6W A;  5B31 B;  1P3O A;  1S32 B;  2ZY2 A;  2CV5 D;  4KUD C;  2JSS A;  5AV9 A;  3KWQ B;  3UTA C;  2Y2K A;  4WU8 C;  1P3P B;  4H9Q B;  4R8P D;  3AZH B;  5B1L B;  4H9O B;  5GXQ D;  2VQR A;  1KX4 D;  2W8S A;  3W96 C;  3AV2 B;  3C1C A;  5DNM A;  1B67 A;  2Y2L A;  3W99 A;  1P3B C;  3WKJ B;  4YS3 D;  5C3I C;  4ZUX A;  1TZY B;  4H9N B;  5B32 G;  3REK A;  1AOI A;  3VH5 A;  5DNN A;  3AZM A;  2IO5 C;  3W98 D;  4KUD D;  3X1U A;  1HQ3 A;  5E5A D;  3AFA A;  1KX5 B;  5AV5 D;  3AZE C;  3UTA D;  3AN2 C;  4WU8 D;  3MGP B;  4DRA A;  5BNV A;  4ZBJ C;  4EO5 C;  4AWL B;  3KFU G;  2CV5 A;  3W96 D;  4YM6 C;  5GT3 C;  2Y2Q A;  4J8V C;  5B1M D;  4Z66 D;  3REH D;  3X1T B;  1P3A B;  4R8P A;  3LEL C;  2F8N G;  2J8P A;  5GXQ A;  1KX4 A;  1M1A C;  5B32 B;  3AZL C;  4HGA B;  3B6G C;  4J8U D;  4J8W B;  5B33 C;  3WAA D;  2PYO C;  3MGQ B;  1P3L B;  3AZE D;  4DQY B;  3AN2 D;  4YS3 A;  3MGR C;  2HIO D;  3X1S D;  1JFI B;  2RVQ C;  1P3K C;  4WU9 D;  5B2I B;  3MVD C;  3W98 A;  4XZQ B;  4KUD A;  5CHL B;  4YM6 D;  1U35 B;  5E5A A;  2Y2M A;  5B0Z C;  5AV5 A;  3REI B;  5F99 B;  3UTA A;  5GT0 C;  5AV6 C;  3A1K A;  1P3G C;  3W97 D;  4WU8 A;  4KHA A;  3LEL D;  3AV1 D;  3MNN B;  5CPI C;  3AZL D;  5KDM B;  3W96 A;  3O62 B;  3WA9 B;  4Z5T C;  2HUE C;  3UTB B;  1F66 B;  2YFW A;  4WV4 B;  5B1M A;  5AV9 C;  5B0Y C;  4Z66 A;  3LJA D;  3REH A;  5AVB C;  3MGR D;  3AZF D;  3AZG B;  1TAF B;  2RVQ D;  5BT1 D;  4J8U A;  3WAA A;  5B0Z D;  3AZE A;  1KX3 C;  5DNM C;  5GT0 D;  2YFV A;  5AV6 D;  1P3I C;  3AN2 A;  1P3F D;  1P3G D;  3X1V C;  5AY8 C;  1P3M C;  2HIO A;  3X1S A;  3W99 C;  4G92 C;  4KGC D;  1BH8 B;  4ZUX C;  4WU9 A;  5CPI D;  5FUG B;  4Z5T D;  4YM6 A;  3LZ1 B;  3H0M C;  4CSR A;  5DNN C;  3AZM C;  4NE5 A;  1P34 D;  3KUY B;  3A6N B;  3MGS B;  3W97 A;  1HQ3 C;  5B0Y D;  5AVB D;  4LD9 D;  3LEL A;  3AZN C;  3AV1 A;  4H9R A;  4JJN C;  3AZL A;  3REJ D;  2ARO C;  3AZI B;  3AZK D;  2DF4 C;  2CV5 C;  1KX3 D;  3UT9 B;  5JA4 B;  3LJA A;  1P3I D;  5B24 B;  3IP4 C;  3MGR A;  5AY8 D;  3X1V D;  5AV8 D;  5B2J B;  1P3M D;  3AZF A;  3R45 B;  3AYW B;  5GXQ C;  3VH6 A;  5B0Z A;  5AVC C;  3B0C T;  3B0D B;  5GT0 A;  5AV6 A;  3V9R B;  1P3F A;  1P3G A;  1A7W A;  2FJ7 B;  5B40 B;  3AZN D;  4KGC A;  1S32 C;  3REL D;  5CPI A;  4JJN D;  1Q9C A;  2ARO D;  4Z5T A;  3KWQ C;  4UUZ A;  3W98 C;  1H3O B;  1P3P C;  5E5A C;  5B0Y A;  5AVB A;  5AV5 C;  4LD9 A;  3AZH C;  5CPK B;  3AV2 C;  3REJ A;  1Z2C B;  4E45 A;  3AZK A;  5GSU B;  4XUJ D;  1KX3 A;  1M19 B;  5AVC D;  1P3I A;  3WKJ C;  3KSY A;  3X1V A;  5AY8 A;  1P3M A;  5AV8 A;  5B31 D;  3AZJ B;  5CPJ B;  5B1M C;  4Z66 C;  3REH C;  1S32 D;  4QLC B;  3A1I A;  1KX5 C;  2NZD B;  3KWQ D;  4H9P A;  2LY8 A;  4J8U C;  1BH9 A;  3WAA C;  1P3P D;  2BYK A;  5B1L D;  3AZN A;  3AZH D;  3LZ0 B;  3REL A;  4AWL C;  4JJN A;  2HIO C;  3X1S C;  3AV2 D;  3H0L C;  2ARO A;  5BNX A;  3KXB B;  4WU9 C;  5G49 B;  3WKJ D;  3X1T C;  3C1B B;  2ZY4 A;  4X23 B;  1ID3 B;  1TZY D;  3W97 C;  4WNN A;  4CAY B;  1P3B B;  3AV1 C;  4UPK A;  5C3I B;  4XUJ A;  3NQJ A;  1KX5 D;  3MGQ C;  1P3L C;  1ZLA B;  4J8X B;  5AVC A;  2IO5 B;  5JRG B;  5B31 A;  3MGP D;  1BFM A;  3B6F B;  1S32 A;  3LJA C;  5B2I C;  2G5H C;  3AZF C;  1U35 C;  5BT1 C;  4H9S C;  3KWQ A;  3REI C;  5F99 C;  4EO5 B;  3EPH A;  1P3P A;  4H9Q A;  3X1T D;  1P3A D;  3WTP B;  3AL0 C;  2FFF B;  3AZH A;  5B1L A;  4H9O A;  2BG1 A;  1P3F C;  5GT3 B;  3B0C W;  5B32 D;  4J8V B;  2BYM B;  3AV2 A;  4KGC C;  4J8W D;  1F66 C;  2G5I C;  2F8N B;  3MGQ D;  1P3L D;  1M1A B;  3WKJ A;  3P5J B;  3NQU B;  1TZY A;  4H9N A;  3B6G B;  1N1J B;  2Y2J A;  5B33 B;  1P34 C;  1EQZ B;  5CP6 B;  3AZG C;  2PYO B;  4LD9 C;  5B2I D;  4XZQ D;  1U35 D;  1M18 B;  1KX5 A;  2NQB B;  3REI D;  3REJ C;  5F99 D;  1P3K B;  3AZK C;  2RIQ A;  3MVD B;  3MGP A;  3MNN D;  5AV8 C;  3O62 D;  3WA9 D;  2XD5 A;  4G91 C;  3UTB D;  1F66 D;  3TU4 B;  2DQN C;  2ZM5 A;  3KUY C;  3A6N C;  3MGS C;  5BO0 B;  3X1T A;  1P3A A;  1P3O B;  3AZG D;  5B32 A;  3AZI C;  5AV9 B;  2ZY3 A;  5B0Y B;  4J8W A;  3REL C;  3MGQ A;  1P3L A;  2F2A C;  5B2J C;  1JFI A;  2Y2I A;  1KU5 A;  5B2I A;  3C1C B;  5DNM B;  4XZQ A;  2UWX A;  3AYW C;  3LZ1 D;  1U35 A;  4G92 B;  4H9S A;  3W99 B;  3REI A;  5F99 A;  3B0D C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...