3B6FB

Nucleosome core particle treated with cisplatin
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
79
structure length
79
Chain Sequence
DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 147-MER DNA
publication title Site selectivity of platinum anticancer therapeutics
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 21
structure length 79
sequence length 79
chains with identical sequence F
ec nomenclature
pdb deposition date 2007-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3b6fB00
5C3IC 4KUDA 4YM6D 2HUEC 5DNMD 3B6GA 5G49A 4QLCD 4J8XD 4J8VD 2FJ7D 3MGQC 1P3MB 1P3GB 1KX5C 3A6NA 4JJNC 5B33D 5C3IB 1KX3A 4KGCB 5GSUD 1P3BB 4ZUXB 3AZKD 1P3PD 3UTBC 3O62A 5CPJA 3MGQB 1HTAA 3AN2B 1EQZC 2NQBA 5AV9B 3W99C 1A7WA 1BFMA 1KX4A 3W98A 4J8WB 4HGAB 3MGRC 1JFIB 5B40B 2F8NB 5B1MD 2RVQD 5DNMC 3X1TD 5CPKB 3AZEA 4WU8D 1P34A 2AROB 4J8XC 4J8VC 2FJ7C 1P3LA 1HQ3A 3MGPA 3MGRB 1ID3C 4YM6B 2PYOA 1P3PC 2CV5A 3MNNA 4QLCB 2FJ7B 2BYMA 4Z5TA 5B33B 3X1SB 1M1AB 5GSUB 3AZKB 3AZFD 1M18B 1H3OB 3AZGD 1S32A 3AZJD 4LD9D 3AZHC 5B1MC 4XZQC 3TU4D 4WU8C 3LZ1C 4H9OB 4UUZA 5CPIA 5AY8D 5B1LA 1AOID 5B1MB 3X1TB 3REIC 2JSSA 2HIOB 1P3IA 5JRGD 1P3GA 5B2JB 1ZLAD 2BYKB 3WKJC 3REKB 3AZGC 3W97B 5B2ID 3AZJC 3AZID 3MGQA 4LD9C 3TU4C 1KX5A 4JJNA 5B31D 3AZFB 5AY8C 1P3AB 3UTBA 4R8PC 5AVBD 1AOIC 2NZDD 5GT3C 3B0DB 4LD9B 1EQZA 3TU4B 3LJAD 2F8NA 3R45B 3W99A 5BO0A 3B6FC 3AZMB 3AFAB 3KWQB 3MGSB 5JRGC 4WU9D 1ZLAC 5DNMA 3NQUA 4J8XA 4J8VA 5B2IC 3VH6T 1P3MD 2FJ7A 4ZBJB 5JRGB 5B0ZD 1ID3A 3KUYC 1ZLAB 4KGCD 1P3BD 4ZUXD 5AV5C 5B31C 1P3PA 1P3FD 1H3OA 5AVBC 5AV8D 3AN2D 3AZIB 5BNVB 5AV9D 3LJAC 4Z2MG 4CAYB 5B31B 1BH8A 2YFVB 4J8WD 3X1VD 5AVBB 4WU9C 3AYWD 2NZDB 5B40D 1TZYD 3AZHA 3LJAB 5B1MA 4XZQA 2AROD 4WU8A 3LZ1A 1P3MC 3LZ0D 5B0ZC 4WU9B 2F8NH 4KGCC 5CHLB 4G92C 4ZUXC 1P3BC 3C1BD 3REIA 1P3FC 3NQJB 3AN2C 3UTAB 5AV9C 5B0ZB 3X1SD 5B0YD 1M19D 4Z66D 1M1AD 4G92B 1M18D 3REJD 4J8UB 3WKJA 4J8WC 4HGAC 1P3FB 3AZGA 1BH9B 3AYWC 5AV8B 5B40C 1TZYC 3AZJA 4LD9A 4X23D 3TU4A 5CPKC 3R45A 3RELB 2AROC 5GXQD 5KDMB 5AY8A 3LZ0C 1KU5A 3LELD 3X1VB 4R8PA 3AYWB 3B0CW 4YM6C 1TZYB 5GT3A 3AZLB 1AOIA 3VH5W 4QLCC 2IO5C 4H9QA 5BNXA 3UT9B 3B6FA 2HIOD 1Q9CA 3V9RA 3LZ0B 5B2JD 5B33C 5JRGA 3X1SC 5B0YC 1M19C 4Z66C 1M1AC 5GSUC 2YFWA 1ZLAA 3AZKC 5AV6B 1M18C 3REKD 2IO5B 3C1BB 3W97D 4G91C 4KHAA 1N1JB 5B2IA 4M6BA 5BNVA 4X23C 3WAAD 5B0YB 3KSYA 4Z66B 1M19B 3KUYA 1U35D 5AV5A 3REJB 4H9NA 1P3AD 2F8NG 3LELC 1F1EA 4G91B 5AVBA 3AV2D 2RVQC 5CP6D 4X23B 3X1TC 5JA4A 3LJAA 5GXQB 3AZMD 1F66D 2HIOC 3AFAD 4XUJB 3KWQD 3MGSD 3LELB 5B2JC 4H9RB 4WU9A 3VH5A 4E44A 1P3KD 4WV4B 3REKC 1KX3D 3W97C 3NQJA 3REHD 1P3MA 3W96B 3B0BA 5DNND 3WAAC 5B0ZA 5CPJD 3C1CD 4KGCA 1U35C 1P3BA 4H9PB 4ZUXA 3AZFC 1P3AC 1TAFB 1P3FA 5E5AD 3B0DC 1BH9A 3AV2C 3VH6A 3AN2A 3WA9D 5AV9A 3WAAB 1U35B 4NFTA 5B32D 3AZMC 3AFAC 1WWSA 2CWEA 3KWQC 1F66C 5FUGB 3MGSC 4J8WA 1JFIA 3AYWA 3AV2B 5B40A 1TZYA 5CP6B 1P3KC 5CPKA 2AROA 1F66B 4ZBJC 3REHC 3MVDD 3MNND 3LZ0A 3MGRA 5DNNC 4YM6A 3C1CC 1P3KB 3A6NB 2L5AA 4QLCA 1KX3B 5E5AC 3UTAD 3AZIC 4WZSB 3REHB 3WA9C 3WTPD 5DNNB 3X1SA 5B33A 3O62B 5B0YA 3C1CB 5CPJB 1M19A 5GSUA 1M1AA 4J8UD 3AZKA 5B32C 1M18A 1P3OD 5E5AB 2NZDC 3WA9B 5B1LD 3KXBD 4X23A 3RELD 2F8NK 4H9OA 5B32B 3MVDC 1WWIA 3AZEB 3LELA 4H9RA 3AZLD 1P3ID 1P3LB 1HQ3B 3MGPB 3X1TA 4EO5B 3UT9D 3UTAC 2HIOA 3MVDB 3WTPC 3MNNB 5B2JA 2BYMB 5AV6D 2BYKA 4Z5TB 4J8UC 5GT0D 1KX5D 4WNNB 3REKA 4JJND 1P3OC 5AVCD 1TAFA 3W97A 5AV8C 3WTPB 5B31G 3KXBC 3RELC 3WAAA 5F99D 1S32B 1EQZD 1U35A 3AZFA 1P3AA 3X1VC 1P3OB 3AZLC 5CPIB 1B6WA 3AV2A 5B1LB 3KXBB 3X1UD 3UT9C 4XUJD 3AZMA 1F66A 3AFAA 3KWQA 3MGSA 4AWLB 5AV6C 1P3IB 5GT0C 1P3KA 5B24D 3C1BC 1ID3D 5AVCC 2HUEB 4DRBA 3W96D 3AV1D 3REHA 5DNNA 5F99C 3C1CA 3REJC 5GT0B 2LY8A 1KX5B 4JJNB 5AVCB 5E5AA 3VH6W 3AZIA 3WA9A 4H9SC 3UTBB 5F99B 3X1UC 4CAYA 1EQZB 5GXQC 3AZHD 4YS3D 5B31A 4XZQD 5BS7C 5B32A 4XUJC 3W99B 2YFVA 3AZND 5BO0B 2NZDA 4NE6A 3LZ1D 5B24C 4KUDD 3X1UB 4CSRB 3B6GD 3W96C 5DNMB 3AV1C 3MVDA 3REID 3NQUB 4J8XB 4J8VB 3A6ND 5B24B 4WNNA 1ID3B 3UTAA 3WKJD 3AV1B 1P3PB 3WTPA 3O62D 2NQBD 4YS3C 4J8UA 3AZNC 1P3OA 5AV8A 1KX4D 3W98D 5CP6C 1BH8B 4R8PD 3KXBA 4KUDC 3RELA 5GT3D 3AZHB 4YS3B 4XZQB 5KDMA 3B6GC 3AZED 3AZNB 1P34D 3X1VA 4WU8B 4Z2MH 3B6FD 3LZ1B 3AZLA 1P3LD 1HQ3D 3A6NC 3MGPD 4KUDB 1KX3C 2PYOD 3UT9A 4DRAA 3B6GB 2CV5D 5G49B 3REIB 3O62C 1ULYA 5CPJC 4Z5TD 2NQBC 5AV6A 5GT0A 3C1BA 3KUYD 5AVCA 1N1JA 5AV5D 1KX4C 3W98C 3WKJB 3AZGB 3B0CT 1S32D 4Z66A 5F99A 3VH5T 2NQBB 3AZJB 3REJA 4NE3A 3AZEC 1R4VA 1P34C 5CPID 1KX4B 3W98B 1P3LC 5AY8B 1HQ3C 3MGPC 4H9SA 4EO5C 4R8PB 1AOIB 5GT3B 3X1UA 2PYOC 4CSRA 5GXQA 5BS7A 4XUJA 2CV5C 3MNNC 4H9QB 1P34B 5BNXB 3B6FB 4Z5TC 3V9RB 1P3GD 5BT1D 5B24A 2YFWB 2PYOB 2CV5B 3W96A 3AV1A 4E45A 4KHAB 1S32C 3MGQD 5B2IB 4H9PA 3KUYB 5AV5B 5CPIC 1B67A 4H9NB 5B1LC 3UTBD 5B32G 3WTPE 2F8ND 3W99D 5JA4B 4YS3A 5FUGA 4AWLC 5CPKD 3AZNA 4UUZB 1P3IC 5CP6A 1P3GC 4NE5A 3MGRD 5BT1C
chains in the Genus database with same CATH superfamily
5C3IC 4KUDA 4YM6D 2HUEC 5DNMD 2Y2OA 3B6GA 2UWXA 5G49A 4QLCD 4J8XD 4J8VD 2FJ7D 3MGQC 1P3MB 1P3GB 1KX5C 3A6NA 4JJNC 5B33D 5C3IB 1KX3A 4KGCB 5GSUD 1P3BB 4ZUXB 3AZKD 3AL0C 2Y2GA 1P3PD 3UTBC 2Y2NA 3O62A 5CPJA 3MGQB 1HTAA 3AN2B 1EQZC 2NQBA 5AV9B 2J8PA 3W99C 1A7WA 1BFMA 1KX4A 3W98A 4J8WB 4HGAB 3MGRC 1JFIB 2F2AC 5B40B 2F8NB 5B1MD 2RVQD 5DNMC 3X1TD 2FFFB 5CPKB 3AZEA 2Y2HA 4WU8D 1P34A 2AROB 4J8XC 4J8VC 2FJ7C 1P3LA 1HQ3A 3MGPA 3MGRB 1ID3C 4YM6B 2PYOA 1P3PC 2CV5A 3MNNA 4QLCB 2FJ7B 2BYMA 4Z5TA 5B33B 3X1SB 1M1AB 5GSUB 3AZKB 3AZFD 1M18B 2G5IC 1H3OB 3AZGD 1S32A 2Y2LA 3AZJD 4LD9D 3AZHC 5B1MC 4XZQC 3TU4D 2ZY5A 4WU8C 2G5HC 3P5JB 4H9OB 3LZ1C 4UUZA 5CPIA 5AY8D 5B1LA 1AOID 5B1MB 3X1TB 3A1KA 3REIC 2JSSA 4DQYB 2HIOB 1P3IA 5JRGD 1P3GA 5B2JB 1ZLAD 2BYKB 3WKJC 3REKB 3AZGC 3W97B 5B2ID 2BG1A 3AZID 3MGQA 3AZJC 4LD9C 3TU4C 1KX5A 4JJNA 5B31D 3AZFB 5AY8C 1P3AB 3UTBA 4R8PC 5AVBD 1AOIC 2NZDD 5GT3C 3B0DB 4LD9B 1EQZA 3TU4B 3LJAD 2F8NA 3R45B 3W99A 5BO0A 3B6FC 3AZMB 3AFAB 3KWQB 3MGSB 5JRGC 3F6TA 4WU9D 1ZLAC 5DNMA 3NQUA 4J8XA 4J8VA 5B2IC 3VH6T 1P3MD 2FJ7A 4ZBJB 5JRGB 5B0ZD 1ID3A 3KUYC 1ZLAB 4KGCD 1P3BD 4ZUXD 5AV5C 5B31C 1Z2CB 1P3PA 1P3FD 1H3OA 5AVBC 5AV8D 3AN2D 2Y2IA 3AZIB 5BNVB 5AV9D 3LJAC 4Z2MG 4CAYB 2JCHA 5B31B 1BH8A 2YFVB 4J8WD 3X1VD 5AVBB 4WU9C 3AYWD 2NZDB 5B40D 1TZYD 3AZHA 3KFUG 3LJAB 5B1MA 4XZQA 2AROD 4WU8A 3LZ1A 1P3MC 3LZ0D 5B0ZC 4WU9B 2F8NH 4KGCC 5CHLB 4G92C 4ZUXC 1P3BC 2Y2MA 3C1BD 3REIA 1P3FC 3NQJB 3AN2C 3UTAB 5AV9C 5B0ZB 3X1SD 5B0YD 1M19D 4Z66D 1M1AD 4G92B 1M18D 3REJD 4J8UB 3WKJA 4J8WC 4HGAC 1P3FB 3AZGA 1BH9B 3AYWC 5AV8B 5B40C 1TZYC 3H0LC 3AZJA 4LD9A 4X23D 3EPLA 3TU4A 5CPKC 3R45A 3RELB 2AROC 3FDDA 5GXQD 5KDMB 3EPKA 5AY8A 3H0MC 1KU5A 3LZ0C 3LELD 3X1VB 4R8PA 3AYWB 3B0CW 4YM6C 1TZYB 5GT3A 3AZLB 1AOIA 2Y2PA 3VH5W 2JE5A 4QLCC 2IO5C 4H9QA 5BNXA 3UT9B 3B6FA 2HIOD 1Q9CA 3V9RA 3LZ0B 5B2JD 5B33C 5JRGA 3X1SC 5B0YC 1M19C 2Y2JA 2RIQA 5GSUC 2YFWA 4Z66C 3AZKC 1M1AC 5AV6B 1ZLAA 1M18C 3REKD 2IO5B 3C1BB 3W97D 4G91C 4KHAA 1N1JB 5B2IA 4M6BA 5BNVA 4X23C 3WAAD 5B0YB 3KSYA 4Z66B 1M19B 3KUYA 1U35D 5AV5A 3REJB 4H9NA 1P3AD 2F8NG 3LELC 1F1EA 4G91B 5AVBA 2DQNC 3AV2D 2RVQC 5CP6D 4X23B 3X1TC 5JA4A 3LJAA 5GXQB 3AZMD 1F66D 2HIOC 3AFAD 4XUJB 3KWQD 3MGSD 3LELB 5B2JC 4H9RB 3A1IA 4WU9A 3VH5A 4E44A 1P3KD 4WV4B 3REKC 1KX3D 3W97C 3NQJA 3REHD 1P3MA 3W96B 3B0BA 5DNND 3WAAC 5B0ZA 5CPJD 3C1CD 4KGCA 1U35C 1P3BA 4H9PB 4ZUXA 3AZFC 1P3AC 1TAFB 1P3FA 3H0RC 5E5AD 3B0DC 1BH9A 3AV2C 3VH6A 3AN2A 3WA9D 1PZRA 2VQRA 5AV9A 3WAAB 1U35B 4NFTA 5B32D 3AZMC 3AFAC 1WWSA 2CWEA 3KWQC 1F66C 5FUGB 3MGSC 4J8WA 1JFIA 3AYWA 3AV2B 5B40A 1TZYA 5CP6B 1P3KC 5CPKA 1W2EA 2AROA 1F66B 4ZBJC 3REHC 3MVDD 3MNND 3LZ0A 3MGRA 5DNNC 4YM6A 3C1CC 1P3KB 3A6NB 2L5AA 4QLCA 1KX3B 5E5AC 3UTAD 3AZIC 4WZSB 3REHB 3WA9C 3WTPD 5DNNB 3X1SA 5B33A 3O62B 5B0YA 3C1CB 5CPJB 1M19A 5GSUA 1M1AA 4J8UD 3AZKA 5B32C 1M18A 1P3OD 5E5AB 2NZDC 3WA9B 5B1LD 3KXBD 4X23A 3RELD 2F8NK 4H9OA 5B32B 3MVDC 1WWIA 3AZEB 3LELA 4H9RA 3AZLD 1P3ID 1P3LB 1HQ3B 3MGPB 3X1TA 4EO5B 2DF4C 3IP4C 3UT9D 3UTAC 2ZM5A 2HIOA 3MVDB 3WTPC 3MNNB 5B2JA 2BYMB 5AV6D 4Z5TB 2BYKA 4J8UC 2XD5A 5GT0D 1KX5D 4WNNB 3REKA 4JJND 1P3OC 5AVCD 1TAFA 3W97A 5AV8C 3WTPB 5B31G 3KXBC 3RELC 3WAAA 5F99D 2ZY3A 1S32B 1EQZD 3EPJA 1U35A 3AZFA 1P3AA 3X1VC 1P3OB 3AZLC 5CPIB 1B6WA 3AV2A 5B1LB 3KXBB 3X1UD 3UT9C 3EG5B 2Y2KA 4XUJD 3AZMA 1F66A 3AFAA 3KWQA 3MGSA 4AWLB 5AV6C 1P3IB 2ZY4A 5GT0C 1P3KA 5B24D 3C1BC 1ID3D 5AVCC 2HUEB 4DRBA 3W96D 3AV1D 3REHA 5DNNA 5F99C 3C1CA 3REJC 2Y2QA 5GT0B 2LY8A 1KX5B 4JJNB 5AVCB 5E5AA 3VH6W 3AZIA 3WA9A 4H9SC 3UTBB 5F99B 3X1UC 4CAYA 1EQZB 5GXQC 3AZHD 5B31A 5BS7C 4XUJC 4XZQD 5B32A 4YS3D 3W99B 2YFVA 3AZND 5BO0B 2NZDA 4NE6A 3LZ1D 5B24C 4KUDD 3X1UB 4CSRB 3B6GD 3W96C 5DNMB 3AV1C 3MVDA 3REID 3NQUB 4J8XB 4J8VB 2ZY2A 3A6ND 5B24B 4WNNA 1ID3B 3UTAA 3WKJD 3AV1B 1T3UA 1P3PB 3WTPA 3O62D 2NQBD 4YS3C 4J8UA 3AZNC 1P3OA 5AV8A 1KX4D 3W98D 5CP6C 1BH8B 4R8PD 3KXBA 4KUDC 3RELA 5GT3D 3AZHB 4YS3B 4XZQB 5KDMA 3B6GC 3AZED 3AZNB 1P34D 3X1VA 4WU8B 4Z2MH 3B6FD 3LZ1B 3AZLA 1P3LD 1HQ3D 3A6NC 3MGPD 4KUDB 1KX3C 2PYOD 3UT9A 4DRAA 3B6GB 2CV5D 5G49B 3REIB 3O62C 4UPKA 1ULYA 5CPJC 2XD1A 4Z5TD 2NQBC 5AV6A 5GT0A 3C1BA 3KUYD 5AVCA 1N1JA 5AV5D 1KX4C 3W98C 3WKJB 3AZGB 3B0CT 1S32D 4Z66A 2W8SA 5F99A 3VH5T 2NQBB 3AZJB 3REJA 4NE3A 3AZEC 1R4VA 1P34C 5CPID 1KX4B 3W98B 1P3LC 5AY8B 1HQ3C 3MGPC 4H9SA 4EO5C 4R8PB 1AOIB 5GT3B 3X1UA 2PYOC 4CSRA 5GXQA 5BS7A 4XUJA 2CV5C 3MNNC 4H9QB 1P34B 5BNXB 3B6FB 4Z5TC 3V9RB 3EPHA 1P3GD 5BT1D 5B24A 2YFWB 2PYOB 2CV5B 3W96A 3AV1A 4E45A 4KHAB 1S32C 3MGQD 5B2IB 4H9PA 3KUYB 5AV5B 5CPIC 1B67A 4H9NB 5B1LC 3UTBD 5B32G 3WTPE 2F8ND 3W99D 5JA4B 4YS3A 5FUGA 4AWLC 5CPKD 3AZNA 4UUZB 1P3IC 4WJ3C 5CP6A 1P3GC 4NE5A 3MGRD 5BT1C
chains in the Genus database with same CATH topology
5C3IC 4KUDA 4YM6D 2HUEC 5DNMD 2Y2OA 3B6GA 2UWXA 5G49A 4QLCD 4J8XD 4J8VD 2FJ7D 3MGQC 1P3MB 1P3GB 1KX5C 3A6NA 4JJNC 5B33D 5C3IB 1KX3A 4KGCB 5GSUD 1P3BB 4ZUXB 3AZKD 3AL0C 2Y2GA 1P3PD 3UTBC 2Y2NA 3O62A 5CPJA 3MGQB 1HTAA 3AN2B 1EQZC 2NQBA 5AV9B 2J8PA 3W99C 1A7WA 1BFMA 1KX4A 3W98A 4J8WB 4HGAB 3MGRC 1JFIB 2F2AC 5B40B 2F8NB 5B1MD 2RVQD 5DNMC 3X1TD 2FFFB 5CPKB 3AZEA 2Y2HA 4WU8D 1P34A 2AROB 4J8XC 4J8VC 2FJ7C 1P3LA 1HQ3A 3MGPA 3MGRB 1ID3C 4YM6B 2PYOA 1P3PC 2CV5A 3MNNA 4QLCB 2FJ7B 2BYMA 4Z5TA 5B33B 3X1SB 1M1AB 5GSUB 3AZKB 3AZFD 1M18B 2G5IC 1H3OB 3AZGD 1S32A 2Y2LA 3AZJD 4LD9D 3AZHC 5B1MC 4XZQC 3TU4D 2ZY5A 4WU8C 2G5HC 3P5JB 4H9OB 3LZ1C 4UUZA 5CPIA 5AY8D 5B1LA 1AOID 5B1MB 3X1TB 3A1KA 3REIC 2JSSA 4DQYB 2HIOB 1P3IA 5JRGD 1P3GA 5B2JB 1ZLAD 2BYKB 3WKJC 3REKB 3AZGC 3W97B 5B2ID 2BG1A 3AZID 3MGQA 3AZJC 4LD9C 3TU4C 1KX5A 4JJNA 5B31D 3AZFB 5AY8C 1P3AB 3UTBA 4R8PC 5AVBD 1AOIC 2NZDD 5GT3C 3B0DB 4LD9B 1EQZA 3TU4B 3LJAD 2F8NA 3R45B 3W99A 5BO0A 3B6FC 3AZMB 3AFAB 3KWQB 3MGSB 5JRGC 3F6TA 4WU9D 1ZLAC 5DNMA 3NQUA 4J8XA 4J8VA 5B2IC 3VH6T 1P3MD 2FJ7A 4ZBJB 5JRGB 5B0ZD 1ID3A 3KUYC 1ZLAB 4KGCD 1P3BD 4ZUXD 5AV5C 5B31C 1Z2CB 1P3PA 1P3FD 1H3OA 5AVBC 5AV8D 3AN2D 2Y2IA 3AZIB 5BNVB 5AV9D 3LJAC 4Z2MG 4CAYB 2JCHA 5B31B 1BH8A 2YFVB 4J8WD 3X1VD 5AVBB 4WU9C 3AYWD 2NZDB 5B40D 1TZYD 3AZHA 3KFUG 3LJAB 5B1MA 4XZQA 2AROD 4WU8A 3LZ1A 1P3MC 3LZ0D 5B0ZC 4WU9B 2F8NH 4KGCC 5CHLB 4G92C 4ZUXC 1P3BC 2Y2MA 3C1BD 3REIA 1P3FC 3NQJB 3AN2C 3UTAB 5AV9C 5B0ZB 3X1SD 5B0YD 1M19D 4Z66D 1M1AD 4G92B 1M18D 3REJD 4J8UB 3WKJA 4J8WC 4HGAC 1P3FB 3AZGA 1BH9B 3AYWC 5AV8B 5B40C 1TZYC 3H0LC 3AZJA 4LD9A 4X23D 3EPLA 3TU4A 5CPKC 3R45A 3RELB 2AROC 3FDDA 5GXQD 5KDMB 3EPKA 5AY8A 3H0MC 1KU5A 3LZ0C 3LELD 3X1VB 4R8PA 3AYWB 3B0CW 4YM6C 1TZYB 5GT3A 3AZLB 1AOIA 2Y2PA 3VH5W 2JE5A 4QLCC 2IO5C 4H9QA 5BNXA 3UT9B 3B6FA 2HIOD 1Q9CA 3V9RA 3LZ0B 5B2JD 5B33C 5JRGA 3X1SC 5B0YC 1M19C 2Y2JA 2RIQA 5GSUC 2YFWA 4Z66C 3AZKC 1M1AC 5AV6B 1ZLAA 1M18C 3REKD 2IO5B 3C1BB 3W97D 4G91C 4KHAA 1N1JB 5B2IA 4M6BA 5BNVA 4X23C 3WAAD 5B0YB 3KSYA 4Z66B 1M19B 3KUYA 1U35D 5AV5A 3REJB 4H9NA 1P3AD 2F8NG 3LELC 1F1EA 4G91B 5AVBA 2DQNC 3AV2D 2RVQC 5CP6D 4X23B 3X1TC 5JA4A 3LJAA 5GXQB 3AZMD 1F66D 2HIOC 3AFAD 4XUJB 3KWQD 3MGSD 3LELB 5B2JC 4H9RB 3A1IA 4WU9A 3VH5A 4E44A 1P3KD 4WV4B 3REKC 1KX3D 3W97C 3NQJA 3REHD 1P3MA 3W96B 3B0BA 5DNND 3WAAC 5B0ZA 5CPJD 3C1CD 4KGCA 1U35C 1P3BA 4H9PB 4ZUXA 3AZFC 1P3AC 1TAFB 1P3FA 3H0RC 5E5AD 3B0DC 1BH9A 3AV2C 3VH6A 3AN2A 3WA9D 1PZRA 2VQRA 5AV9A 3WAAB 1U35B 4NFTA 5B32D 3AZMC 3AFAC 1WWSA 2CWEA 3KWQC 1F66C 5FUGB 3MGSC 4J8WA 1JFIA 3AYWA 3AV2B 5B40A 1TZYA 5CP6B 1P3KC 5CPKA 1W2EA 2AROA 1F66B 4ZBJC 3REHC 3MVDD 3MNND 3LZ0A 3MGRA 5DNNC 4YM6A 3C1CC 1P3KB 3A6NB 2L5AA 4QLCA 1KX3B 5E5AC 3UTAD 3AZIC 4WZSB 3REHB 3WA9C 3WTPD 5DNNB 3X1SA 5B33A 3O62B 5B0YA 3C1CB 5CPJB 1M19A 5GSUA 1M1AA 4J8UD 3AZKA 5B32C 1M18A 1P3OD 5E5AB 2NZDC 3WA9B 5B1LD 3KXBD 4X23A 3RELD 2F8NK 4H9OA 5B32B 3MVDC 1WWIA 3AZEB 3LELA 4H9RA 3AZLD 1P3ID 1P3LB 1HQ3B 3MGPB 3X1TA 4EO5B 2DF4C 3IP4C 3UT9D 3UTAC 2ZM5A 2HIOA 3MVDB 3WTPC 3MNNB 5B2JA 2BYMB 5AV6D 4Z5TB 2BYKA 4J8UC 2XD5A 5GT0D 1KX5D 4WNNB 3REKA 4JJND 1P3OC 5AVCD 1TAFA 3W97A 5AV8C 3WTPB 5B31G 3KXBC 3RELC 3WAAA 5F99D 2ZY3A 1S32B 1EQZD 3EPJA 1U35A 3AZFA 1P3AA 3X1VC 1P3OB 3AZLC 5CPIB 1B6WA 3AV2A 5B1LB 3KXBB 3X1UD 3UT9C 3EG5B 2Y2KA 4XUJD 3AZMA 1F66A 3AFAA 3KWQA 3MGSA 4AWLB 5AV6C 1P3IB 2ZY4A 5GT0C 1P3KA 5B24D 3C1BC 1ID3D 5AVCC 2HUEB 4DRBA 3W96D 3AV1D 3REHA 5DNNA 5F99C 3C1CA 3REJC 2Y2QA 5GT0B 2LY8A 1KX5B 4JJNB 5AVCB 5E5AA 3VH6W 3AZIA 3WA9A 4H9SC 3UTBB 5F99B 3X1UC 4CAYA 1EQZB 5GXQC 3AZHD 5B31A 5BS7C 4XUJC 4XZQD 5B32A 4YS3D 3W99B 2YFVA 3AZND 5BO0B 2NZDA 4NE6A 3LZ1D 5B24C 4KUDD 3X1UB 4CSRB 3B6GD 3W96C 5DNMB 3AV1C 3MVDA 3REID 3NQUB 4J8XB 4J8VB 2ZY2A 3A6ND 5B24B 4WNNA 1ID3B 3UTAA 3WKJD 3AV1B 1T3UA 1P3PB 3WTPA 3O62D 2NQBD 4YS3C 4J8UA 3AZNC 1P3OA 5AV8A 1KX4D 3W98D 5CP6C 1BH8B 4R8PD 3KXBA 4KUDC 3RELA 5GT3D 3AZHB 4YS3B 4XZQB 5KDMA 3B6GC 3AZED 3AZNB 1P34D 3X1VA 4WU8B 4Z2MH 3B6FD 3LZ1B 3AZLA 1P3LD 1HQ3D 3A6NC 3MGPD 4KUDB 1KX3C 2PYOD 3UT9A 4DRAA 3B6GB 2CV5D 5G49B 3REIB 3O62C 4UPKA 1ULYA 5CPJC 2XD1A 4Z5TD 2NQBC 5AV6A 5GT0A 3C1BA 3KUYD 5AVCA 1N1JA 5AV5D 1KX4C 3W98C 3WKJB 3AZGB 3B0CT 1S32D 4Z66A 2W8SA 5F99A 3VH5T 2NQBB 3AZJB 3REJA 4NE3A 3AZEC 1R4VA 1P34C 5CPID 1KX4B 3W98B 1P3LC 5AY8B 1HQ3C 3MGPC 4H9SA 4EO5C 4R8PB 1AOIB 5GT3B 3X1UA 2PYOC 4CSRA 5GXQA 5BS7A 4XUJA 2CV5C 3MNNC 4H9QB 1P34B 5BNXB 3B6FB 4Z5TC 3V9RB 3EPHA 1P3GD 5BT1D 5B24A 2YFWB 2PYOB 2CV5B 3W96A 3AV1A 4E45A 4KHAB 1S32C 3MGQD 5B2IB 4H9PA 3KUYB 5AV5B 5CPIC 1B67A 4H9NB 5B1LC 3UTBD 5B32G 3WTPE 2F8ND 3W99D 5JA4B 4YS3A 5FUGA 4AWLC 5CPKD 3AZNA 4UUZB 1P3IC 4WJ3C 5CP6A 1P3GC 4NE5A 3MGRD 5BT1C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C3I C;  4KUD A;  4YM6 D;  2HUE C;  5DNM D;  3B6G A;  5G49 A;  4QLC D;  4J8X D;  4J8V D;  2FJ7 D;  3MGQ C;  1P3M B;  1P3G B;  1KX5 C;  3A6N A;  4JJN C;  5B33 D;  5C3I B;  1KX3 A;  4KGC B;  5GSU D;  1P3B B;  4ZUX B;  3AZK D;  1P3P D;  3UTB C;  3O62 A;  5CPJ A;  3MGQ B;  1HTA A;  3AN2 B;  1EQZ C;  2NQB A;  5AV9 B;  3W99 C;  1A7W A;  1BFM A;  1KX4 A;  3W98 A;  4J8W B;  4HGA B;  3MGR C;  1JFI B;  5B40 B;  2F8N B;  5B1M D;  2RVQ D;  5DNM C;  3X1T D;  5CPK B;  3AZE A;  4WU8 D;  1P34 A;  2ARO B;  4J8X C;  4J8V C;  2FJ7 C;  1P3L A;  1HQ3 A;  3MGP A;  3MGR B;  1ID3 C;  4YM6 B;  2PYO A;  1P3P C;  2CV5 A;  3MNN A;  4QLC B;  2FJ7 B;  2BYM A;  4Z5T A;  5B33 B;  3X1S B;  1M1A B;  5GSU B;  3AZK B;  3AZF D;  1M18 B;  1H3O B;  3AZG D;  1S32 A;  3AZJ D;  4LD9 D;  3AZH C;  5B1M C;  4XZQ C;  3TU4 D;  4WU8 C;  3LZ1 C;  4H9O B;  4UUZ A;  5CPI A;  5AY8 D;  5B1L A;  1AOI D;  5B1M B;  3X1T B;  3REI C;  2JSS A;  2HIO B;  1P3I A;  5JRG D;  1P3G A;  5B2J B;  1ZLA D;  2BYK B;  3WKJ C;  3REK B;  3AZG C;  3W97 B;  5B2I D;  3AZJ C;  3AZI D;  3MGQ A;  4LD9 C;  3TU4 C;  1KX5 A;  4JJN A;  5B31 D;  3AZF B;  5AY8 C;  1P3A B;  3UTB A;  4R8P C;  5AVB D;  1AOI C;  2NZD D;  5GT3 C;  3B0D B;  4LD9 B;  1EQZ A;  3TU4 B;  3LJA D;  2F8N A;  3R45 B;  3W99 A;  5BO0 A;  3B6F C;  3AZM B;  3AFA B;  3KWQ B;  3MGS B;  5JRG C;  4WU9 D;  1ZLA C;  5DNM A;  3NQU A;  4J8X A;  4J8V A;  5B2I C;  3VH6 T;  1P3M D;  2FJ7 A;  4ZBJ B;  5JRG B;  5B0Z D;  1ID3 A;  3KUY C;  1ZLA B;  4KGC D;  1P3B D;  4ZUX D;  5AV5 C;  5B31 C;  1P3P A;  1P3F D;  1H3O A;  5AVB C;  5AV8 D;  3AN2 D;  3AZI B;  5BNV B;  5AV9 D;  3LJA C;  4Z2M G;  4CAY B;  5B31 B;  1BH8 A;  2YFV B;  4J8W D;  3X1V D;  5AVB B;  4WU9 C;  3AYW D;  2NZD B;  5B40 D;  1TZY D;  3AZH A;  3LJA B;  5B1M A;  4XZQ A;  2ARO D;  4WU8 A;  3LZ1 A;  1P3M C;  3LZ0 D;  5B0Z C;  4WU9 B;  2F8N H;  4KGC C;  5CHL B;  4G92 C;  4ZUX C;  1P3B C;  3C1B D;  3REI A;  1P3F C;  3NQJ B;  3AN2 C;  3UTA B;  5AV9 C;  5B0Z B;  3X1S D;  5B0Y D;  1M19 D;  4Z66 D;  1M1A D;  4G92 B;  1M18 D;  3REJ D;  4J8U B;  3WKJ A;  4J8W C;  4HGA C;  1P3F B;  3AZG A;  1BH9 B;  3AYW C;  5AV8 B;  5B40 C;  1TZY C;  3AZJ A;  4LD9 A;  4X23 D;  3TU4 A;  5CPK C;  3R45 A;  3REL B;  2ARO C;  5GXQ D;  5KDM B;  5AY8 A;  3LZ0 C;  1KU5 A;  3LEL D;  3X1V B;  4R8P A;  3AYW B;  3B0C W;  4YM6 C;  1TZY B;  5GT3 A;  3AZL B;  1AOI A;  3VH5 W;  4QLC C;  2IO5 C;  4H9Q A;  5BNX A;  3UT9 B;  3B6F A;  2HIO D;  1Q9C A;  3V9R A;  3LZ0 B;  5B2J D;  5B33 C;  5JRG A;  3X1S C;  5B0Y C;  1M19 C;  4Z66 C;  1M1A C;  5GSU C;  2YFW A;  1ZLA A;  3AZK C;  5AV6 B;  1M18 C;  3REK D;  2IO5 B;  3C1B B;  3W97 D;  4G91 C;  4KHA A;  1N1J B;  5B2I A;  4M6B A;  5BNV A;  4X23 C;  3WAA D;  5B0Y B;  3KSY A;  4Z66 B;  1M19 B;  3KUY A;  1U35 D;  5AV5 A;  3REJ B;  4H9N A;  1P3A D;  2F8N G;  3LEL C;  1F1E A;  4G91 B;  5AVB A;  3AV2 D;  2RVQ C;  5CP6 D;  4X23 B;  3X1T C;  5JA4 A;  3LJA A;  5GXQ B;  3AZM D;  1F66 D;  2HIO C;  3AFA D;  4XUJ B;  3KWQ D;  3MGS D;  3LEL B;  5B2J C;  4H9R B;  4WU9 A;  3VH5 A;  4E44 A;  1P3K D;  4WV4 B;  3REK C;  1KX3 D;  3W97 C;  3NQJ A;  3REH D;  1P3M A;  3W96 B;  3B0B A;  5DNN D;  3WAA C;  5B0Z A;  5CPJ D;  3C1C D;  4KGC A;  1U35 C;  1P3B A;  4H9P B;  4ZUX A;  3AZF C;  1P3A C;  1TAF B;  1P3F A;  5E5A D;  3B0D C;  1BH9 A;  3AV2 C;  3VH6 A;  3AN2 A;  3WA9 D;  5AV9 A;  3WAA B;  1U35 B;  4NFT A;  5B32 D;  3AZM C;  3AFA C;  1WWS A;  2CWE A;  3KWQ C;  1F66 C;  5FUG B;  3MGS C;  4J8W A;  1JFI A;  3AYW A;  3AV2 B;  5B40 A;  1TZY A;  5CP6 B;  1P3K C;  5CPK A;  2ARO A;  1F66 B;  4ZBJ C;  3REH C;  3MVD D;  3MNN D;  3LZ0 A;  3MGR A;  5DNN C;  4YM6 A;  3C1C C;  1P3K B;  3A6N B;  2L5A A;  4QLC A;  1KX3 B;  5E5A C;  3UTA D;  3AZI C;  4WZS B;  3REH B;  3WA9 C;  3WTP D;  5DNN B;  3X1S A;  5B33 A;  3O62 B;  5B0Y A;  3C1C B;  5CPJ B;  1M19 A;  5GSU A;  1M1A A;  4J8U D;  3AZK A;  5B32 C;  1M18 A;  1P3O D;  5E5A B;  2NZD C;  3WA9 B;  5B1L D;  3KXB D;  4X23 A;  3REL D;  2F8N K;  4H9O A;  5B32 B;  3MVD C;  1WWI A;  3AZE B;  3LEL A;  4H9R A;  3AZL D;  1P3I D;  1P3L B;  1HQ3 B;  3MGP B;  3X1T A;  4EO5 B;  3UT9 D;  3UTA C;  2HIO A;  3MVD B;  3WTP C;  3MNN B;  5B2J A;  2BYM B;  5AV6 D;  2BYK A;  4Z5T B;  4J8U C;  5GT0 D;  1KX5 D;  4WNN B;  3REK A;  4JJN D;  1P3O C;  5AVC D;  1TAF A;  3W97 A;  5AV8 C;  3WTP B;  5B31 G;  3KXB C;  3REL C;  3WAA A;  5F99 D;  1S32 B;  1EQZ D;  1U35 A;  3AZF A;  1P3A A;  3X1V C;  1P3O B;  3AZL C;  5CPI B;  1B6W A;  3AV2 A;  5B1L B;  3KXB B;  3X1U D;  3UT9 C;  4XUJ D;  3AZM A;  1F66 A;  3AFA A;  3KWQ A;  3MGS A;  4AWL B;  5AV6 C;  1P3I B;  5GT0 C;  1P3K A;  5B24 D;  3C1B C;  1ID3 D;  5AVC C;  2HUE B;  4DRB A;  3W96 D;  3AV1 D;  3REH A;  5DNN A;  5F99 C;  3C1C A;  3REJ C;  5GT0 B;  2LY8 A;  1KX5 B;  4JJN B;  5AVC B;  5E5A A;  3VH6 W;  3AZI A;  3WA9 A;  4H9S C;  3UTB B;  5F99 B;  3X1U C;  4CAY A;  1EQZ B;  5GXQ C;  3AZH D;  4YS3 D;  5B31 A;  4XZQ D;  5BS7 C;  5B32 A;  4XUJ C;  3W99 B;  2YFV A;  3AZN D;  5BO0 B;  2NZD A;  4NE6 A;  3LZ1 D;  5B24 C;  4KUD D;  3X1U B;  4CSR B;  3B6G D;  3W96 C;  5DNM B;  3AV1 C;  3MVD A;  3REI D;  3NQU B;  4J8X B;  4J8V B;  3A6N D;  5B24 B;  4WNN A;  1ID3 B;  3UTA A;  3WKJ D;  3AV1 B;  1P3P B;  3WTP A;  3O62 D;  2NQB D;  4YS3 C;  4J8U A;  3AZN C;  1P3O A;  5AV8 A;  1KX4 D;  3W98 D;  5CP6 C;  1BH8 B;  4R8P D;  3KXB A;  4KUD C;  3REL A;  5GT3 D;  3AZH B;  4YS3 B;  4XZQ B;  5KDM A;  3B6G C;  3AZE D;  3AZN B;  1P34 D;  3X1V A;  4WU8 B;  4Z2M H;  3B6F D;  3LZ1 B;  3AZL A;  1P3L D;  1HQ3 D;  3A6N C;  3MGP D;  4KUD B;  1KX3 C;  2PYO D;  3UT9 A;  4DRA A;  3B6G B;  2CV5 D;  5G49 B;  3REI B;  3O62 C;  1ULY A;  5CPJ C;  4Z5T D;  2NQB C;  5AV6 A;  5GT0 A;  3C1B A;  3KUY D;  5AVC A;  1N1J A;  5AV5 D;  1KX4 C;  3W98 C;  3WKJ B;  3AZG B;  3B0C T;  1S32 D;  4Z66 A;  5F99 A;  3VH5 T;  2NQB B;  3AZJ B;  3REJ A;  4NE3 A;  3AZE C;  1R4V A;  1P34 C;  5CPI D;  1KX4 B;  3W98 B;  1P3L C;  5AY8 B;  1HQ3 C;  3MGP C;  4H9S A;  4EO5 C;  4R8P B;  1AOI B;  5GT3 B;  3X1U A;  2PYO C;  4CSR A;  5GXQ A;  5BS7 A;  4XUJ A;  2CV5 C;  3MNN C;  4H9Q B;  1P34 B;  5BNX B;  3B6F B;  4Z5T C;  3V9R B;  1P3G D;  5BT1 D;  5B24 A;  2YFW B;  2PYO B;  2CV5 B;  3W96 A;  3AV1 A;  4E45 A;  4KHA B;  1S32 C;  3MGQ D;  5B2I B;  4H9P A;  3KUY B;  5AV5 B;  5CPI C;  1B67 A;  4H9N B;  5B1L C;  3UTB D;  5B32 G;  3WTP E;  2F8N D;  3W99 D;  5JA4 B;  4YS3 A;  5FUG A;  4AWL C;  5CPK D;  3AZN A;  4UUZ B;  1P3I C;  5CP6 A;  1P3G C;  4NE5 A;  3MGR D;  5BT1 C; 
#chains in the Genus database with same CATH topology
 5C3I C;  4KUD A;  4YM6 D;  2HUE C;  5DNM D;  2Y2O A;  3B6G A;  2UWX A;  5G49 A;  4QLC D;  4J8X D;  4J8V D;  2FJ7 D;  3MGQ C;  1P3M B;  1P3G B;  1KX5 C;  3A6N A;  4JJN C;  5B33 D;  5C3I B;  1KX3 A;  4KGC B;  5GSU D;  1P3B B;  4ZUX B;  3AZK D;  3AL0 C;  2Y2G A;  1P3P D;  3UTB C;  2Y2N A;  3O62 A;  5CPJ A;  3MGQ B;  1HTA A;  3AN2 B;  1EQZ C;  2NQB A;  5AV9 B;  2J8P A;  3W99 C;  1A7W A;  1BFM A;  1KX4 A;  3W98 A;  4J8W B;  4HGA B;  3MGR C;  1JFI B;  2F2A C;  5B40 B;  2F8N B;  5B1M D;  2RVQ D;  5DNM C;  3X1T D;  2FFF B;  5CPK B;  3AZE A;  2Y2H A;  4WU8 D;  1P34 A;  2ARO B;  4J8X C;  4J8V C;  2FJ7 C;  1P3L A;  1HQ3 A;  3MGP A;  3MGR B;  1ID3 C;  4YM6 B;  2PYO A;  1P3P C;  2CV5 A;  3MNN A;  4QLC B;  2FJ7 B;  2BYM A;  4Z5T A;  5B33 B;  3X1S B;  1M1A B;  5GSU B;  3AZK B;  3AZF D;  1M18 B;  2G5I C;  1H3O B;  3AZG D;  1S32 A;  2Y2L A;  3AZJ D;  4LD9 D;  3AZH C;  5B1M C;  4XZQ C;  3TU4 D;  2ZY5 A;  4WU8 C;  2G5H C;  3P5J B;  4H9O B;  3LZ1 C;  4UUZ A;  5CPI A;  5AY8 D;  5B1L A;  1AOI D;  5B1M B;  3X1T B;  3A1K A;  3REI C;  2JSS A;  4DQY B;  2HIO B;  1P3I A;  5JRG D;  1P3G A;  5B2J B;  1ZLA D;  2BYK B;  3WKJ C;  3REK B;  3AZG C;  3W97 B;  5B2I D;  2BG1 A;  3AZI D;  3MGQ A;  3AZJ C;  4LD9 C;  3TU4 C;  1KX5 A;  4JJN A;  5B31 D;  3AZF B;  5AY8 C;  1P3A B;  3UTB A;  4R8P C;  5AVB D;  1AOI C;  2NZD D;  5GT3 C;  3B0D B;  4LD9 B;  1EQZ A;  3TU4 B;  3LJA D;  2F8N A;  3R45 B;  3W99 A;  5BO0 A;  3B6F C;  3AZM B;  3AFA B;  3KWQ B;  3MGS B;  5JRG C;  3F6T A;  4WU9 D;  1ZLA C;  5DNM A;  3NQU A;  4J8X A;  4J8V A;  5B2I C;  3VH6 T;  1P3M D;  2FJ7 A;  4ZBJ B;  5JRG B;  5B0Z D;  1ID3 A;  3KUY C;  1ZLA B;  4KGC D;  1P3B D;  4ZUX D;  5AV5 C;  5B31 C;  1Z2C B;  1P3P A;  1P3F D;  1H3O A;  5AVB C;  5AV8 D;  3AN2 D;  2Y2I A;  3AZI B;  5BNV B;  5AV9 D;  3LJA C;  4Z2M G;  4CAY B;  2JCH A;  5B31 B;  1BH8 A;  2YFV B;  4J8W D;  3X1V D;  5AVB B;  4WU9 C;  3AYW D;  2NZD B;  5B40 D;  1TZY D;  3AZH A;  3KFU G;  3LJA B;  5B1M A;  4XZQ A;  2ARO D;  4WU8 A;  3LZ1 A;  1P3M C;  3LZ0 D;  5B0Z C;  4WU9 B;  2F8N H;  4KGC C;  5CHL B;  4G92 C;  4ZUX C;  1P3B C;  2Y2M A;  3C1B D;  3REI A;  1P3F C;  3NQJ B;  3AN2 C;  3UTA B;  5AV9 C;  5B0Z B;  3X1S D;  5B0Y D;  1M19 D;  4Z66 D;  1M1A D;  4G92 B;  1M18 D;  3REJ D;  4J8U B;  3WKJ A;  4J8W C;  4HGA C;  1P3F B;  3AZG A;  1BH9 B;  3AYW C;  5AV8 B;  5B40 C;  1TZY C;  3H0L C;  3AZJ A;  4LD9 A;  4X23 D;  3EPL A;  3TU4 A;  5CPK C;  3R45 A;  3REL B;  2ARO C;  3FDD A;  5GXQ D;  5KDM B;  3EPK A;  5AY8 A;  3H0M C;  1KU5 A;  3LZ0 C;  3LEL D;  3X1V B;  4R8P A;  3AYW B;  3B0C W;  4YM6 C;  1TZY B;  5GT3 A;  3AZL B;  1AOI A;  2Y2P A;  3VH5 W;  2JE5 A;  4QLC C;  2IO5 C;  4H9Q A;  5BNX A;  3UT9 B;  3B6F A;  2HIO D;  1Q9C A;  3V9R A;  3LZ0 B;  5B2J D;  5B33 C;  5JRG A;  3X1S C;  5B0Y C;  1M19 C;  2Y2J A;  2RIQ A;  5GSU C;  2YFW A;  4Z66 C;  3AZK C;  1M1A C;  5AV6 B;  1ZLA A;  1M18 C;  3REK D;  2IO5 B;  3C1B B;  3W97 D;  4G91 C;  4KHA A;  1N1J B;  5B2I A;  4M6B A;  5BNV A;  4X23 C;  3WAA D;  5B0Y B;  3KSY A;  4Z66 B;  1M19 B;  3KUY A;  1U35 D;  5AV5 A;  3REJ B;  4H9N A;  1P3A D;  2F8N G;  3LEL C;  1F1E A;  4G91 B;  5AVB A;  2DQN C;  3AV2 D;  2RVQ C;  5CP6 D;  4X23 B;  3X1T C;  5JA4 A;  3LJA A;  5GXQ B;  3AZM D;  1F66 D;  2HIO C;  3AFA D;  4XUJ B;  3KWQ D;  3MGS D;  3LEL B;  5B2J C;  4H9R B;  3A1I A;  4WU9 A;  3VH5 A;  4E44 A;  1P3K D;  4WV4 B;  3REK C;  1KX3 D;  3W97 C;  3NQJ A;  3REH D;  1P3M A;  3W96 B;  3B0B A;  5DNN D;  3WAA C;  5B0Z A;  5CPJ D;  3C1C D;  4KGC A;  1U35 C;  1P3B A;  4H9P B;  4ZUX A;  3AZF C;  1P3A C;  1TAF B;  1P3F A;  3H0R C;  5E5A D;  3B0D C;  1BH9 A;  3AV2 C;  3VH6 A;  3AN2 A;  3WA9 D;  1PZR A;  2VQR A;  5AV9 A;  3WAA B;  1U35 B;  4NFT A;  5B32 D;  3AZM C;  3AFA C;  1WWS A;  2CWE A;  3KWQ C;  1F66 C;  5FUG B;  3MGS C;  4J8W A;  1JFI A;  3AYW A;  3AV2 B;  5B40 A;  1TZY A;  5CP6 B;  1P3K C;  5CPK A;  1W2E A;  2ARO A;  1F66 B;  4ZBJ C;  3REH C;  3MVD D;  3MNN D;  3LZ0 A;  3MGR A;  5DNN C;  4YM6 A;  3C1C C;  1P3K B;  3A6N B;  2L5A A;  4QLC A;  1KX3 B;  5E5A C;  3UTA D;  3AZI C;  4WZS B;  3REH B;  3WA9 C;  3WTP D;  5DNN B;  3X1S A;  5B33 A;  3O62 B;  5B0Y A;  3C1C B;  5CPJ B;  1M19 A;  5GSU A;  1M1A A;  4J8U D;  3AZK A;  5B32 C;  1M18 A;  1P3O D;  5E5A B;  2NZD C;  3WA9 B;  5B1L D;  3KXB D;  4X23 A;  3REL D;  2F8N K;  4H9O A;  5B32 B;  3MVD C;  1WWI A;  3AZE B;  3LEL A;  4H9R A;  3AZL D;  1P3I D;  1P3L B;  1HQ3 B;  3MGP B;  3X1T A;  4EO5 B;  2DF4 C;  3IP4 C;  3UT9 D;  3UTA C;  2ZM5 A;  2HIO A;  3MVD B;  3WTP C;  3MNN B;  5B2J A;  2BYM B;  5AV6 D;  4Z5T B;  2BYK A;  4J8U C;  2XD5 A;  5GT0 D;  1KX5 D;  4WNN B;  3REK A;  4JJN D;  1P3O C;  5AVC D;  1TAF A;  3W97 A;  5AV8 C;  3WTP B;  5B31 G;  3KXB C;  3REL C;  3WAA A;  5F99 D;  2ZY3 A;  1S32 B;  1EQZ D;  3EPJ A;  1U35 A;  3AZF A;  1P3A A;  3X1V C;  1P3O B;  3AZL C;  5CPI B;  1B6W A;  3AV2 A;  5B1L B;  3KXB B;  3X1U D;  3UT9 C;  3EG5 B;  2Y2K A;  4XUJ D;  3AZM A;  1F66 A;  3AFA A;  3KWQ A;  3MGS A;  4AWL B;  5AV6 C;  1P3I B;  2ZY4 A;  5GT0 C;  1P3K A;  5B24 D;  3C1B C;  1ID3 D;  5AVC C;  2HUE B;  4DRB A;  3W96 D;  3AV1 D;  3REH A;  5DNN A;  5F99 C;  3C1C A;  3REJ C;  2Y2Q A;  5GT0 B;  2LY8 A;  1KX5 B;  4JJN B;  5AVC B;  5E5A A;  3VH6 W;  3AZI A;  3WA9 A;  4H9S C;  3UTB B;  5F99 B;  3X1U C;  4CAY A;  1EQZ B;  5GXQ C;  3AZH D;  5B31 A;  5BS7 C;  4XUJ C;  4XZQ D;  5B32 A;  4YS3 D;  3W99 B;  2YFV A;  3AZN D;  5BO0 B;  2NZD A;  4NE6 A;  3LZ1 D;  5B24 C;  4KUD D;  3X1U B;  4CSR B;  3B6G D;  3W96 C;  5DNM B;  3AV1 C;  3MVD A;  3REI D;  3NQU B;  4J8X B;  4J8V B;  2ZY2 A;  3A6N D;  5B24 B;  4WNN A;  1ID3 B;  3UTA A;  3WKJ D;  3AV1 B;  1T3U A;  1P3P B;  3WTP A;  3O62 D;  2NQB D;  4YS3 C;  4J8U A;  3AZN C;  1P3O A;  5AV8 A;  1KX4 D;  3W98 D;  5CP6 C;  1BH8 B;  4R8P D;  3KXB A;  4KUD C;  3REL A;  5GT3 D;  3AZH B;  4YS3 B;  4XZQ B;  5KDM A;  3B6G C;  3AZE D;  3AZN B;  1P34 D;  3X1V A;  4WU8 B;  4Z2M H;  3B6F D;  3LZ1 B;  3AZL A;  1P3L D;  1HQ3 D;  3A6N C;  3MGP D;  4KUD B;  1KX3 C;  2PYO D;  3UT9 A;  4DRA A;  3B6G B;  2CV5 D;  5G49 B;  3REI B;  3O62 C;  4UPK A;  1ULY A;  5CPJ C;  2XD1 A;  4Z5T D;  2NQB C;  5AV6 A;  5GT0 A;  3C1B A;  3KUY D;  5AVC A;  1N1J A;  5AV5 D;  1KX4 C;  3W98 C;  3WKJ B;  3AZG B;  3B0C T;  1S32 D;  4Z66 A;  2W8S A;  5F99 A;  3VH5 T;  2NQB B;  3AZJ B;  3REJ A;  4NE3 A;  3AZE C;  1R4V A;  1P34 C;  5CPI D;  1KX4 B;  3W98 B;  1P3L C;  5AY8 B;  1HQ3 C;  3MGP C;  4H9S A;  4EO5 C;  4R8P B;  1AOI B;  5GT3 B;  3X1U A;  2PYO C;  4CSR A;  5GXQ A;  5BS7 A;  4XUJ A;  2CV5 C;  3MNN C;  4H9Q B;  1P34 B;  5BNX B;  3B6F B;  4Z5T C;  3V9R B;  3EPH A;  1P3G D;  5BT1 D;  5B24 A;  2YFW B;  2PYO B;  2CV5 B;  3W96 A;  3AV1 A;  4E45 A;  4KHA B;  1S32 C;  3MGQ D;  5B2I B;  4H9P A;  3KUY B;  5AV5 B;  5CPI C;  1B67 A;  4H9N B;  5B1L C;  3UTB D;  5B32 G;  3WTP E;  2F8N D;  3W99 D;  5JA4 B;  4YS3 A;  5FUG A;  4AWL C;  5CPK D;  3AZN A;  4UUZ B;  1P3I C;  4WJ3 C;  5CP6 A;  1P3G C;  4NE5 A;  3MGR D;  5BT1 C; 
#chains in the Genus database with same CATH homology
 5C3I C;  4KUD A;  4YM6 D;  2HUE C;  5DNM D;  2Y2O A;  3B6G A;  2UWX A;  5G49 A;  4QLC D;  4J8X D;  4J8V D;  2FJ7 D;  3MGQ C;  1P3M B;  1P3G B;  1KX5 C;  3A6N A;  4JJN C;  5B33 D;  5C3I B;  1KX3 A;  4KGC B;  5GSU D;  1P3B B;  4ZUX B;  3AZK D;  3AL0 C;  2Y2G A;  1P3P D;  3UTB C;  2Y2N A;  3O62 A;  5CPJ A;  3MGQ B;  1HTA A;  3AN2 B;  1EQZ C;  2NQB A;  5AV9 B;  2J8P A;  3W99 C;  1A7W A;  1BFM A;  1KX4 A;  3W98 A;  4J8W B;  4HGA B;  3MGR C;  1JFI B;  2F2A C;  5B40 B;  2F8N B;  5B1M D;  2RVQ D;  5DNM C;  3X1T D;  2FFF B;  5CPK B;  3AZE A;  2Y2H A;  4WU8 D;  1P34 A;  2ARO B;  4J8X C;  4J8V C;  2FJ7 C;  1P3L A;  1HQ3 A;  3MGP A;  3MGR B;  1ID3 C;  4YM6 B;  2PYO A;  1P3P C;  2CV5 A;  3MNN A;  4QLC B;  2FJ7 B;  2BYM A;  4Z5T A;  5B33 B;  3X1S B;  1M1A B;  5GSU B;  3AZK B;  3AZF D;  1M18 B;  2G5I C;  1H3O B;  3AZG D;  1S32 A;  2Y2L A;  3AZJ D;  4LD9 D;  3AZH C;  5B1M C;  4XZQ C;  3TU4 D;  2ZY5 A;  4WU8 C;  2G5H C;  3P5J B;  4H9O B;  3LZ1 C;  4UUZ A;  5CPI A;  5AY8 D;  5B1L A;  1AOI D;  5B1M B;  3X1T B;  3A1K A;  3REI C;  2JSS A;  4DQY B;  2HIO B;  1P3I A;  5JRG D;  1P3G A;  5B2J B;  1ZLA D;  2BYK B;  3WKJ C;  3REK B;  3AZG C;  3W97 B;  5B2I D;  2BG1 A;  3AZI D;  3MGQ A;  3AZJ C;  4LD9 C;  3TU4 C;  1KX5 A;  4JJN A;  5B31 D;  3AZF B;  5AY8 C;  1P3A B;  3UTB A;  4R8P C;  5AVB D;  1AOI C;  2NZD D;  5GT3 C;  3B0D B;  4LD9 B;  1EQZ A;  3TU4 B;  3LJA D;  2F8N A;  3R45 B;  3W99 A;  5BO0 A;  3B6F C;  3AZM B;  3AFA B;  3KWQ B;  3MGS B;  5JRG C;  3F6T A;  4WU9 D;  1ZLA C;  5DNM A;  3NQU A;  4J8X A;  4J8V A;  5B2I C;  3VH6 T;  1P3M D;  2FJ7 A;  4ZBJ B;  5JRG B;  5B0Z D;  1ID3 A;  3KUY C;  1ZLA B;  4KGC D;  1P3B D;  4ZUX D;  5AV5 C;  5B31 C;  1Z2C B;  1P3P A;  1P3F D;  1H3O A;  5AVB C;  5AV8 D;  3AN2 D;  2Y2I A;  3AZI B;  5BNV B;  5AV9 D;  3LJA C;  4Z2M G;  4CAY B;  2JCH A;  5B31 B;  1BH8 A;  2YFV B;  4J8W D;  3X1V D;  5AVB B;  4WU9 C;  3AYW D;  2NZD B;  5B40 D;  1TZY D;  3AZH A;  3KFU G;  3LJA B;  5B1M A;  4XZQ A;  2ARO D;  4WU8 A;  3LZ1 A;  1P3M C;  3LZ0 D;  5B0Z C;  4WU9 B;  2F8N H;  4KGC C;  5CHL B;  4G92 C;  4ZUX C;  1P3B C;  2Y2M A;  3C1B D;  3REI A;  1P3F C;  3NQJ B;  3AN2 C;  3UTA B;  5AV9 C;  5B0Z B;  3X1S D;  5B0Y D;  1M19 D;  4Z66 D;  1M1A D;  4G92 B;  1M18 D;  3REJ D;  4J8U B;  3WKJ A;  4J8W C;  4HGA C;  1P3F B;  3AZG A;  1BH9 B;  3AYW C;  5AV8 B;  5B40 C;  1TZY C;  3H0L C;  3AZJ A;  4LD9 A;  4X23 D;  3EPL A;  3TU4 A;  5CPK C;  3R45 A;  3REL B;  2ARO C;  3FDD A;  5GXQ D;  5KDM B;  3EPK A;  5AY8 A;  3H0M C;  1KU5 A;  3LZ0 C;  3LEL D;  3X1V B;  4R8P A;  3AYW B;  3B0C W;  4YM6 C;  1TZY B;  5GT3 A;  3AZL B;  1AOI A;  2Y2P A;  3VH5 W;  2JE5 A;  4QLC C;  2IO5 C;  4H9Q A;  5BNX A;  3UT9 B;  3B6F A;  2HIO D;  1Q9C A;  3V9R A;  3LZ0 B;  5B2J D;  5B33 C;  5JRG A;  3X1S C;  5B0Y C;  1M19 C;  2Y2J A;  2RIQ A;  5GSU C;  2YFW A;  4Z66 C;  3AZK C;  1M1A C;  5AV6 B;  1ZLA A;  1M18 C;  3REK D;  2IO5 B;  3C1B B;  3W97 D;  4G91 C;  4KHA A;  1N1J B;  5B2I A;  4M6B A;  5BNV A;  4X23 C;  3WAA D;  5B0Y B;  3KSY A;  4Z66 B;  1M19 B;  3KUY A;  1U35 D;  5AV5 A;  3REJ B;  4H9N A;  1P3A D;  2F8N G;  3LEL C;  1F1E A;  4G91 B;  5AVB A;  2DQN C;  3AV2 D;  2RVQ C;  5CP6 D;  4X23 B;  3X1T C;  5JA4 A;  3LJA A;  5GXQ B;  3AZM D;  1F66 D;  2HIO C;  3AFA D;  4XUJ B;  3KWQ D;  3MGS D;  3LEL B;  5B2J C;  4H9R B;  3A1I A;  4WU9 A;  3VH5 A;  4E44 A;  1P3K D;  4WV4 B;  3REK C;  1KX3 D;  3W97 C;  3NQJ A;  3REH D;  1P3M A;  3W96 B;  3B0B A;  5DNN D;  3WAA C;  5B0Z A;  5CPJ D;  3C1C D;  4KGC A;  1U35 C;  1P3B A;  4H9P B;  4ZUX A;  3AZF C;  1P3A C;  1TAF B;  1P3F A;  3H0R C;  5E5A D;  3B0D C;  1BH9 A;  3AV2 C;  3VH6 A;  3AN2 A;  3WA9 D;  1PZR A;  2VQR A;  5AV9 A;  3WAA B;  1U35 B;  4NFT A;  5B32 D;  3AZM C;  3AFA C;  1WWS A;  2CWE A;  3KWQ C;  1F66 C;  5FUG B;  3MGS C;  4J8W A;  1JFI A;  3AYW A;  3AV2 B;  5B40 A;  1TZY A;  5CP6 B;  1P3K C;  5CPK A;  1W2E A;  2ARO A;  1F66 B;  4ZBJ C;  3REH C;  3MVD D;  3MNN D;  3LZ0 A;  3MGR A;  5DNN C;  4YM6 A;  3C1C C;  1P3K B;  3A6N B;  2L5A A;  4QLC A;  1KX3 B;  5E5A C;  3UTA D;  3AZI C;  4WZS B;  3REH B;  3WA9 C;  3WTP D;  5DNN B;  3X1S A;  5B33 A;  3O62 B;  5B0Y A;  3C1C B;  5CPJ B;  1M19 A;  5GSU A;  1M1A A;  4J8U D;  3AZK A;  5B32 C;  1M18 A;  1P3O D;  5E5A B;  2NZD C;  3WA9 B;  5B1L D;  3KXB D;  4X23 A;  3REL D;  2F8N K;  4H9O A;  5B32 B;  3MVD C;  1WWI A;  3AZE B;  3LEL A;  4H9R A;  3AZL D;  1P3I D;  1P3L B;  1HQ3 B;  3MGP B;  3X1T A;  4EO5 B;  2DF4 C;  3IP4 C;  3UT9 D;  3UTA C;  2ZM5 A;  2HIO A;  3MVD B;  3WTP C;  3MNN B;  5B2J A;  2BYM B;  5AV6 D;  4Z5T B;  2BYK A;  4J8U C;  2XD5 A;  5GT0 D;  1KX5 D;  4WNN B;  3REK A;  4JJN D;  1P3O C;  5AVC D;  1TAF A;  3W97 A;  5AV8 C;  3WTP B;  5B31 G;  3KXB C;  3REL C;  3WAA A;  5F99 D;  2ZY3 A;  1S32 B;  1EQZ D;  3EPJ A;  1U35 A;  3AZF A;  1P3A A;  3X1V C;  1P3O B;  3AZL C;  5CPI B;  1B6W A;  3AV2 A;  5B1L B;  3KXB B;  3X1U D;  3UT9 C;  3EG5 B;  2Y2K A;  4XUJ D;  3AZM A;  1F66 A;  3AFA A;  3KWQ A;  3MGS A;  4AWL B;  5AV6 C;  1P3I B;  2ZY4 A;  5GT0 C;  1P3K A;  5B24 D;  3C1B C;  1ID3 D;  5AVC C;  2HUE B;  4DRB A;  3W96 D;  3AV1 D;  3REH A;  5DNN A;  5F99 C;  3C1C A;  3REJ C;  2Y2Q A;  5GT0 B;  2LY8 A;  1KX5 B;  4JJN B;  5AVC B;  5E5A A;  3VH6 W;  3AZI A;  3WA9 A;  4H9S C;  3UTB B;  5F99 B;  3X1U C;  4CAY A;  1EQZ B;  5GXQ C;  3AZH D;  5B31 A;  5BS7 C;  4XUJ C;  4XZQ D;  5B32 A;  4YS3 D;  3W99 B;  2YFV A;  3AZN D;  5BO0 B;  2NZD A;  4NE6 A;  3LZ1 D;  5B24 C;  4KUD D;  3X1U B;  4CSR B;  3B6G D;  3W96 C;  5DNM B;  3AV1 C;  3MVD A;  3REI D;  3NQU B;  4J8X B;  4J8V B;  2ZY2 A;  3A6N D;  5B24 B;  4WNN A;  1ID3 B;  3UTA A;  3WKJ D;  3AV1 B;  1T3U A;  1P3P B;  3WTP A;  3O62 D;  2NQB D;  4YS3 C;  4J8U A;  3AZN C;  1P3O A;  5AV8 A;  1KX4 D;  3W98 D;  5CP6 C;  1BH8 B;  4R8P D;  3KXB A;  4KUD C;  3REL A;  5GT3 D;  3AZH B;  4YS3 B;  4XZQ B;  5KDM A;  3B6G C;  3AZE D;  3AZN B;  1P34 D;  3X1V A;  4WU8 B;  4Z2M H;  3B6F D;  3LZ1 B;  3AZL A;  1P3L D;  1HQ3 D;  3A6N C;  3MGP D;  4KUD B;  1KX3 C;  2PYO D;  3UT9 A;  4DRA A;  3B6G B;  2CV5 D;  5G49 B;  3REI B;  3O62 C;  4UPK A;  1ULY A;  5CPJ C;  2XD1 A;  4Z5T D;  2NQB C;  5AV6 A;  5GT0 A;  3C1B A;  3KUY D;  5AVC A;  1N1J A;  5AV5 D;  1KX4 C;  3W98 C;  3WKJ B;  3AZG B;  3B0C T;  1S32 D;  4Z66 A;  2W8S A;  5F99 A;  3VH5 T;  2NQB B;  3AZJ B;  3REJ A;  4NE3 A;  3AZE C;  1R4V A;  1P34 C;  5CPI D;  1KX4 B;  3W98 B;  1P3L C;  5AY8 B;  1HQ3 C;  3MGP C;  4H9S A;  4EO5 C;  4R8P B;  1AOI B;  5GT3 B;  3X1U A;  2PYO C;  4CSR A;  5GXQ A;  5BS7 A;  4XUJ A;  2CV5 C;  3MNN C;  4H9Q B;  1P34 B;  5BNX B;  3B6F B;  4Z5T C;  3V9R B;  3EPH A;  1P3G D;  5BT1 D;  5B24 A;  2YFW B;  2PYO B;  2CV5 B;  3W96 A;  3AV1 A;  4E45 A;  4KHA B;  1S32 C;  3MGQ D;  5B2I B;  4H9P A;  3KUY B;  5AV5 B;  5CPI C;  1B67 A;  4H9N B;  5B1L C;  3UTB D;  5B32 G;  3WTP E;  2F8N D;  3W99 D;  5JA4 B;  4YS3 A;  5FUG A;  4AWL C;  5CPK D;  3AZN A;  4UUZ B;  1P3I C;  4WJ3 C;  5CP6 A;  1P3G C;  4NE5 A;  3MGR D;  5BT1 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...