3B6FB

Nucleosome core particle treated with cisplatin
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
79
structure length
79
Chain Sequence
b'DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 147-MER DNA
publication title Site selectivity of platinum anticancer therapeutics
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 21
structure length 79
sequence length 79
chains with identical sequence F
ec nomenclature
pdb deposition date 2007-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3b6fB00
5B0ZB 5B31D 4XUJC 3LELB 3AYWC 3AN2D 5GT3B 4X23C 3LZ0D 5AV8B 3UT9A 5G49B 2CV5A 3X1VC 5B2JD 1P3AA 3AZNB 5AV6A 3W99A 5B40A 3A6NC 3LZ1B 1KX3C 3MNND 5B1MB 5E5AC 3UTBD 3LELC 3C1CD 3AZED 5DNND 1U35A 4YS3B 1P34C 1P3BD 1P3KB 5GT3C 3X1SC 5AY8B 5AV8C 4Z66B 4JJNC 3AZFD 3W97B 4DRBA 3B6FD 5AVCB 1Q9CA 3AZID 5B1MC 3WTPA 3TU4B 3AV2A 1M18D 4YS3C 5CPJB 1P3KC 4H9SA 2PYOB 4H9QA 5AY8C 4LD9A 5B33A 4Z66C 4Z5TA 2BYKB 3REKD 5AVBB 5B24D 5FUGA 4QLCD 3MGQB 3TU4C 1WWSA 3AZMB 3B0CW 3MGPB 1AOIB 5CPJC 3C1BB 5BO0A 1P3IB 3REIA 1P3MA 2HIOB 4WZSB 1F66B 4WU9A 1M19A 2NQBD 2YFVA 5AVBC 1S32D 3W96A 5CPIA 3VH6W 5CPKA 5JRGD 3WA9B 5GSUD 1AOIC 3MGPC 3UT9B 3C1BC 1P3GA 1P3IC 5AV6B 2HIOC 5B40B 3W99B 1F66C 3WAAA 3MGSD 3VH6T 4J8XD 3REHB 3AZGD 1U35B 5CP6D 4CSRA 5AV9A 3KWQD 3WA9C 1EQZA 2BYMA 4G91B 4HGAB 3UT9C 1KX5A 4E45A 5AV6C 1P3FB 4J8WD 3AZHD 5GT0D 3W98C 5C3IB 3WTPB 5DNMA 3REHC 3AV2B 1P3PD 4X23A 4H9QB 4J8UA 3X1VA 4G91C 4LD9B 2NZDA 4Z5TB 1KX3A 3MGRD 1P3FC 1B67A 5FUGB 5E5AA 3X1UD 3B0BA 1P34A 5C3IC 3MVDD 3X1SA 5GT3A 5B0YA 3B6GC 4WU8D 5AV8A 1P3MB 4JJNA 1R4VA 3AV1A 1KX4A 4WU9B 2AROD 3AFAA 5F99D 2YFVB 5CPIB 2FJ7A 2IO5C 5B32D 4YS3A 4ZBJB 1P3GB 3WTPE 2L5AA 4Z66A 4M6BA 4YM6D 3WAAB 4WU9C 5GXQC 4CSRB 3AZLD 4R8PC 1EQZB 3KUYD 2LY8A 1KX5B 4ZBJC 1P3LA 4KUDC 1P3OD 1M1AD 5B0ZD 5B31A 2BYKA 5AVBA 4XZQD 5DNMB 3O62C 4X23B 3LZ0A 4J8VC 1EQZC 4J8UB 3X1VB 5BT1C 2NZDB 2HIOA 3AZND 3AZKB 1ID3D 3VH5T 5E5AB 3B0DB 3AZEA 1BH9A 1P34B 5DNMC 3X1SB 5B0YB 3WA9A 4WU8C 1JFIA 5B2ID 4ZUXD 4JJNB 4J8UC 3AZFA 3AV1B 1KX4B 3WKJB 2NZDC 1ZLAD 2AROC 3AFAB 3AZKC 3W97D 5AVCD 3W98A 3REHA 3B0DC 4KGCB 2FJ7B 5B0YC 1HQ3D 3RELC 2PYOD 1KX4C 3KXBD 3AV1C 3VH6A 3WKJC 1P3FA 3AFAC 5B24A 5B31G 4QLCA 3MGQD 4KGCC 3AZMD 2FJ7C 3UTAB 3B6GA 3KUYC 1P3LB 5B31B 5AV5C 2NQBA 1S32A 4E44A 3AN2B 4CAYA 3LZ0B 5JRGA 3AZJD 5GSUA 1TZYC 3X1TD 3REJC 3UTAC 2CV5D 1P3AD 4NE6A 3W99D 1P3LC 5B40D 5GXQA 3UTBB 3B0CT 4DRAA 5B31C 3AZGA 3C1CB 3AZEB 1BH9B 1U35D 1P3BB 3AN2C 4R8PA 3KWQA 3LZ0C 1JFIB 5CHLB 5B2IC 3AZFB 4KUDA 5B2JC 3AZHA 4WNNA 3W98B 3MNNC 3AZIB 3UTBC 3WTPD 3O62A 3AV2D 3C1CC 3AZEC 5DNNC 1P3BC 4J8VA 2F8ND 1HQ3C 1A7WA 3V9RA 2YFWA 3AZFC 5B33D 4LD9D 4Z5TD 3NQUA 3REKB 2JSSA 5B24B 3B6FC 4QLCB 2F8NK 3AZIC 4H9RA 4NE3A 1M18C 3B6GB 4WU8A 4H9PA 3REID 1P3MD 5B1LD 2AROA 1M19D 3AZKA 5F99A 3REKC 2NQBB 4H9OA 5B24C 2RVQD 1S32B 4QLCC 4CAYB 5CPID 5JRGB 2IO5B 5GSUB 5B32A 5CPKD 3W96D 3RELA 1P3GD 1ULYA 3VH5A 3WKJA 5JA4A 5GXQB 3AZGB 2NQBC 1F1EA 5AV9D 1S32C 4R8PB 4KGCA 3KWQB 5JRGC 5GSUC 3KUYA 1KX5D 4KUDB 3AZHB 4WNNB 3MGSC 4XUJD 5AV5A 3AYWD 5BS7C 4J8XC 4XZQA 3O62B 3AZGC 5CP6C 4X23D 4J8VB 1TZYA 3KWQC 3REJA 3LJAD 3UTAA 3V9RB 3X1VD 2YFWB 3A6ND 1ID3A 3NQUB 1KX3D 4J8WC 3AZHC 5GT0C 1BH8A 3LELD 4H9RB 1P34D 3AN2A 3MVDB 1P3PC 5GT3D 5B32G 4WU8B 5B2IA 4H9PB 1TAFA 4ZUXA 5AV8D 4JJND 5B2JA 1ZLAA 4UUZA 2AROB 5F99B 3LZ1D 3MGRC 4H9OB 3MNNA 3UTBA 5B1MD 1H3OA 3X1UC 3C1CA 1P3BA 5DNNA 5B32B 4YS3D 4WV4B 3MVDC 1P3KD 1HQ3A 3RELB 5AY8D 4Z66D 3KXBA 4YM6B 5JA4B 5F99C 3B6FA 3AZIA 3TU4D 1M18A 5B32C 5CPJD 3KUYB 4EO5B 1P3OB 1KU5A 4YM6C 5AV5B 3REKA 5AVBD 4XZQB 5BNXA 3AZLC 3AZJA 1TZYB 3REJB 4G92C 3LJAC 3MGPD 3X1TA 4KHAB 3C1BD 1AOID 1P3ID 2HIOD 1ID3B 4EO5C 1F66D 1P3OC 1N1JB 5B0ZC 1M1AC 5KDMA 1BH8B 4XZQC 3WA9D 3NQJA 1BFMA 5B2IB 1TAFB 3R45A 4ZUXB 3UT9D 5B2JB 3AZNC 4UUZB 5AV6D 1ZLAB 1ID3C 5BNVA 3LZ1C 3MGSA 3W98D 5BS7A 3MNNB 4J8XA 1H3OB 1HTAA 3REHD 5DNNB 5CP6A 2F8NA 1HQ3B 4ZUXC 3KXBB 1ZLAC 4J8WA 1P3FD 3W97C 2HUEB 3B6FB 5AVCC 5GT0A 1P3PA 1M18B 3B6GD 2PYOC 5B1LA 2F8NH 3KXBC 4AWLB 3MGRA 2HUEC 5BNXB 3X1UA 3MGQC 3AZJB 3MVDA 3AZMC 3X1TB 2CV5B 1P3AB 4NE5A 2CWEA 4NFTA 4WU9D 4AWLC 5GXQD 5KDMB 4R8PD 3AZJC 3NQJB 2F8NG 3X1TC 3R45B 2CV5C 1P3AC 4KUDD 3W99C 5B40C 4YM6A 5BNVB 3MGSB 3WAAD 4XUJA 3AYWA 4J8XB 4H9NA 3O62D 1U35C 5CP6B 3AZLA 4J8VD 2F8NB 3LJAA 1EQZD 5BT1D 4HGAC 5B33B 3A6NA 1P3OA 1M1AA 5B0ZA 4J8WB 5GT0B 3LELA 5DNMD 3WTPC 3AV2C 1P3PB 5BO0B 4H9SC 3REIB 4KHAA 5G49A 5B1LB 4J8UD 4LD9C 5B33C 3AZNA 4Z5TC 1M19B 2NZDD 1B6WA 3AZKD 3LZ1A 1N1JA 3MGRB 5B1MA 5E5AD 4Z2MH 3X1UB 3W96B 5CPKB 1WWIA 1P3KA 3X1SD 5B0YD 3RELD 5AY8A 3REIC 1P3MC 1KX4D 3AV1D 5B1LC 3WKJD 3W97A 1M19C 3AFAD 5AVCA 3KSYA 2RVQC 5AV9B 3TU4A 4KGCD 3W96C 5CPIC 5CPKC 2FJ7D 5CPJA 2BYMB 2PYOA 1P3GC 4Z2MG 3WAAC 4XUJB 5AV5D 3AYWB 4H9NB 3MGQA 3AZLB 5AV9C 3VH5W 1TZYD 3AZMA 4G92B 3LJAB 3MGPA 3REJD 3UTAD 3C1BA 1AOIA 1P3IA 1KX5C 3A6NB 1P3LD 1F66A 1KX3B 1M1AB
chains in the Genus database with same CATH superfamily
5B0ZB 5B31D 4XUJC 3LELB 3AYWC 3AN2D 2W8SA 5GT3B 4X23C 3LZ0D 5AV8B 3UT9A 5G49B 2CV5A 3X1VC 5B2JD 1P3AA 3AZNB 5AV6A 3W99A 5B40A 3A6NC 3LZ1B 2G5IC 1KX3C 3MNND 5B1MB 5E5AC 3UTBD 3LELC 3C1CD 3AZED 5DNND 1U35A 4YS3B 1P34C 1P3BD 1P3KB 5GT3C 3X1SC 5AY8B 5AV8C 4Z66B 4JJNC 3AZFD 3W97B 4DRBA 3B6FD 5AVCB 1Q9CA 3AZID 5B1MC 3WTPA 3TU4B 3AV2A 1M18D 4YS3C 5CPJB 3H0MC 4H9SA 1P3KC 2PYOB 4H9QA 5AY8C 4LD9A 5B33A 4Z66C 4Z5TA 2BYKB 3REKD 5AVBB 5B24D 5FUGA 4QLCD 3MGQB 3TU4C 1WWSA 3AZMB 3B0CW 3MGPB 1AOIB 5CPJC 3C1BB 5BO0A 1P3IB 3REIA 1P3MA 2HIOB 4WZSB 1F66B 2JE5A 4WU9A 1M19A 2Y2QA 2NQBD 2YFVA 5AVBC 2Y2JA 1S32D 3W96A 5CPIA 3VH6W 5CPKA 5JRGD 3WA9B 5GSUD 3EPKA 1AOIC 3MGPC 3UT9B 3C1BC 1P3GA 1P3IC 5AV6B 2HIOC 5B40B 3W99B 1F66C 3WAAA 3MGSD 3VH6T 4J8XD 3REHB 3AZGD 1U35B 5CP6D 4CSRA 5AV9A 3KWQD 3WA9C 1EQZA 2BYMA 4G91B 4HGAB 3UT9C 1KX5A 4E45A 5AV6C 1P3FB 4J8WD 3AZHD 3H0RC 5GT0D 3W98C 2ZY2A 5C3IB 3WTPB 5DNMA 3REHC 3AV2B 1P3PD 4X23A 4H9QB 4J8UA 3X1VA 2DQNC 1PZRA 4G91C 4LD9B 2NZDA 4Z5TB 1KX3A 3MGRD 1P3FC 1B67A 5FUGB 5E5AA 3X1UD 3B0BA 1P34A 3H0LC 5C3IC 3MVDD 3X1SA 5GT3A 5B0YA 3B6GC 4WU8D 2Y2NA 5AV8A 1P3MB 4JJNA 1R4VA 3AV1A 1KX4A 4WU9B 2AROD 3AFAA 5F99D 2Y2KA 2YFVB 5CPIB 2FJ7A 2IO5C 5B32D 4YS3A 4ZBJB 1P3GB 3WTPE 2L5AA 3IP4C 4Z66A 4M6BA 4YM6D 3WAAB 4WU9C 5GXQC 4CSRB 3AZLD 4R8PC 1EQZB 3KUYD 2LY8A 1KX5B 4ZBJC 1P3LA 4KUDC 1P3OD 1M1AD 5B0ZD 5B31A 2BYKA 5AVBA 4XZQD 5DNMB 3O62C 4X23B 2Y2OA 3LZ0A 4J8VC 1EQZC 4J8UB 3X1VB 5BT1C 3F6TA 2NZDB 2HIOA 3AZND 3AZKB 1ID3D 3VH5T 2ZY3A 5E5AB 3B0DB 3AZEA 1BH9A 1P34B 2Y2LA 5DNMC 3X1SB 5B0YB 3WA9A 2BG1A 4DQYB 4WU8C 1JFIA 5B2ID 4ZUXD 4JJNB 4J8UC 3AZFA 2XD5A 3AV1B 1KX4B 3WKJB 2NZDC 1ZLAD 2AROC 3AFAB 3AZKC 3W97D 2UWXA 5AVCD 3W98A 3REHA 3B0DC 4KGCB 2FJ7B 5B0YC 1HQ3D 3RELC 2PYOD 3KFUG 1KX4C 3KXBD 3AV1C 3VH6A 3WKJC 1P3FA 3AL0C 3AFAC 2F2AC 5B24A 5B31G 4QLCA 3MGQD 4KGCC 3AZMD 2FJ7C 3UTAB 4WJ3C 3B6GA 3A1KA 3KUYC 1P3LB 5B31B 5AV5C 2NQBA 1S32A 4E44A 3AN2B 4CAYA 3LZ0B 5JRGA 3AZJD 5GSUA 1TZYC 3X1TD 3REJC 3UTAC 2CV5D 1P3AD 4NE6A 3W99D 1P3LC 5B40D 3EPHA 2DF4C 5GXQA 3UTBB 3B0CT 4DRAA 5B31C 3AZGA 3C1CB 3AZEB 1BH9B 1U35D 1P3BB 3AN2C 4R8PA 3KWQA 3LZ0C 1JFIB 5CHLB 5B2IC 3AZFB 4KUDA 5B2JC 3AZHA 4WNNA 3EPLA 3W98B 3MNNC 3AZIB 3UTBC 3WTPD 3O62A 3AV2D 3C1CC 3AZEC 5DNNC 1P3BC 4J8VA 2F8ND 1HQ3C 1A7WA 3V9RA 2YFWA 3AZFC 5B33D 4LD9D 4Z5TD 2ZY5A 3NQUA 3REKB 2JSSA 5B24B 3B6FC 4QLCB 2F8NK 3AZIC 4H9RA 4NE3A 1M18C 3B6GB 4WU8A 4H9PA 3REID 1P3MD 1W2EA 5B1LD 1T3UA 2AROA 1M19D 3AZKA 5F99A 3REKC 2NQBB 4H9OA 5B24C 2RVQD 1S32B 4QLCC 4CAYB 5CPID 5JRGB 2IO5B 5GSUB 5B32A 5CPKD 3W96D 3RELA 1P3GD 1ULYA 3VH5A 3WKJA 5JA4A 5GXQB 3AZGB 2NQBC 1F1EA 5AV9D 1S32C 4R8PB 4KGCA 3KWQB 2ZM5A 5JRGC 5GSUC 3KUYA 1KX5D 3EPJA 4KUDB 3AZHB 4WNNB 3MGSC 4XUJD 5AV5A 3AYWD 5BS7C 4J8XC 4XZQA 3O62B 3AZGC 5CP6C 4X23D 4J8VB 1TZYA 3KWQC 3REJA 2FFFB 3LJAD 3UTAA 3V9RB 3X1VD 2YFWB 2Y2IA 3A6ND 1ID3A 3NQUB 1KX3D 4J8WC 3AZHC 5GT0C 1BH8A 3LELD 4H9RB 1P34D 3AN2A 3MVDB 1P3PC 5GT3D 5B32G 4WU8B 5B2IA 4H9PB 1TAFA 4ZUXA 5AV8D 4JJND 5B2JA 1ZLAA 4UUZA 2AROB 3EG5B 5F99B 3LZ1D 3MGRC 4H9OB 3MNNA 3UTBA 5B1MD 1H3OA 3X1UC 3C1CA 1P3BA 5DNNA 5B32B 4YS3D 4WV4B 3MVDC 1P3KD 1HQ3A 3RELB 5AY8D 4Z66D 3KXBA 4YM6B 5JA4B 5F99C 3B6FA 3AZIA 3TU4D 1M18A 5B32C 5CPJD 3KUYB 4EO5B 1P3OB 1KU5A 4YM6C 5AV5B 3REKA 5AVBD 4XZQB 5BNXA 3AZLC 3AZJA 1TZYB 3REJB 4G92C 3LJAC 3MGPD 3X1TA 4KHAB 3C1BD 1AOID 1P3ID 2HIOD 1ID3B 4EO5C 1F66D 1P3OC 1N1JB 5B0ZC 1M1AC 5KDMA 1BH8B 4XZQC 3WA9D 3NQJA 1BFMA 5B2IB 4ZUXB 1TAFB 3R45A 3UT9D 5B2JB 2Y2PA 3AZNC 4UUZB 5AV6D 1ZLAB 1ID3C 5BNVA 3LZ1C 3MGSA 2Y2GA 5BS7A 3MNNB 4J8XA 3W98D 1H3OB 1HTAA 3REHD 5DNNB 5CP6A 2F8NA 1HQ3B 2ZY4A 4ZUXC 3KXBB 4UPKA 1ZLAC 1Z2CB 4J8WA 1P3FD 3W97C 2HUEB 3B6FB 5AVCC 2Y2HA 5GT0A 1P3PA 1M18B 3B6GD 2PYOC 5B1LA 2RIQA 2F8NH 3KXBC 4AWLB 3MGRA 2HUEC 5BNXB 3X1UA 3MGQC 3AZJB 3MVDA 3AZMC 3X1TB 2CV5B 1P3AB 4NE5A 2CWEA 4NFTA 4WU9D 4AWLC 5GXQD 5KDMB 4R8PD 3AZJC 3NQJB 2F8NG 3X1TC 3R45B 2CV5C 1P3AC 4KUDD 3W99C 5B40C 4YM6A 5BNVB 3MGSB 3WAAD 4XUJA 2Y2MA 3AYWA 4J8XB 4H9NA 3O62D 1U35C 5CP6B 3AZLA 4J8VD 2F8NB 3LJAA 1EQZD 5BT1D 4HGAC 5B33B 3A6NA 1P3OA 1M1AA 5B0ZA 4J8WB 3FDDA 5GT0B 3LELA 5DNMD 3WTPC 3AV2C 1P3PB 5BO0B 4H9SC 3REIB 4KHAA 5G49A 5B1LB 4J8UD 4LD9C 5B33C 3AZNA 4Z5TC 1M19B 2NZDD 1B6WA 3AZKD 3LZ1A 1N1JA 3MGRB 5B1MA 5E5AD 2JCHA 4Z2MH 2VQRA 3X1UB 3W96B 5CPKB 1WWIA 3P5JB 3X1SD 1P3KA 5B0YD 3RELD 5AY8A 3REIC 1P3MC 1KX4D 3AV1D 5B1LC 2G5HC 3WKJD 3W97A 1M19C 3AFAD 5AVCA 3KSYA 2RVQC 5AV9B 3TU4A 4KGCD 3W96C 5CPIC 5CPKC 2FJ7D 5CPJA 2BYMB 2PYOA 1P3GC 3A1IA 4Z2MG 3WAAC 2J8PA 4XUJB 5AV5D 3AYWB 4H9NB 3MGQA 3AZLB 5AV9C 3VH5W 1TZYD 2XD1A 4G92B 3LJAB 3MGPA 3REJD 3UTAD 3C1BA 3AZMA 1AOIA 1P3IA 1KX5C 3A6NB 1P3LD 1F66A 1KX3B 1M1AB
chains in the Genus database with same CATH topology
5B0ZB 5B31D 4XUJC 3LELB 3AYWC 3AN2D 2W8SA 5GT3B 4X23C 3LZ0D 5AV8B 3UT9A 5G49B 2CV5A 3X1VC 5B2JD 1P3AA 3AZNB 5AV6A 3W99A 5B40A 3A6NC 3LZ1B 2G5IC 1KX3C 3MNND 5B1MB 5E5AC 3UTBD 3LELC 3C1CD 3AZED 5DNND 1U35A 4YS3B 1P34C 1P3BD 1P3KB 5GT3C 3X1SC 5AY8B 5AV8C 4Z66B 4JJNC 3AZFD 3W97B 4DRBA 3B6FD 5AVCB 1Q9CA 3AZID 5B1MC 3WTPA 3TU4B 3AV2A 1M18D 4YS3C 5CPJB 3H0MC 4H9SA 1P3KC 2PYOB 4H9QA 5AY8C 4LD9A 5B33A 4Z66C 4Z5TA 2BYKB 3REKD 5AVBB 5B24D 5FUGA 4QLCD 3MGQB 3TU4C 1WWSA 3AZMB 3B0CW 3MGPB 1AOIB 5CPJC 3C1BB 5BO0A 1P3IB 3REIA 1P3MA 2HIOB 4WZSB 1F66B 2JE5A 4WU9A 1M19A 2Y2QA 2NQBD 2YFVA 5AVBC 2Y2JA 1S32D 3W96A 5CPIA 3VH6W 5CPKA 5JRGD 3WA9B 5GSUD 3EPKA 1AOIC 3MGPC 3UT9B 3C1BC 1P3GA 1P3IC 5AV6B 2HIOC 5B40B 3W99B 1F66C 3WAAA 3MGSD 3VH6T 4J8XD 3REHB 3AZGD 1U35B 5CP6D 4CSRA 5AV9A 3KWQD 3WA9C 1EQZA 2BYMA 4G91B 4HGAB 3UT9C 1KX5A 4E45A 5AV6C 1P3FB 4J8WD 3AZHD 3H0RC 5GT0D 3W98C 2ZY2A 5C3IB 3WTPB 5DNMA 3REHC 3AV2B 1P3PD 4X23A 4H9QB 4J8UA 3X1VA 2DQNC 1PZRA 4G91C 4LD9B 2NZDA 4Z5TB 1KX3A 3MGRD 1P3FC 1B67A 5FUGB 5E5AA 3X1UD 3B0BA 1P34A 3H0LC 5C3IC 3MVDD 3X1SA 5GT3A 5B0YA 3B6GC 4WU8D 2Y2NA 5AV8A 1P3MB 4JJNA 1R4VA 3AV1A 1KX4A 4WU9B 2AROD 3AFAA 5F99D 2Y2KA 2YFVB 5CPIB 2FJ7A 2IO5C 5B32D 4YS3A 4ZBJB 1P3GB 3WTPE 2L5AA 3IP4C 4Z66A 4M6BA 4YM6D 3WAAB 4WU9C 5GXQC 4CSRB 3AZLD 4R8PC 1EQZB 3KUYD 2LY8A 1KX5B 4ZBJC 1P3LA 4KUDC 1P3OD 1M1AD 5B0ZD 5B31A 2BYKA 5AVBA 4XZQD 5DNMB 3O62C 4X23B 2Y2OA 3LZ0A 4J8VC 1EQZC 4J8UB 3X1VB 5BT1C 3F6TA 2NZDB 2HIOA 3AZND 3AZKB 1ID3D 3VH5T 2ZY3A 5E5AB 3B0DB 3AZEA 1BH9A 1P34B 2Y2LA 5DNMC 3X1SB 5B0YB 3WA9A 2BG1A 4DQYB 4WU8C 1JFIA 5B2ID 4ZUXD 4JJNB 4J8UC 3AZFA 2XD5A 3AV1B 1KX4B 3WKJB 2NZDC 1ZLAD 2AROC 3AFAB 3AZKC 3W97D 2UWXA 5AVCD 3W98A 3REHA 3B0DC 4KGCB 2FJ7B 5B0YC 1HQ3D 3RELC 2PYOD 3KFUG 1KX4C 3KXBD 3AV1C 3VH6A 3WKJC 1P3FA 3AL0C 3AFAC 2F2AC 5B24A 5B31G 4QLCA 3MGQD 4KGCC 3AZMD 2FJ7C 3UTAB 4WJ3C 3B6GA 3A1KA 3KUYC 1P3LB 5B31B 5AV5C 2NQBA 1S32A 4E44A 3AN2B 4CAYA 3LZ0B 5JRGA 3AZJD 5GSUA 1TZYC 3X1TD 3REJC 3UTAC 2CV5D 1P3AD 4NE6A 3W99D 1P3LC 5B40D 3EPHA 2DF4C 5GXQA 3UTBB 3B0CT 4DRAA 5B31C 3AZGA 3C1CB 3AZEB 1BH9B 1U35D 1P3BB 3AN2C 4R8PA 3KWQA 3LZ0C 1JFIB 5CHLB 5B2IC 3AZFB 4KUDA 5B2JC 3AZHA 4WNNA 3EPLA 3W98B 3MNNC 3AZIB 3UTBC 3WTPD 3O62A 3AV2D 3C1CC 3AZEC 5DNNC 1P3BC 4J8VA 2F8ND 1HQ3C 1A7WA 3V9RA 2YFWA 3AZFC 5B33D 4LD9D 4Z5TD 2ZY5A 3NQUA 3REKB 2JSSA 5B24B 3B6FC 4QLCB 2F8NK 3AZIC 4H9RA 4NE3A 1M18C 3B6GB 4WU8A 4H9PA 3REID 1P3MD 1W2EA 5B1LD 1T3UA 2AROA 1M19D 3AZKA 5F99A 3REKC 2NQBB 4H9OA 5B24C 2RVQD 1S32B 4QLCC 4CAYB 5CPID 5JRGB 2IO5B 5GSUB 5B32A 5CPKD 3W96D 3RELA 1P3GD 1ULYA 3VH5A 3WKJA 5JA4A 5GXQB 3AZGB 2NQBC 1F1EA 5AV9D 1S32C 4R8PB 4KGCA 3KWQB 2ZM5A 5JRGC 5GSUC 3KUYA 1KX5D 3EPJA 4KUDB 3AZHB 4WNNB 3MGSC 4XUJD 5AV5A 3AYWD 5BS7C 4J8XC 4XZQA 3O62B 3AZGC 5CP6C 4X23D 4J8VB 1TZYA 3KWQC 3REJA 2FFFB 3LJAD 3UTAA 3V9RB 3X1VD 2YFWB 2Y2IA 3A6ND 1ID3A 3NQUB 1KX3D 4J8WC 3AZHC 5GT0C 1BH8A 3LELD 4H9RB 1P34D 3AN2A 3MVDB 1P3PC 5GT3D 5B32G 4WU8B 5B2IA 4H9PB 1TAFA 4ZUXA 5AV8D 4JJND 5B2JA 1ZLAA 4UUZA 2AROB 3EG5B 5F99B 3LZ1D 3MGRC 4H9OB 3MNNA 3UTBA 5B1MD 1H3OA 3X1UC 3C1CA 1P3BA 5DNNA 5B32B 4YS3D 4WV4B 3MVDC 1P3KD 1HQ3A 3RELB 5AY8D 4Z66D 3KXBA 4YM6B 5JA4B 5F99C 3B6FA 3AZIA 3TU4D 1M18A 5B32C 5CPJD 3KUYB 4EO5B 1P3OB 1KU5A 4YM6C 5AV5B 3REKA 5AVBD 4XZQB 5BNXA 3AZLC 3AZJA 1TZYB 3REJB 4G92C 3LJAC 3MGPD 3X1TA 4KHAB 3C1BD 1AOID 1P3ID 2HIOD 1ID3B 4EO5C 1F66D 1P3OC 1N1JB 5B0ZC 1M1AC 5KDMA 1BH8B 4XZQC 3WA9D 3NQJA 1BFMA 5B2IB 4ZUXB 1TAFB 3R45A 3UT9D 5B2JB 2Y2PA 3AZNC 4UUZB 5AV6D 1ZLAB 1ID3C 5BNVA 3LZ1C 3MGSA 2Y2GA 5BS7A 3MNNB 4J8XA 3W98D 1H3OB 1HTAA 3REHD 5DNNB 5CP6A 2F8NA 1HQ3B 2ZY4A 4ZUXC 3KXBB 4UPKA 1ZLAC 1Z2CB 4J8WA 1P3FD 3W97C 2HUEB 3B6FB 5AVCC 2Y2HA 5GT0A 1P3PA 1M18B 3B6GD 2PYOC 5B1LA 2RIQA 2F8NH 3KXBC 4AWLB 3MGRA 2HUEC 5BNXB 3X1UA 3MGQC 3AZJB 3MVDA 3AZMC 3X1TB 2CV5B 1P3AB 4NE5A 2CWEA 4NFTA 4WU9D 4AWLC 5GXQD 5KDMB 4R8PD 3AZJC 3NQJB 2F8NG 3X1TC 3R45B 2CV5C 1P3AC 4KUDD 3W99C 5B40C 4YM6A 5BNVB 3MGSB 3WAAD 4XUJA 2Y2MA 3AYWA 4J8XB 4H9NA 3O62D 1U35C 5CP6B 3AZLA 4J8VD 2F8NB 3LJAA 1EQZD 5BT1D 4HGAC 5B33B 3A6NA 1P3OA 1M1AA 5B0ZA 4J8WB 3FDDA 5GT0B 3LELA 5DNMD 3WTPC 3AV2C 1P3PB 5BO0B 4H9SC 3REIB 4KHAA 5G49A 5B1LB 4J8UD 4LD9C 5B33C 3AZNA 4Z5TC 1M19B 2NZDD 1B6WA 3AZKD 3LZ1A 1N1JA 3MGRB 5B1MA 5E5AD 2JCHA 4Z2MH 2VQRA 3X1UB 3W96B 5CPKB 1WWIA 3P5JB 3X1SD 1P3KA 5B0YD 3RELD 5AY8A 3REIC 1P3MC 1KX4D 3AV1D 5B1LC 2G5HC 3WKJD 3W97A 1M19C 3AFAD 5AVCA 3KSYA 2RVQC 5AV9B 3TU4A 4KGCD 3W96C 5CPIC 5CPKC 2FJ7D 5CPJA 2BYMB 2PYOA 1P3GC 3A1IA 4Z2MG 3WAAC 2J8PA 4XUJB 5AV5D 3AYWB 4H9NB 3MGQA 3AZLB 5AV9C 3VH5W 1TZYD 2XD1A 4G92B 3LJAB 3MGPA 3REJD 3UTAD 3C1BA 3AZMA 1AOIA 1P3IA 1KX5C 3A6NB 1P3LD 1F66A 1KX3B 1M1AB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B0Z B;  5B31 D;  4XUJ C;  3LEL B;  3AYW C;  3AN2 D;  5GT3 B;  4X23 C;  3LZ0 D;  5AV8 B;  3UT9 A;  5G49 B;  2CV5 A;  3X1V C;  5B2J D;  1P3A A;  3AZN B;  5AV6 A;  3W99 A;  5B40 A;  3A6N C;  3LZ1 B;  1KX3 C;  3MNN D;  5B1M B;  5E5A C;  3UTB D;  3LEL C;  3C1C D;  3AZE D;  5DNN D;  1U35 A;  4YS3 B;  1P34 C;  1P3B D;  1P3K B;  5GT3 C;  3X1S C;  5AY8 B;  5AV8 C;  4Z66 B;  4JJN C;  3AZF D;  3W97 B;  4DRB A;  3B6F D;  5AVC B;  1Q9C A;  3AZI D;  5B1M C;  3WTP A;  3TU4 B;  3AV2 A;  1M18 D;  4YS3 C;  5CPJ B;  1P3K C;  4H9S A;  2PYO B;  4H9Q A;  5AY8 C;  4LD9 A;  5B33 A;  4Z66 C;  4Z5T A;  2BYK B;  3REK D;  5AVB B;  5B24 D;  5FUG A;  4QLC D;  3MGQ B;  3TU4 C;  1WWS A;  3AZM B;  3B0C W;  3MGP B;  1AOI B;  5CPJ C;  3C1B B;  5BO0 A;  1P3I B;  3REI A;  1P3M A;  2HIO B;  4WZS B;  1F66 B;  4WU9 A;  1M19 A;  2NQB D;  2YFV A;  5AVB C;  1S32 D;  3W96 A;  5CPI A;  3VH6 W;  5CPK A;  5JRG D;  3WA9 B;  5GSU D;  1AOI C;  3MGP C;  3UT9 B;  3C1B C;  1P3G A;  1P3I C;  5AV6 B;  2HIO C;  5B40 B;  3W99 B;  1F66 C;  3WAA A;  3MGS D;  3VH6 T;  4J8X D;  3REH B;  3AZG D;  1U35 B;  5CP6 D;  4CSR A;  5AV9 A;  3KWQ D;  3WA9 C;  1EQZ A;  2BYM A;  4G91 B;  4HGA B;  3UT9 C;  1KX5 A;  4E45 A;  5AV6 C;  1P3F B;  4J8W D;  3AZH D;  5GT0 D;  3W98 C;  5C3I B;  3WTP B;  5DNM A;  3REH C;  3AV2 B;  1P3P D;  4X23 A;  4H9Q B;  4J8U A;  3X1V A;  4G91 C;  4LD9 B;  2NZD A;  4Z5T B;  1KX3 A;  3MGR D;  1P3F C;  1B67 A;  5FUG B;  5E5A A;  3X1U D;  3B0B A;  1P34 A;  5C3I C;  3MVD D;  3X1S A;  5GT3 A;  5B0Y A;  3B6G C;  4WU8 D;  5AV8 A;  1P3M B;  4JJN A;  1R4V A;  3AV1 A;  1KX4 A;  4WU9 B;  2ARO D;  3AFA A;  5F99 D;  2YFV B;  5CPI B;  2FJ7 A;  2IO5 C;  5B32 D;  4YS3 A;  4ZBJ B;  1P3G B;  3WTP E;  2L5A A;  4Z66 A;  4M6B A;  4YM6 D;  3WAA B;  4WU9 C;  5GXQ C;  4CSR B;  3AZL D;  4R8P C;  1EQZ B;  3KUY D;  2LY8 A;  1KX5 B;  4ZBJ C;  1P3L A;  4KUD C;  1P3O D;  1M1A D;  5B0Z D;  5B31 A;  2BYK A;  5AVB A;  4XZQ D;  5DNM B;  3O62 C;  4X23 B;  3LZ0 A;  4J8V C;  1EQZ C;  4J8U B;  3X1V B;  5BT1 C;  2NZD B;  2HIO A;  3AZN D;  3AZK B;  1ID3 D;  3VH5 T;  5E5A B;  3B0D B;  3AZE A;  1BH9 A;  1P34 B;  5DNM C;  3X1S B;  5B0Y B;  3WA9 A;  4WU8 C;  1JFI A;  5B2I D;  4ZUX D;  4JJN B;  4J8U C;  3AZF A;  3AV1 B;  1KX4 B;  3WKJ B;  2NZD C;  1ZLA D;  2ARO C;  3AFA B;  3AZK C;  3W97 D;  5AVC D;  3W98 A;  3REH A;  3B0D C;  4KGC B;  2FJ7 B;  5B0Y C;  1HQ3 D;  3REL C;  2PYO D;  1KX4 C;  3KXB D;  3AV1 C;  3VH6 A;  3WKJ C;  1P3F A;  3AFA C;  5B24 A;  5B31 G;  4QLC A;  3MGQ D;  4KGC C;  3AZM D;  2FJ7 C;  3UTA B;  3B6G A;  3KUY C;  1P3L B;  5B31 B;  5AV5 C;  2NQB A;  1S32 A;  4E44 A;  3AN2 B;  4CAY A;  3LZ0 B;  5JRG A;  3AZJ D;  5GSU A;  1TZY C;  3X1T D;  3REJ C;  3UTA C;  2CV5 D;  1P3A D;  4NE6 A;  3W99 D;  1P3L C;  5B40 D;  5GXQ A;  3UTB B;  3B0C T;  4DRA A;  5B31 C;  3AZG A;  3C1C B;  3AZE B;  1BH9 B;  1U35 D;  1P3B B;  3AN2 C;  4R8P A;  3KWQ A;  3LZ0 C;  1JFI B;  5CHL B;  5B2I C;  3AZF B;  4KUD A;  5B2J C;  3AZH A;  4WNN A;  3W98 B;  3MNN C;  3AZI B;  3UTB C;  3WTP D;  3O62 A;  3AV2 D;  3C1C C;  3AZE C;  5DNN C;  1P3B C;  4J8V A;  2F8N D;  1HQ3 C;  1A7W A;  3V9R A;  2YFW A;  3AZF C;  5B33 D;  4LD9 D;  4Z5T D;  3NQU A;  3REK B;  2JSS A;  5B24 B;  3B6F C;  4QLC B;  2F8N K;  3AZI C;  4H9R A;  4NE3 A;  1M18 C;  3B6G B;  4WU8 A;  4H9P A;  3REI D;  1P3M D;  5B1L D;  2ARO A;  1M19 D;  3AZK A;  5F99 A;  3REK C;  2NQB B;  4H9O A;  5B24 C;  2RVQ D;  1S32 B;  4QLC C;  4CAY B;  5CPI D;  5JRG B;  2IO5 B;  5GSU B;  5B32 A;  5CPK D;  3W96 D;  3REL A;  1P3G D;  1ULY A;  3VH5 A;  3WKJ A;  5JA4 A;  5GXQ B;  3AZG B;  2NQB C;  1F1E A;  5AV9 D;  1S32 C;  4R8P B;  4KGC A;  3KWQ B;  5JRG C;  5GSU C;  3KUY A;  1KX5 D;  4KUD B;  3AZH B;  4WNN B;  3MGS C;  4XUJ D;  5AV5 A;  3AYW D;  5BS7 C;  4J8X C;  4XZQ A;  3O62 B;  3AZG C;  5CP6 C;  4X23 D;  4J8V B;  1TZY A;  3KWQ C;  3REJ A;  3LJA D;  3UTA A;  3V9R B;  3X1V D;  2YFW B;  3A6N D;  1ID3 A;  3NQU B;  1KX3 D;  4J8W C;  3AZH C;  5GT0 C;  1BH8 A;  3LEL D;  4H9R B;  1P34 D;  3AN2 A;  3MVD B;  1P3P C;  5GT3 D;  5B32 G;  4WU8 B;  5B2I A;  4H9P B;  1TAF A;  4ZUX A;  5AV8 D;  4JJN D;  5B2J A;  1ZLA A;  4UUZ A;  2ARO B;  5F99 B;  3LZ1 D;  3MGR C;  4H9O B;  3MNN A;  3UTB A;  5B1M D;  1H3O A;  3X1U C;  3C1C A;  1P3B A;  5DNN A;  5B32 B;  4YS3 D;  4WV4 B;  3MVD C;  1P3K D;  1HQ3 A;  3REL B;  5AY8 D;  4Z66 D;  3KXB A;  4YM6 B;  5JA4 B;  5F99 C;  3B6F A;  3AZI A;  3TU4 D;  1M18 A;  5B32 C;  5CPJ D;  3KUY B;  4EO5 B;  1P3O B;  1KU5 A;  4YM6 C;  5AV5 B;  3REK A;  5AVB D;  4XZQ B;  5BNX A;  3AZL C;  3AZJ A;  1TZY B;  3REJ B;  4G92 C;  3LJA C;  3MGP D;  3X1T A;  4KHA B;  3C1B D;  1AOI D;  1P3I D;  2HIO D;  1ID3 B;  4EO5 C;  1F66 D;  1P3O C;  1N1J B;  5B0Z C;  1M1A C;  5KDM A;  1BH8 B;  4XZQ C;  3WA9 D;  3NQJ A;  1BFM A;  5B2I B;  1TAF B;  3R45 A;  4ZUX B;  3UT9 D;  5B2J B;  3AZN C;  4UUZ B;  5AV6 D;  1ZLA B;  1ID3 C;  5BNV A;  3LZ1 C;  3MGS A;  3W98 D;  5BS7 A;  3MNN B;  4J8X A;  1H3O B;  1HTA A;  3REH D;  5DNN B;  5CP6 A;  2F8N A;  1HQ3 B;  4ZUX C;  3KXB B;  1ZLA C;  4J8W A;  1P3F D;  3W97 C;  2HUE B;  3B6F B;  5AVC C;  5GT0 A;  1P3P A;  1M18 B;  3B6G D;  2PYO C;  5B1L A;  2F8N H;  3KXB C;  4AWL B;  3MGR A;  2HUE C;  5BNX B;  3X1U A;  3MGQ C;  3AZJ B;  3MVD A;  3AZM C;  3X1T B;  2CV5 B;  1P3A B;  4NE5 A;  2CWE A;  4NFT A;  4WU9 D;  4AWL C;  5GXQ D;  5KDM B;  4R8P D;  3AZJ C;  3NQJ B;  2F8N G;  3X1T C;  3R45 B;  2CV5 C;  1P3A C;  4KUD D;  3W99 C;  5B40 C;  4YM6 A;  5BNV B;  3MGS B;  3WAA D;  4XUJ A;  3AYW A;  4J8X B;  4H9N A;  3O62 D;  1U35 C;  5CP6 B;  3AZL A;  4J8V D;  2F8N B;  3LJA A;  1EQZ D;  5BT1 D;  4HGA C;  5B33 B;  3A6N A;  1P3O A;  1M1A A;  5B0Z A;  4J8W B;  5GT0 B;  3LEL A;  5DNM D;  3WTP C;  3AV2 C;  1P3P B;  5BO0 B;  4H9S C;  3REI B;  4KHA A;  5G49 A;  5B1L B;  4J8U D;  4LD9 C;  5B33 C;  3AZN A;  4Z5T C;  1M19 B;  2NZD D;  1B6W A;  3AZK D;  3LZ1 A;  1N1J A;  3MGR B;  5B1M A;  5E5A D;  4Z2M H;  3X1U B;  3W96 B;  5CPK B;  1WWI A;  1P3K A;  3X1S D;  5B0Y D;  3REL D;  5AY8 A;  3REI C;  1P3M C;  1KX4 D;  3AV1 D;  5B1L C;  3WKJ D;  3W97 A;  1M19 C;  3AFA D;  5AVC A;  3KSY A;  2RVQ C;  5AV9 B;  3TU4 A;  4KGC D;  3W96 C;  5CPI C;  5CPK C;  2FJ7 D;  5CPJ A;  2BYM B;  2PYO A;  1P3G C;  4Z2M G;  3WAA C;  4XUJ B;  5AV5 D;  3AYW B;  4H9N B;  3MGQ A;  3AZL B;  5AV9 C;  3VH5 W;  1TZY D;  3AZM A;  4G92 B;  3LJA B;  3MGP A;  3REJ D;  3UTA D;  3C1B A;  1AOI A;  1P3I A;  1KX5 C;  3A6N B;  1P3L D;  1F66 A;  1KX3 B;  1M1A B; 
#chains in the Genus database with same CATH topology
 5B0Z B;  5B31 D;  4XUJ C;  3LEL B;  3AYW C;  3AN2 D;  2W8S A;  5GT3 B;  4X23 C;  3LZ0 D;  5AV8 B;  3UT9 A;  5G49 B;  2CV5 A;  3X1V C;  5B2J D;  1P3A A;  3AZN B;  5AV6 A;  3W99 A;  5B40 A;  3A6N C;  3LZ1 B;  2G5I C;  1KX3 C;  3MNN D;  5B1M B;  5E5A C;  3UTB D;  3LEL C;  3C1C D;  3AZE D;  5DNN D;  1U35 A;  4YS3 B;  1P34 C;  1P3B D;  1P3K B;  5GT3 C;  3X1S C;  5AY8 B;  5AV8 C;  4Z66 B;  4JJN C;  3AZF D;  3W97 B;  4DRB A;  3B6F D;  5AVC B;  1Q9C A;  3AZI D;  5B1M C;  3WTP A;  3TU4 B;  3AV2 A;  1M18 D;  4YS3 C;  5CPJ B;  3H0M C;  4H9S A;  1P3K C;  2PYO B;  4H9Q A;  5AY8 C;  4LD9 A;  5B33 A;  4Z66 C;  4Z5T A;  2BYK B;  3REK D;  5AVB B;  5B24 D;  5FUG A;  4QLC D;  3MGQ B;  3TU4 C;  1WWS A;  3AZM B;  3B0C W;  3MGP B;  1AOI B;  5CPJ C;  3C1B B;  5BO0 A;  1P3I B;  3REI A;  1P3M A;  2HIO B;  4WZS B;  1F66 B;  2JE5 A;  4WU9 A;  1M19 A;  2Y2Q A;  2NQB D;  2YFV A;  5AVB C;  2Y2J A;  1S32 D;  3W96 A;  5CPI A;  3VH6 W;  5CPK A;  5JRG D;  3WA9 B;  5GSU D;  3EPK A;  1AOI C;  3MGP C;  3UT9 B;  3C1B C;  1P3G A;  1P3I C;  5AV6 B;  2HIO C;  5B40 B;  3W99 B;  1F66 C;  3WAA A;  3MGS D;  3VH6 T;  4J8X D;  3REH B;  3AZG D;  1U35 B;  5CP6 D;  4CSR A;  5AV9 A;  3KWQ D;  3WA9 C;  1EQZ A;  2BYM A;  4G91 B;  4HGA B;  3UT9 C;  1KX5 A;  4E45 A;  5AV6 C;  1P3F B;  4J8W D;  3AZH D;  3H0R C;  5GT0 D;  3W98 C;  2ZY2 A;  5C3I B;  3WTP B;  5DNM A;  3REH C;  3AV2 B;  1P3P D;  4X23 A;  4H9Q B;  4J8U A;  3X1V A;  2DQN C;  1PZR A;  4G91 C;  4LD9 B;  2NZD A;  4Z5T B;  1KX3 A;  3MGR D;  1P3F C;  1B67 A;  5FUG B;  5E5A A;  3X1U D;  3B0B A;  1P34 A;  3H0L C;  5C3I C;  3MVD D;  3X1S A;  5GT3 A;  5B0Y A;  3B6G C;  4WU8 D;  2Y2N A;  5AV8 A;  1P3M B;  4JJN A;  1R4V A;  3AV1 A;  1KX4 A;  4WU9 B;  2ARO D;  3AFA A;  5F99 D;  2Y2K A;  2YFV B;  5CPI B;  2FJ7 A;  2IO5 C;  5B32 D;  4YS3 A;  4ZBJ B;  1P3G B;  3WTP E;  2L5A A;  3IP4 C;  4Z66 A;  4M6B A;  4YM6 D;  3WAA B;  4WU9 C;  5GXQ C;  4CSR B;  3AZL D;  4R8P C;  1EQZ B;  3KUY D;  2LY8 A;  1KX5 B;  4ZBJ C;  1P3L A;  4KUD C;  1P3O D;  1M1A D;  5B0Z D;  5B31 A;  2BYK A;  5AVB A;  4XZQ D;  5DNM B;  3O62 C;  4X23 B;  2Y2O A;  3LZ0 A;  4J8V C;  1EQZ C;  4J8U B;  3X1V B;  5BT1 C;  3F6T A;  2NZD B;  2HIO A;  3AZN D;  3AZK B;  1ID3 D;  3VH5 T;  2ZY3 A;  5E5A B;  3B0D B;  3AZE A;  1BH9 A;  1P34 B;  2Y2L A;  5DNM C;  3X1S B;  5B0Y B;  3WA9 A;  2BG1 A;  4DQY B;  4WU8 C;  1JFI A;  5B2I D;  4ZUX D;  4JJN B;  4J8U C;  3AZF A;  2XD5 A;  3AV1 B;  1KX4 B;  3WKJ B;  2NZD C;  1ZLA D;  2ARO C;  3AFA B;  3AZK C;  3W97 D;  2UWX A;  5AVC D;  3W98 A;  3REH A;  3B0D C;  4KGC B;  2FJ7 B;  5B0Y C;  1HQ3 D;  3REL C;  2PYO D;  3KFU G;  1KX4 C;  3KXB D;  3AV1 C;  3VH6 A;  3WKJ C;  1P3F A;  3AL0 C;  3AFA C;  2F2A C;  5B24 A;  5B31 G;  4QLC A;  3MGQ D;  4KGC C;  3AZM D;  2FJ7 C;  3UTA B;  4WJ3 C;  3B6G A;  3A1K A;  3KUY C;  1P3L B;  5B31 B;  5AV5 C;  2NQB A;  1S32 A;  4E44 A;  3AN2 B;  4CAY A;  3LZ0 B;  5JRG A;  3AZJ D;  5GSU A;  1TZY C;  3X1T D;  3REJ C;  3UTA C;  2CV5 D;  1P3A D;  4NE6 A;  3W99 D;  1P3L C;  5B40 D;  3EPH A;  2DF4 C;  5GXQ A;  3UTB B;  3B0C T;  4DRA A;  5B31 C;  3AZG A;  3C1C B;  3AZE B;  1BH9 B;  1U35 D;  1P3B B;  3AN2 C;  4R8P A;  3KWQ A;  3LZ0 C;  1JFI B;  5CHL B;  5B2I C;  3AZF B;  4KUD A;  5B2J C;  3AZH A;  4WNN A;  3EPL A;  3W98 B;  3MNN C;  3AZI B;  3UTB C;  3WTP D;  3O62 A;  3AV2 D;  3C1C C;  3AZE C;  5DNN C;  1P3B C;  4J8V A;  2F8N D;  1HQ3 C;  1A7W A;  3V9R A;  2YFW A;  3AZF C;  5B33 D;  4LD9 D;  4Z5T D;  2ZY5 A;  3NQU A;  3REK B;  2JSS A;  5B24 B;  3B6F C;  4QLC B;  2F8N K;  3AZI C;  4H9R A;  4NE3 A;  1M18 C;  3B6G B;  4WU8 A;  4H9P A;  3REI D;  1P3M D;  1W2E A;  5B1L D;  1T3U A;  2ARO A;  1M19 D;  3AZK A;  5F99 A;  3REK C;  2NQB B;  4H9O A;  5B24 C;  2RVQ D;  1S32 B;  4QLC C;  4CAY B;  5CPI D;  5JRG B;  2IO5 B;  5GSU B;  5B32 A;  5CPK D;  3W96 D;  3REL A;  1P3G D;  1ULY A;  3VH5 A;  3WKJ A;  5JA4 A;  5GXQ B;  3AZG B;  2NQB C;  1F1E A;  5AV9 D;  1S32 C;  4R8P B;  4KGC A;  3KWQ B;  2ZM5 A;  5JRG C;  5GSU C;  3KUY A;  1KX5 D;  3EPJ A;  4KUD B;  3AZH B;  4WNN B;  3MGS C;  4XUJ D;  5AV5 A;  3AYW D;  5BS7 C;  4J8X C;  4XZQ A;  3O62 B;  3AZG C;  5CP6 C;  4X23 D;  4J8V B;  1TZY A;  3KWQ C;  3REJ A;  2FFF B;  3LJA D;  3UTA A;  3V9R B;  3X1V D;  2YFW B;  2Y2I A;  3A6N D;  1ID3 A;  3NQU B;  1KX3 D;  4J8W C;  3AZH C;  5GT0 C;  1BH8 A;  3LEL D;  4H9R B;  1P34 D;  3AN2 A;  3MVD B;  1P3P C;  5GT3 D;  5B32 G;  4WU8 B;  5B2I A;  4H9P B;  1TAF A;  4ZUX A;  5AV8 D;  4JJN D;  5B2J A;  1ZLA A;  4UUZ A;  2ARO B;  3EG5 B;  5F99 B;  3LZ1 D;  3MGR C;  4H9O B;  3MNN A;  3UTB A;  5B1M D;  1H3O A;  3X1U C;  3C1C A;  1P3B A;  5DNN A;  5B32 B;  4YS3 D;  4WV4 B;  3MVD C;  1P3K D;  1HQ3 A;  3REL B;  5AY8 D;  4Z66 D;  3KXB A;  4YM6 B;  5JA4 B;  5F99 C;  3B6F A;  3AZI A;  3TU4 D;  1M18 A;  5B32 C;  5CPJ D;  3KUY B;  4EO5 B;  1P3O B;  1KU5 A;  4YM6 C;  5AV5 B;  3REK A;  5AVB D;  4XZQ B;  5BNX A;  3AZL C;  3AZJ A;  1TZY B;  3REJ B;  4G92 C;  3LJA C;  3MGP D;  3X1T A;  4KHA B;  3C1B D;  1AOI D;  1P3I D;  2HIO D;  1ID3 B;  4EO5 C;  1F66 D;  1P3O C;  1N1J B;  5B0Z C;  1M1A C;  5KDM A;  1BH8 B;  4XZQ C;  3WA9 D;  3NQJ A;  1BFM A;  5B2I B;  4ZUX B;  1TAF B;  3R45 A;  3UT9 D;  5B2J B;  2Y2P A;  3AZN C;  4UUZ B;  5AV6 D;  1ZLA B;  1ID3 C;  5BNV A;  3LZ1 C;  3MGS A;  2Y2G A;  5BS7 A;  3MNN B;  4J8X A;  3W98 D;  1H3O B;  1HTA A;  3REH D;  5DNN B;  5CP6 A;  2F8N A;  1HQ3 B;  2ZY4 A;  4ZUX C;  3KXB B;  4UPK A;  1ZLA C;  1Z2C B;  4J8W A;  1P3F D;  3W97 C;  2HUE B;  3B6F B;  5AVC C;  2Y2H A;  5GT0 A;  1P3P A;  1M18 B;  3B6G D;  2PYO C;  5B1L A;  2RIQ A;  2F8N H;  3KXB C;  4AWL B;  3MGR A;  2HUE C;  5BNX B;  3X1U A;  3MGQ C;  3AZJ B;  3MVD A;  3AZM C;  3X1T B;  2CV5 B;  1P3A B;  4NE5 A;  2CWE A;  4NFT A;  4WU9 D;  4AWL C;  5GXQ D;  5KDM B;  4R8P D;  3AZJ C;  3NQJ B;  2F8N G;  3X1T C;  3R45 B;  2CV5 C;  1P3A C;  4KUD D;  3W99 C;  5B40 C;  4YM6 A;  5BNV B;  3MGS B;  3WAA D;  4XUJ A;  2Y2M A;  3AYW A;  4J8X B;  4H9N A;  3O62 D;  1U35 C;  5CP6 B;  3AZL A;  4J8V D;  2F8N B;  3LJA A;  1EQZ D;  5BT1 D;  4HGA C;  5B33 B;  3A6N A;  1P3O A;  1M1A A;  5B0Z A;  4J8W B;  3FDD A;  5GT0 B;  3LEL A;  5DNM D;  3WTP C;  3AV2 C;  1P3P B;  5BO0 B;  4H9S C;  3REI B;  4KHA A;  5G49 A;  5B1L B;  4J8U D;  4LD9 C;  5B33 C;  3AZN A;  4Z5T C;  1M19 B;  2NZD D;  1B6W A;  3AZK D;  3LZ1 A;  1N1J A;  3MGR B;  5B1M A;  5E5A D;  2JCH A;  4Z2M H;  2VQR A;  3X1U B;  3W96 B;  5CPK B;  1WWI A;  3P5J B;  3X1S D;  1P3K A;  5B0Y D;  3REL D;  5AY8 A;  3REI C;  1P3M C;  1KX4 D;  3AV1 D;  5B1L C;  2G5H C;  3WKJ D;  3W97 A;  1M19 C;  3AFA D;  5AVC A;  3KSY A;  2RVQ C;  5AV9 B;  3TU4 A;  4KGC D;  3W96 C;  5CPI C;  5CPK C;  2FJ7 D;  5CPJ A;  2BYM B;  2PYO A;  1P3G C;  3A1I A;  4Z2M G;  3WAA C;  2J8P A;  4XUJ B;  5AV5 D;  3AYW B;  4H9N B;  3MGQ A;  3AZL B;  5AV9 C;  3VH5 W;  1TZY D;  2XD1 A;  4G92 B;  3LJA B;  3MGP A;  3REJ D;  3UTA D;  3C1B A;  3AZM A;  1AOI A;  1P3I A;  1KX5 C;  3A6N B;  1P3L D;  1F66 A;  1KX3 B;  1M1A B; 
#chains in the Genus database with same CATH homology
 5B0Z B;  5B31 D;  4XUJ C;  3LEL B;  3AYW C;  3AN2 D;  2W8S A;  5GT3 B;  4X23 C;  3LZ0 D;  5AV8 B;  3UT9 A;  5G49 B;  2CV5 A;  3X1V C;  5B2J D;  1P3A A;  3AZN B;  5AV6 A;  3W99 A;  5B40 A;  3A6N C;  3LZ1 B;  2G5I C;  1KX3 C;  3MNN D;  5B1M B;  5E5A C;  3UTB D;  3LEL C;  3C1C D;  3AZE D;  5DNN D;  1U35 A;  4YS3 B;  1P34 C;  1P3B D;  1P3K B;  5GT3 C;  3X1S C;  5AY8 B;  5AV8 C;  4Z66 B;  4JJN C;  3AZF D;  3W97 B;  4DRB A;  3B6F D;  5AVC B;  1Q9C A;  3AZI D;  5B1M C;  3WTP A;  3TU4 B;  3AV2 A;  1M18 D;  4YS3 C;  5CPJ B;  3H0M C;  4H9S A;  1P3K C;  2PYO B;  4H9Q A;  5AY8 C;  4LD9 A;  5B33 A;  4Z66 C;  4Z5T A;  2BYK B;  3REK D;  5AVB B;  5B24 D;  5FUG A;  4QLC D;  3MGQ B;  3TU4 C;  1WWS A;  3AZM B;  3B0C W;  3MGP B;  1AOI B;  5CPJ C;  3C1B B;  5BO0 A;  1P3I B;  3REI A;  1P3M A;  2HIO B;  4WZS B;  1F66 B;  2JE5 A;  4WU9 A;  1M19 A;  2Y2Q A;  2NQB D;  2YFV A;  5AVB C;  2Y2J A;  1S32 D;  3W96 A;  5CPI A;  3VH6 W;  5CPK A;  5JRG D;  3WA9 B;  5GSU D;  3EPK A;  1AOI C;  3MGP C;  3UT9 B;  3C1B C;  1P3G A;  1P3I C;  5AV6 B;  2HIO C;  5B40 B;  3W99 B;  1F66 C;  3WAA A;  3MGS D;  3VH6 T;  4J8X D;  3REH B;  3AZG D;  1U35 B;  5CP6 D;  4CSR A;  5AV9 A;  3KWQ D;  3WA9 C;  1EQZ A;  2BYM A;  4G91 B;  4HGA B;  3UT9 C;  1KX5 A;  4E45 A;  5AV6 C;  1P3F B;  4J8W D;  3AZH D;  3H0R C;  5GT0 D;  3W98 C;  2ZY2 A;  5C3I B;  3WTP B;  5DNM A;  3REH C;  3AV2 B;  1P3P D;  4X23 A;  4H9Q B;  4J8U A;  3X1V A;  2DQN C;  1PZR A;  4G91 C;  4LD9 B;  2NZD A;  4Z5T B;  1KX3 A;  3MGR D;  1P3F C;  1B67 A;  5FUG B;  5E5A A;  3X1U D;  3B0B A;  1P34 A;  3H0L C;  5C3I C;  3MVD D;  3X1S A;  5GT3 A;  5B0Y A;  3B6G C;  4WU8 D;  2Y2N A;  5AV8 A;  1P3M B;  4JJN A;  1R4V A;  3AV1 A;  1KX4 A;  4WU9 B;  2ARO D;  3AFA A;  5F99 D;  2Y2K A;  2YFV B;  5CPI B;  2FJ7 A;  2IO5 C;  5B32 D;  4YS3 A;  4ZBJ B;  1P3G B;  3WTP E;  2L5A A;  3IP4 C;  4Z66 A;  4M6B A;  4YM6 D;  3WAA B;  4WU9 C;  5GXQ C;  4CSR B;  3AZL D;  4R8P C;  1EQZ B;  3KUY D;  2LY8 A;  1KX5 B;  4ZBJ C;  1P3L A;  4KUD C;  1P3O D;  1M1A D;  5B0Z D;  5B31 A;  2BYK A;  5AVB A;  4XZQ D;  5DNM B;  3O62 C;  4X23 B;  2Y2O A;  3LZ0 A;  4J8V C;  1EQZ C;  4J8U B;  3X1V B;  5BT1 C;  3F6T A;  2NZD B;  2HIO A;  3AZN D;  3AZK B;  1ID3 D;  3VH5 T;  2ZY3 A;  5E5A B;  3B0D B;  3AZE A;  1BH9 A;  1P34 B;  2Y2L A;  5DNM C;  3X1S B;  5B0Y B;  3WA9 A;  2BG1 A;  4DQY B;  4WU8 C;  1JFI A;  5B2I D;  4ZUX D;  4JJN B;  4J8U C;  3AZF A;  2XD5 A;  3AV1 B;  1KX4 B;  3WKJ B;  2NZD C;  1ZLA D;  2ARO C;  3AFA B;  3AZK C;  3W97 D;  2UWX A;  5AVC D;  3W98 A;  3REH A;  3B0D C;  4KGC B;  2FJ7 B;  5B0Y C;  1HQ3 D;  3REL C;  2PYO D;  3KFU G;  1KX4 C;  3KXB D;  3AV1 C;  3VH6 A;  3WKJ C;  1P3F A;  3AL0 C;  3AFA C;  2F2A C;  5B24 A;  5B31 G;  4QLC A;  3MGQ D;  4KGC C;  3AZM D;  2FJ7 C;  3UTA B;  4WJ3 C;  3B6G A;  3A1K A;  3KUY C;  1P3L B;  5B31 B;  5AV5 C;  2NQB A;  1S32 A;  4E44 A;  3AN2 B;  4CAY A;  3LZ0 B;  5JRG A;  3AZJ D;  5GSU A;  1TZY C;  3X1T D;  3REJ C;  3UTA C;  2CV5 D;  1P3A D;  4NE6 A;  3W99 D;  1P3L C;  5B40 D;  3EPH A;  2DF4 C;  5GXQ A;  3UTB B;  3B0C T;  4DRA A;  5B31 C;  3AZG A;  3C1C B;  3AZE B;  1BH9 B;  1U35 D;  1P3B B;  3AN2 C;  4R8P A;  3KWQ A;  3LZ0 C;  1JFI B;  5CHL B;  5B2I C;  3AZF B;  4KUD A;  5B2J C;  3AZH A;  4WNN A;  3EPL A;  3W98 B;  3MNN C;  3AZI B;  3UTB C;  3WTP D;  3O62 A;  3AV2 D;  3C1C C;  3AZE C;  5DNN C;  1P3B C;  4J8V A;  2F8N D;  1HQ3 C;  1A7W A;  3V9R A;  2YFW A;  3AZF C;  5B33 D;  4LD9 D;  4Z5T D;  2ZY5 A;  3NQU A;  3REK B;  2JSS A;  5B24 B;  3B6F C;  4QLC B;  2F8N K;  3AZI C;  4H9R A;  4NE3 A;  1M18 C;  3B6G B;  4WU8 A;  4H9P A;  3REI D;  1P3M D;  1W2E A;  5B1L D;  1T3U A;  2ARO A;  1M19 D;  3AZK A;  5F99 A;  3REK C;  2NQB B;  4H9O A;  5B24 C;  2RVQ D;  1S32 B;  4QLC C;  4CAY B;  5CPI D;  5JRG B;  2IO5 B;  5GSU B;  5B32 A;  5CPK D;  3W96 D;  3REL A;  1P3G D;  1ULY A;  3VH5 A;  3WKJ A;  5JA4 A;  5GXQ B;  3AZG B;  2NQB C;  1F1E A;  5AV9 D;  1S32 C;  4R8P B;  4KGC A;  3KWQ B;  2ZM5 A;  5JRG C;  5GSU C;  3KUY A;  1KX5 D;  3EPJ A;  4KUD B;  3AZH B;  4WNN B;  3MGS C;  4XUJ D;  5AV5 A;  3AYW D;  5BS7 C;  4J8X C;  4XZQ A;  3O62 B;  3AZG C;  5CP6 C;  4X23 D;  4J8V B;  1TZY A;  3KWQ C;  3REJ A;  2FFF B;  3LJA D;  3UTA A;  3V9R B;  3X1V D;  2YFW B;  2Y2I A;  3A6N D;  1ID3 A;  3NQU B;  1KX3 D;  4J8W C;  3AZH C;  5GT0 C;  1BH8 A;  3LEL D;  4H9R B;  1P34 D;  3AN2 A;  3MVD B;  1P3P C;  5GT3 D;  5B32 G;  4WU8 B;  5B2I A;  4H9P B;  1TAF A;  4ZUX A;  5AV8 D;  4JJN D;  5B2J A;  1ZLA A;  4UUZ A;  2ARO B;  3EG5 B;  5F99 B;  3LZ1 D;  3MGR C;  4H9O B;  3MNN A;  3UTB A;  5B1M D;  1H3O A;  3X1U C;  3C1C A;  1P3B A;  5DNN A;  5B32 B;  4YS3 D;  4WV4 B;  3MVD C;  1P3K D;  1HQ3 A;  3REL B;  5AY8 D;  4Z66 D;  3KXB A;  4YM6 B;  5JA4 B;  5F99 C;  3B6F A;  3AZI A;  3TU4 D;  1M18 A;  5B32 C;  5CPJ D;  3KUY B;  4EO5 B;  1P3O B;  1KU5 A;  4YM6 C;  5AV5 B;  3REK A;  5AVB D;  4XZQ B;  5BNX A;  3AZL C;  3AZJ A;  1TZY B;  3REJ B;  4G92 C;  3LJA C;  3MGP D;  3X1T A;  4KHA B;  3C1B D;  1AOI D;  1P3I D;  2HIO D;  1ID3 B;  4EO5 C;  1F66 D;  1P3O C;  1N1J B;  5B0Z C;  1M1A C;  5KDM A;  1BH8 B;  4XZQ C;  3WA9 D;  3NQJ A;  1BFM A;  5B2I B;  4ZUX B;  1TAF B;  3R45 A;  3UT9 D;  5B2J B;  2Y2P A;  3AZN C;  4UUZ B;  5AV6 D;  1ZLA B;  1ID3 C;  5BNV A;  3LZ1 C;  3MGS A;  2Y2G A;  5BS7 A;  3MNN B;  4J8X A;  3W98 D;  1H3O B;  1HTA A;  3REH D;  5DNN B;  5CP6 A;  2F8N A;  1HQ3 B;  2ZY4 A;  4ZUX C;  3KXB B;  4UPK A;  1ZLA C;  1Z2C B;  4J8W A;  1P3F D;  3W97 C;  2HUE B;  3B6F B;  5AVC C;  2Y2H A;  5GT0 A;  1P3P A;  1M18 B;  3B6G D;  2PYO C;  5B1L A;  2RIQ A;  2F8N H;  3KXB C;  4AWL B;  3MGR A;  2HUE C;  5BNX B;  3X1U A;  3MGQ C;  3AZJ B;  3MVD A;  3AZM C;  3X1T B;  2CV5 B;  1P3A B;  4NE5 A;  2CWE A;  4NFT A;  4WU9 D;  4AWL C;  5GXQ D;  5KDM B;  4R8P D;  3AZJ C;  3NQJ B;  2F8N G;  3X1T C;  3R45 B;  2CV5 C;  1P3A C;  4KUD D;  3W99 C;  5B40 C;  4YM6 A;  5BNV B;  3MGS B;  3WAA D;  4XUJ A;  2Y2M A;  3AYW A;  4J8X B;  4H9N A;  3O62 D;  1U35 C;  5CP6 B;  3AZL A;  4J8V D;  2F8N B;  3LJA A;  1EQZ D;  5BT1 D;  4HGA C;  5B33 B;  3A6N A;  1P3O A;  1M1A A;  5B0Z A;  4J8W B;  3FDD A;  5GT0 B;  3LEL A;  5DNM D;  3WTP C;  3AV2 C;  1P3P B;  5BO0 B;  4H9S C;  3REI B;  4KHA A;  5G49 A;  5B1L B;  4J8U D;  4LD9 C;  5B33 C;  3AZN A;  4Z5T C;  1M19 B;  2NZD D;  1B6W A;  3AZK D;  3LZ1 A;  1N1J A;  3MGR B;  5B1M A;  5E5A D;  2JCH A;  4Z2M H;  2VQR A;  3X1U B;  3W96 B;  5CPK B;  1WWI A;  3P5J B;  3X1S D;  1P3K A;  5B0Y D;  3REL D;  5AY8 A;  3REI C;  1P3M C;  1KX4 D;  3AV1 D;  5B1L C;  2G5H C;  3WKJ D;  3W97 A;  1M19 C;  3AFA D;  5AVC A;  3KSY A;  2RVQ C;  5AV9 B;  3TU4 A;  4KGC D;  3W96 C;  5CPI C;  5CPK C;  2FJ7 D;  5CPJ A;  2BYM B;  2PYO A;  1P3G C;  3A1I A;  4Z2M G;  3WAA C;  2J8P A;  4XUJ B;  5AV5 D;  3AYW B;  4H9N B;  3MGQ A;  3AZL B;  5AV9 C;  3VH5 W;  1TZY D;  2XD1 A;  4G92 B;  3LJA B;  3MGP A;  3REJ D;  3UTA D;  3C1B A;  3AZM A;  1AOI A;  1P3I A;  1KX5 C;  3A6N B;  1P3L D;  1F66 A;  1KX3 B;  1M1A B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...