5E5AB

Crystal structure of the chromatin-tethering domain of human cytomegalovirus ie1 protein bound to the nucleosome core particle
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
79
structure length
79
Chain Sequence
DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding/viral protein/dna
molecule keywords DNA (146-MER)
publication title Human cytomegalovirus IE1 protein alters the higher-order chromatin structure by targeting the acidic patch of the nucleosome
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 79
sequence length 79
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5e5aB00
3AV1D 4WU8C 3X1SC 5FUGA 4AWLC 3REKC 3UTBA 5CPJC 3WTPE 1S32D 1EQZC 3REID 3B6GD 4JJNB 4KHAB 3C1BA 3KWQC 1P3PC 4KGCD 5GT3D 3MGSC 3KXBC 3AZKC 4QLCD 3W98D 3AZED 5BS7C 1KX3D 5AV9C 5B2IA 1ID3B 5CPID 3AV1B 3X1VB 5GT0C 3AN2D 3B0BA 3AYWA 3AZJC 5AV6A 3VH6A 3MGPD 3KUYA 4YS3C 3B6GB 1P3FB 3AZNA 3NQJA 3WA9D 4J8UD 5CP6D 3V9RA 3WAAC 3WTPC 5B31G 3W98B 3AZEB 1N1JA 5CPKD 1KX3B 5CPIB 2CV5D 1KX4D 3AN2B 3MGQD 3LZ1C 3MGPB 4H9OA 3LJAC 4Z5TA 3WA9B 3B6FC 4J8UB 1HQ3D 5BNVB 5GSUA 5DNMC 5B0YB 3AFAD 1TAFA 5CPKB 5B24A 2CV5B 2BYMB 1KX4B 4AWLB 3REKB 3MGQB 3AZJD 1EQZB 2FJ7A 4X23C 4WU9C 1P3AC 4CAYA 1HQ3B 1KX5A 2AROC 5KDMB 3LELA 2YFWB 5B1MA 5AV5A 3AZKB 5AV8D 5AY8D 3AZLD 4ZBJC 4J8XA 1ZLAC 3AZJB 3A6NC 3TU4D 3AZMD 4YS3B 5B1LA 5BO0B 5JRGC 3UT9A 1M1AC 4NE3A 5AV8B 5AY8B 3RELA 3X1UD 5GXQD 1F66A 3KSYA 4WV4B 2NQBD 4LD9C 1P3MA 5AVBD 3LJAB 3AZHA 5B32A 5DNND 3AZMB 2HIOA 1P34D 3UTBC 4J8WA 5B2JA 1Q9CA 1TZYA 3C1BC 3X1UB 2F8NH 5GXQB 3R45B 1AOIA 4G92B 2NQBB 2NZDA 3W96A 1P3GA 5AVBB 1M19A 5B2IC 4X23B 3B0DB 3MGRD 4ZUXA 3AYWC 1P3LD 5AV6C 3MVDD 4KUDA 4H9PA 3KUYC 4M6BA 3AZNC 2F8NB 1BH8A 3REJD 4ZBJB 5B32G 4WNNB 1M18C 4LD9D 5B33A 4H9RA 3C1CA 3MNNA 4YM6A 3LZ0A 1P3LB 5E5AA 3X1TD 3MVDB 1ULYA 5B0ZA 4XZQA 5AVCA 3O62A 4E45A 3AV2D 5GSUC 4LD9B 3WKJA 4HGAC 2PYOA 1P3IA 4H9NA 1H3OB 3W99A 1P3BA 5B24C 4G91C 2CWEA 4H9QA 5B31A 1ID3D 2FJ7C 5B40D 3AZFD 4WZSB 5BT1C 3X1VD 2IO5C 1KX5C 3AV2B 3LELC 5B1MC 5AV5C 1P3FD 1WWSA 1M18D 4Z66A 5B2IB 4NE6A 2HUEB 4R8PA 1JFIA 4J8XC 3REHD 3AYWB 5AV6B 3NQUA 1P3KA 5B40B 3AZFB 5F99A 3KUYB 4XUJD 5B1LC 4J8VC 3UTAA 4UUZA 3UT9C 1M18B 3W97A 3RELC 1F66C 5B0YD 3REHB 1U35A 3AZID 3AZGD 1P3MC 4H9OB 4WU8D 5B32C 4XUJB 3X1SD 4JJNA 2HIOC 4KHAA 5CPJD 3REKD 1BH9A 1EQZD 4J8WC 5B2JC 1TZYC 3KWQD 4HGAB 1P3PD 5C3IC 3MGSD 3AV1A 1AOIC 4H9SA 3KXBD 3AZKD 1S32A 2NZDC 3AZIB 1P3GC 3AZGB 5AV9D 3REIA 1M19C 4WU8B 2FJ7B 3B6GA 3X1SB 5CPJB 4KGCA 5GT0D 2IO5B 5GT3A 3VH5W 4E44A 4J8VD 1KX5B 4KUDC 4YS3D 5B1MB 4QLCA 3W98A 3AZEA 3KWQB 1P3PB 1KX3A 3MGSB 5CPIA 1R4VA 3WAAD 3KXBB 3WTPD 1B6WA 3AN2A 4NE5A 3MGPA 5AV9B 5B33C 3C1CC 3MNNC 3WA9A 4YM6C 5GT0B 1WWIA 4J8UA 5CP6A 3LZ0C 3LZ1D 4J8VB 5E5AC 5BNVA 3LJAD 5B0ZC 3B6FD 5CPKA 4XZQC 3WAAB 3WTPB 5AVCC 5DNMD 3O62C 2CV5A 3B0CW 1KX4A 3MGQA 3WKJC 1P3IC 1P3MB 1P3BC 5G49B 1P3OC 1HQ3A 3LZ1B 5KDMA 5B31C 4J8WB 2YFWA 4X23D 4WU9D 4DRAA 3AFAA 1P3AD 3B6FB 2AROD 5DNMB 2YFVB 2F8ND 3AZJA 2BYKB 4Z66C 4CSRB 4Z2MH 4R8PC 1ZLAD 5BO0A 3A6ND 4KUDB 4WU9B 1P3KC 1P3AB 5AV8A 5AY8A 5BNXB 2AROB 3AZLA 5JRGD 1M1AD 3UTAC 3TU4A 3W97C 3C1CB 3AZMA 3MNNB 4YM6B 1P3OD 1ZLAB 1U35C 3A6NB 5E5AB 5B0ZB 2F8NK 4JJNC 3UTBD 4XZQB 3X1UA 5GXQA 3R45A 4Z5TC 5JRGB 1M1AB 5AVCB 3VH5T 2NQBA 2RVQC 3C1BD 5AVBA 5DNNA 4H9SC 1P34A 1P3OB 1S32C 5B31B 3REIC 5B2ID 5FUGB 4KGCC 3UTBB 3AYWD 5GT3C 5AV6D 3KUYD 4QLCC 3AZND 4WNNA 3W98C 3C1BB 1KX3C 2L5AA 2LY8A 4Z66B 3MGRA 1P3LA 3B0CT 3MVDA 3MGPC 3WA9C 4J8UC 3REJA 5CP6C 1A7WA 4Z5TD 3AZNB 4LD9A 3NQJB 5CPKC 5JA4A 3V9RB 5GSUD 2CV5C 1KX4C 3MGQC 1N1JB 3X1TA 1U35B 2F8NG 3VH6W 4Z2MG 5B24D 1HQ3C 1BH9B 3AV2A 3AZHC 4Z5TB 2FJ7D 5BT1D 3AFAC 1KX5D 3LELD 5GSUB 5B1MD 5AV5D 1TAFB 1S32B 1ID3A 3REIB 5B40A 3AZFA 5B24B 3X1VA 4G91B 3W96C 4KGCB 4J8XD 5GT3B 2JSSA 1BFMA 1P3FA 4QLCB 4CAYB 5AV8C 5AY8C 1M18A 4ZUXC 5B1LD 1F1EA 3LELB 4EO5C 3AZLC 5CHLB 1B67A 5AV5B 3UT9D 3REHA 3RELD 3TU4C 1F66D 3AZMC 4XUJA 4J8XB 5CP6B 1P3MD 3AZHD 5B32D 3VH5A 2HIOD 5B1LB 3X1UC 4J8WD 5GXQC 5B2JD 5B0YA 3UT9B 4G92C 2NQBC 3AZIA 1TZYD 3AZGA 3RELB 5AVBC 4WU8A 1F66B 5DNNC 2BYMA 3X1SA 1AOID 4NFTA 3REKA 5CPJA 1P34C 2NZDD 3W96D 1P3GD 3B0DC 1EQZA 2PYOC 1M19D 3W99C 3AZHB 5B32B 2HIOB 3AFAB 3KWQA 1P3PA 3MGSA 4ZUXD 4KUDD 5B2JB 3KXBA 3AZKA 1TZYB 5BS7A 5AV9A 5C3IB 1AOIB 5GT0A 2NZDB 3W96B 1P3GB 1HTAA 3MGRC 1P3LC 4J8VA 3MVDC 1M19B 5B33D 3C1CD 4YS3A 3MNND 4YM6D 3VH6T 4ZUXB 3LZ0D 3REJC 5E5AD 3WAAA 3WTPA 4H9PB 4EO5B 3AZLB 5F99C 5B0ZD 4XZQD 1BH8B 3TU4B 5AVCD 3O62D 5G49A 3LZ1A 3WKJD 2PYOD 3X1TC 3LJAA 5B33B 4H9RB 1P3ID 3W99D 1P3BD 3B6FA 3LZ0B 5B31D 5DNMA 3AV2C 2YFVA 2BYKA 3O62B 5DNNB 4CSRA 4DRBA 2HUEC 1P34B 3WKJB 2PYOB 1P3IB 1ID3C 4H9NB 4X23A 3AV1C 4WU9A 3W99B 4Z66D 5B40C 3AZFC 1P3AA 1P3BB 5BNXA 3X1VC 4R8PD 4H9QB 2AROA 3B6GC 1P3FC 1P3KD 2F8NA 5F99D 3UTAD 3AZEC 1ZLAA 3REHC 3MGRB 3A6NA 3W97D 5CPIC 1KU5A 4XUJC 3AN2C 4R8PB 1JFIB 1U35D 3REJB 3NQUB 5JRGA 1M1AA 1P3KB 5F99B 4JJND 5JA4B 5B0YC 3UTAB 4UUZB 1P3OA 2RVQD 3AZIC 3AZGC 3W97B 1H3OA 3X1TB
chains in the Genus database with same CATH superfamily
3AV1D 4WU8C 3X1SC 5FUGA 4AWLC 3REKC 2XD1A 3P5JB 3WTPE 3UTBA 5CPJC 1S32D 1EQZC 3REID 3B6GD 4JJNB 4KHAB 3C1BA 3KWQC 1P3PC 4KGCD 5GT3D 3MGSC 3KXBC 3AZKC 4QLCD 3W98D 3AZED 5BS7C 1KX3D 5AV9C 5B2IA 1ID3B 5CPID 3AV1B 3X1VB 5GT0C 3AN2D 3B0BA 3AYWA 3AZJC 5AV6A 3VH6A 3MGPD 3EPJA 3KUYA 2ZY5A 4YS3C 1P3FB 3B6GB 3AZNA 3NQJA 3WA9D 4J8UD 5CP6D 3V9RA 3WAAC 3WTPC 5B31G 3W98B 3AZEB 1N1JA 5CPKD 1KX3B 5CPIB 2CV5D 1KX4D 3AN2B 3MGQD 3LZ1C 3MGPB 4H9OA 3LJAC 4Z5TA 2Y2PA 3B6FC 3WA9B 2Y2LA 4J8UB 1HQ3D 5BNVB 2Y2JA 5DNMC 5GSUA 5B0YB 3AFAD 1TAFA 5CPKB 5B24A 2CV5B 2BYMB 4DQYB 1KX4B 4AWLB 3REKB 2Y2KA 3MGQB 3AZJD 1EQZB 2FJ7A 4X23C 4WU9C 1P3AC 4CAYA 1HQ3B 1KX5A 2AROC 5KDMB 3LELA 2YFWB 5B1MA 5AV5A 3AZKB 5AV8D 5AY8D 2ZY3A 4ZBJC 3AZLD 4J8XA 1ZLAC 3AZJB 3A6NC 2UWXA 3TU4D 3AZMD 4YS3B 5B1LA 2ZY4A 5BO0B 5JRGC 3UT9A 1M1AC 4NE3A 5AV8B 5AY8B 2Y2OA 3RELA 3X1UD 5GXQD 1F66A 3KSYA 4WV4B 2NQBD 4LD9C 1P3MA 5AVBD 3LJAB 3AZHA 5B32A 5DNND 3AZMB 2HIOA 3EPLA 2JCHA 1P34D 3UTBC 4J8WA 5B2JA 1Q9CA 1TZYA 3C1BC 3X1UB 2F8NH 5GXQB 3R45B 1AOIA 4G92B 2NQBB 2NZDA 3W96A 1P3GA 5AVBB 1M19A 5B2IC 4X23B 1PZRA 3B0DB 3MGRD 4ZUXA 3AYWC 1P3LD 5AV6C 3MVDD 4KUDA 4H9PA 3KUYC 4M6BA 3AZNC 2F8NB 1BH8A 3REJD 4ZBJB 5B32G 4WNNB 1M18C 4LD9D 3H0LC 4H9RA 5B33A 3C1CA 3MNNA 1T3UA 4YM6A 2Y2NA 3LZ0A 1P3LB 5E5AA 3X1TD 3MVDB 1ULYA 5B0ZA 4XZQA 5AVCA 3O62A 4E45A 3AV2D 5GSUC 3F6TA 4LD9B 3WKJA 4HGAC 2PYOA 1P3IA 4H9NA 1H3OB 3W99A 1P3BA 5B24C 4G91C 2CWEA 4H9QA 5B31A 1ID3D 2FJ7C 5B40D 3AZFD 4WZSB 5BT1C 3X1VD 2IO5C 1KX5C 3AV2B 3LELC 5B1MC 5AV5C 1P3FD 3AL0C 1WWSA 1M18D 4Z66A 5B2IB 4NE6A 2HUEB 2Y2QA 4R8PA 1JFIA 4J8XC 3REHD 3AYWB 5AV6B 3NQUA 1P3KA 5B40B 3AZFB 5F99A 3KUYB 4XUJD 5B1LC 4J8VC 3UTAA 4UUZA 3UT9C 1M18B 3W97A 3RELC 3FDDA 2JE5A 1F66C 5B0YD 2VQRA 3REHB 1U35A 3AZID 3AZGD 1P3MC 4H9OB 2ZY2A 3H0MC 4WU8D 5B32C 4XUJB 3X1SD 4JJNA 2HIOC 4KHAA 5CPJD 3REKD 1BH9A 1EQZD 4J8WC 5B2JC 2ZM5A 1TZYC 3KWQD 4HGAB 1P3PD 5C3IC 3MGSD 3AV1A 1AOIC 4H9SA 3KXBD 3AZKD 1S32A 2NZDC 3AZIB 1P3GC 3AZGB 5AV9D 3REIA 1M19C 4WU8B 2FJ7B 3B6GA 3X1SB 5CPJB 4KGCA 5GT0D 2IO5B 5GT3A 3VH5W 4E44A 4J8VD 1KX5B 4KUDC 4YS3D 5B1MB 4QLCA 3W98A 3AZEA 3KWQB 1P3PB 1KX3A 3MGSB 2Y2HA 5CPIA 1R4VA 2DQNC 3KXBB 3H0RC 3WTPD 3WAAD 1B6WA 3AN2A 4NE5A 3MGPA 5AV9B 5B33C 3C1CC 3MNNC 3WA9A 4YM6C 5GT0B 1WWIA 4J8UA 5CP6A 3LZ0C 3LZ1D 4J8VB 5E5AC 5BNVA 3LJAD 5B0ZC 3B6FD 5CPKA 4XZQC 3WAAB 3WTPB 5AVCC 5DNMD 3O62C 2CV5A 3B0CW 1KX4A 3MGQA 3WKJC 1P3IC 1P3MB 3IP4C 1P3BC 5G49B 1P3OC 1HQ3A 3LZ1B 5KDMA 5B31C 4J8WB 2YFWA 4X23D 4UPKA 4DRAA 4WU9D 3AFAA 1P3AD 3B6FB 2AROD 5DNMB 2YFVB 2F8ND 3AZJA 2BYKB 4Z66C 4CSRB 4Z2MH 4R8PC 1ZLAD 5BO0A 3KFUG 3A6ND 4KUDB 4WU9B 1P3KC 1P3AB 5AV8A 5AY8A 5BNXB 2AROB 2FFFB 3AZLA 5JRGD 1M1AD 3UTAC 3TU4A 3W97C 3C1CB 3AZMA 3MNNB 2Y2GA 4YM6B 1P3OD 2BG1A 1ZLAB 1U35C 3A6NB 5E5AB 5B0ZB 2F8NK 4JJNC 3UTBD 4XZQB 3X1UA 5GXQA 3R45A 4Z5TC 5JRGB 1M1AB 5AVCB 3VH5T 2NQBA 2RVQC 3C1BD 5AVBA 5DNNA 1W2EA 4H9SC 1P34A 1P3OB 1S32C 5B31B 3REIC 5B2ID 3A1IA 5FUGB 4KGCC 3UTBB 3AYWD 5GT3C 5AV6D 3KUYD 4QLCC 3AZND 4WNNA 3W98C 3C1BB 1KX3C 2L5AA 2LY8A 4Z66B 3MGRA 1P3LA 2G5IC 3B0CT 3MVDA 3MGPC 3WA9C 4J8UC 3REJA 5CP6C 1A7WA 4Z5TD 1Z2CB 3AZNB 4LD9A 3NQJB 5CPKC 5JA4A 3V9RB 5GSUD 2CV5C 1KX4C 3MGQC 1N1JB 3X1TA 1U35B 2F8NG 3VH6W 4Z2MG 5B24D 1HQ3C 1BH9B 3AV2A 3AZHC 4Z5TB 2FJ7D 5BT1D 3AFAC 1KX5D 3LELD 5GSUB 5B1MD 5AV5D 1TAFB 1S32B 1ID3A 3REIB 5B40A 3AZFA 5B24B 3X1VA 4G91B 3W96C 4KGCB 4J8XD 5GT3B 2JSSA 1BFMA 1P3FA 4QLCB 4CAYB 5AV8C 5AY8C 1M18A 4ZUXC 5B1LD 1F1EA 3LELB 4EO5C 3AZLC 5CHLB 1B67A 5AV5B 3UT9D 3REHA 2RIQA 3RELD 3TU4C 1F66D 3AZMC 4XUJA 4J8XB 2Y2MA 5CP6B 1P3MD 3AZHD 5B32D 3VH5A 2HIOD 5B1LB 3X1UC 4J8WD 5GXQC 5B2JD 5B0YA 3UT9B 4G92C 2NQBC 3AZIA 1TZYD 3AZGA 3RELB 5AVBC 4WU8A 1F66B 5DNNC 2BYMA 3X1SA 1AOID 4NFTA 3REKA 5CPJA 1P34C 2NZDD 3W96D 1P3GD 3B0DC 1EQZA 2PYOC 1M19D 3W99C 3AZHB 5B32B 2HIOB 3AFAB 3KWQA 1P3PA 3MGSA 4ZUXD 4KUDD 5B2JB 3KXBA 3AZKA 1TZYB 5BS7A 5AV9A 3EPKA 5C3IB 4WJ3C 1AOIB 5GT0A 2NZDB 3W96B 1P3GB 1HTAA 3MGRC 1P3LC 4J8VA 3MVDC 3A1KA 1M19B 5B33D 3C1CD 4YS3A 3MNND 4YM6D 3VH6T 4ZUXB 3LZ0D 3REJC 5E5AD 3WAAA 3WTPA 4H9PB 4EO5B 3AZLB 5F99C 5B0ZD 4XZQD 1BH8B 3TU4B 5AVCD 3O62D 5G49A 3LZ1A 3WKJD 2PYOD 3X1TC 3LJAA 5B33B 4H9RB 1P3ID 3W99D 1P3BD 3B6FA 2W8SA 3LZ0B 5B31D 5DNMA 3AV2C 2YFVA 2F2AC 2BYKA 3O62B 5DNNB 4CSRA 4DRBA 2HUEC 1P34B 3WKJB 2J8PA 1P3IB 2PYOB 1ID3C 4H9NB 3EG5B 4X23A 3AV1C 4WU9A 3W99B 4Z66D 5B40C 3AZFC 1P3AA 1P3BB 5BNXA 3X1VC 4R8PD 4H9QB 2AROA 3B6GC 1P3FC 1P3KD 2F8NA 5F99D 2DF4C 3UTAD 2XD5A 3AZEC 1ZLAA 3REHC 3MGRB 3A6NA 3W97D 5CPIC 1KU5A 4XUJC 3AN2C 4R8PB 1JFIB 1U35D 3REJB 3NQUB 5JRGA 2G5HC 1M1AA 3EPHA 1P3KB 5F99B 4JJND 2Y2IA 5JA4B 5B0YC 3UTAB 4UUZB 1P3OA 2RVQD 3AZIC 3AZGC 3W97B 1H3OA 3X1TB
chains in the Genus database with same CATH topology
3AV1D 4WU8C 3X1SC 5FUGA 4AWLC 3REKC 2XD1A 3P5JB 3WTPE 3UTBA 5CPJC 1S32D 1EQZC 3REID 3B6GD 4JJNB 4KHAB 3C1BA 3KWQC 1P3PC 4KGCD 5GT3D 3MGSC 3KXBC 3AZKC 4QLCD 3W98D 3AZED 5BS7C 1KX3D 5AV9C 5B2IA 1ID3B 5CPID 3AV1B 3X1VB 5GT0C 3AN2D 3B0BA 3AYWA 3AZJC 5AV6A 3VH6A 3MGPD 3EPJA 3KUYA 2ZY5A 4YS3C 1P3FB 3B6GB 3AZNA 3NQJA 3WA9D 4J8UD 5CP6D 3V9RA 3WAAC 3WTPC 5B31G 3W98B 3AZEB 1N1JA 5CPKD 1KX3B 5CPIB 2CV5D 1KX4D 3AN2B 3MGQD 3LZ1C 3MGPB 4H9OA 3LJAC 4Z5TA 2Y2PA 3B6FC 3WA9B 2Y2LA 4J8UB 1HQ3D 5BNVB 2Y2JA 5DNMC 5GSUA 5B0YB 3AFAD 1TAFA 5CPKB 5B24A 2CV5B 2BYMB 4DQYB 1KX4B 4AWLB 3REKB 2Y2KA 3MGQB 3AZJD 1EQZB 2FJ7A 4X23C 4WU9C 1P3AC 4CAYA 1HQ3B 1KX5A 2AROC 5KDMB 3LELA 2YFWB 5B1MA 5AV5A 3AZKB 5AV8D 5AY8D 2ZY3A 4ZBJC 3AZLD 4J8XA 1ZLAC 3AZJB 3A6NC 2UWXA 3TU4D 3AZMD 4YS3B 5B1LA 2ZY4A 5BO0B 5JRGC 3UT9A 1M1AC 4NE3A 5AV8B 5AY8B 2Y2OA 3RELA 3X1UD 5GXQD 1F66A 3KSYA 4WV4B 2NQBD 4LD9C 1P3MA 5AVBD 3LJAB 3AZHA 5B32A 5DNND 3AZMB 2HIOA 3EPLA 2JCHA 1P34D 3UTBC 4J8WA 5B2JA 1Q9CA 1TZYA 3C1BC 3X1UB 2F8NH 5GXQB 3R45B 1AOIA 4G92B 2NQBB 2NZDA 3W96A 1P3GA 5AVBB 1M19A 5B2IC 4X23B 1PZRA 3B0DB 3MGRD 4ZUXA 3AYWC 1P3LD 5AV6C 3MVDD 4KUDA 4H9PA 3KUYC 4M6BA 3AZNC 2F8NB 1BH8A 3REJD 4ZBJB 5B32G 4WNNB 1M18C 4LD9D 3H0LC 4H9RA 5B33A 3C1CA 3MNNA 1T3UA 4YM6A 2Y2NA 3LZ0A 1P3LB 5E5AA 3X1TD 3MVDB 1ULYA 5B0ZA 4XZQA 5AVCA 3O62A 4E45A 3AV2D 5GSUC 3F6TA 4LD9B 3WKJA 4HGAC 2PYOA 1P3IA 4H9NA 1H3OB 3W99A 1P3BA 5B24C 4G91C 2CWEA 4H9QA 5B31A 1ID3D 2FJ7C 5B40D 3AZFD 4WZSB 5BT1C 3X1VD 2IO5C 1KX5C 3AV2B 3LELC 5B1MC 5AV5C 1P3FD 3AL0C 1WWSA 1M18D 4Z66A 5B2IB 4NE6A 2HUEB 2Y2QA 4R8PA 1JFIA 4J8XC 3REHD 3AYWB 5AV6B 3NQUA 1P3KA 5B40B 3AZFB 5F99A 3KUYB 4XUJD 5B1LC 4J8VC 3UTAA 4UUZA 3UT9C 1M18B 3W97A 3RELC 3FDDA 2JE5A 1F66C 5B0YD 2VQRA 3REHB 1U35A 3AZID 3AZGD 1P3MC 4H9OB 2ZY2A 3H0MC 4WU8D 5B32C 4XUJB 3X1SD 4JJNA 2HIOC 4KHAA 5CPJD 3REKD 1BH9A 1EQZD 4J8WC 5B2JC 2ZM5A 1TZYC 3KWQD 4HGAB 1P3PD 5C3IC 3MGSD 3AV1A 1AOIC 4H9SA 3KXBD 3AZKD 1S32A 2NZDC 3AZIB 1P3GC 3AZGB 5AV9D 3REIA 1M19C 4WU8B 2FJ7B 3B6GA 3X1SB 5CPJB 4KGCA 5GT0D 2IO5B 5GT3A 3VH5W 4E44A 4J8VD 1KX5B 4KUDC 4YS3D 5B1MB 4QLCA 3W98A 3AZEA 3KWQB 1P3PB 1KX3A 3MGSB 2Y2HA 5CPIA 1R4VA 2DQNC 3KXBB 3H0RC 3WTPD 3WAAD 1B6WA 3AN2A 4NE5A 3MGPA 5AV9B 5B33C 3C1CC 3MNNC 3WA9A 4YM6C 5GT0B 1WWIA 4J8UA 5CP6A 3LZ0C 3LZ1D 4J8VB 5E5AC 5BNVA 3LJAD 5B0ZC 3B6FD 5CPKA 4XZQC 3WAAB 3WTPB 5AVCC 5DNMD 3O62C 2CV5A 3B0CW 1KX4A 3MGQA 3WKJC 1P3IC 1P3MB 3IP4C 1P3BC 5G49B 1P3OC 1HQ3A 3LZ1B 5KDMA 5B31C 4J8WB 2YFWA 4X23D 4UPKA 4DRAA 4WU9D 3AFAA 1P3AD 3B6FB 2AROD 5DNMB 2YFVB 2F8ND 3AZJA 2BYKB 4Z66C 4CSRB 4Z2MH 4R8PC 1ZLAD 5BO0A 3KFUG 3A6ND 4KUDB 4WU9B 1P3KC 1P3AB 5AV8A 5AY8A 5BNXB 2AROB 2FFFB 3AZLA 5JRGD 1M1AD 3UTAC 3TU4A 3W97C 3C1CB 3AZMA 3MNNB 2Y2GA 4YM6B 1P3OD 2BG1A 1ZLAB 1U35C 3A6NB 5E5AB 5B0ZB 2F8NK 4JJNC 3UTBD 4XZQB 3X1UA 5GXQA 3R45A 4Z5TC 5JRGB 1M1AB 5AVCB 3VH5T 2NQBA 2RVQC 3C1BD 5AVBA 5DNNA 1W2EA 4H9SC 1P34A 1P3OB 1S32C 5B31B 3REIC 5B2ID 3A1IA 5FUGB 4KGCC 3UTBB 3AYWD 5GT3C 5AV6D 3KUYD 4QLCC 3AZND 4WNNA 3W98C 3C1BB 1KX3C 2L5AA 2LY8A 4Z66B 3MGRA 1P3LA 2G5IC 3B0CT 3MVDA 3MGPC 3WA9C 4J8UC 3REJA 5CP6C 1A7WA 4Z5TD 1Z2CB 3AZNB 4LD9A 3NQJB 5CPKC 5JA4A 3V9RB 5GSUD 2CV5C 1KX4C 3MGQC 1N1JB 3X1TA 1U35B 2F8NG 3VH6W 4Z2MG 5B24D 1HQ3C 1BH9B 3AV2A 3AZHC 4Z5TB 2FJ7D 5BT1D 3AFAC 1KX5D 3LELD 5GSUB 5B1MD 5AV5D 1TAFB 1S32B 1ID3A 3REIB 5B40A 3AZFA 5B24B 3X1VA 4G91B 3W96C 4KGCB 4J8XD 5GT3B 2JSSA 1BFMA 1P3FA 4QLCB 4CAYB 5AV8C 5AY8C 1M18A 4ZUXC 5B1LD 1F1EA 3LELB 4EO5C 3AZLC 5CHLB 1B67A 5AV5B 3UT9D 3REHA 2RIQA 3RELD 3TU4C 1F66D 3AZMC 4XUJA 4J8XB 2Y2MA 5CP6B 1P3MD 3AZHD 5B32D 3VH5A 2HIOD 5B1LB 3X1UC 4J8WD 5GXQC 5B2JD 5B0YA 3UT9B 4G92C 2NQBC 3AZIA 1TZYD 3AZGA 3RELB 5AVBC 4WU8A 1F66B 5DNNC 2BYMA 3X1SA 1AOID 4NFTA 3REKA 5CPJA 1P34C 2NZDD 3W96D 1P3GD 3B0DC 1EQZA 2PYOC 1M19D 3W99C 3AZHB 5B32B 2HIOB 3AFAB 3KWQA 1P3PA 3MGSA 4ZUXD 4KUDD 5B2JB 3KXBA 3AZKA 1TZYB 5BS7A 5AV9A 3EPKA 5C3IB 4WJ3C 1AOIB 5GT0A 2NZDB 3W96B 1P3GB 1HTAA 3MGRC 1P3LC 4J8VA 3MVDC 3A1KA 1M19B 5B33D 3C1CD 4YS3A 3MNND 4YM6D 3VH6T 4ZUXB 3LZ0D 3REJC 5E5AD 3WAAA 3WTPA 4H9PB 4EO5B 3AZLB 5F99C 5B0ZD 4XZQD 1BH8B 3TU4B 5AVCD 3O62D 5G49A 3LZ1A 3WKJD 2PYOD 3X1TC 3LJAA 5B33B 4H9RB 1P3ID 3W99D 1P3BD 3B6FA 2W8SA 3LZ0B 5B31D 5DNMA 3AV2C 2YFVA 2F2AC 2BYKA 3O62B 5DNNB 4CSRA 4DRBA 2HUEC 1P34B 3WKJB 2J8PA 1P3IB 2PYOB 1ID3C 4H9NB 3EG5B 4X23A 3AV1C 4WU9A 3W99B 4Z66D 5B40C 3AZFC 1P3AA 1P3BB 5BNXA 3X1VC 4R8PD 4H9QB 2AROA 3B6GC 1P3FC 1P3KD 2F8NA 5F99D 2DF4C 3UTAD 2XD5A 3AZEC 1ZLAA 3REHC 3MGRB 3A6NA 3W97D 5CPIC 1KU5A 4XUJC 3AN2C 4R8PB 1JFIB 1U35D 3REJB 3NQUB 5JRGA 2G5HC 1M1AA 3EPHA 1P3KB 5F99B 4JJND 2Y2IA 5JA4B 5B0YC 3UTAB 4UUZB 1P3OA 2RVQD 3AZIC 3AZGC 3W97B 1H3OA 3X1TB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AV1 D;  4WU8 C;  3X1S C;  5FUG A;  4AWL C;  3REK C;  3UTB A;  5CPJ C;  3WTP E;  1S32 D;  1EQZ C;  3REI D;  3B6G D;  4JJN B;  4KHA B;  3C1B A;  3KWQ C;  1P3P C;  4KGC D;  5GT3 D;  3MGS C;  3KXB C;  3AZK C;  4QLC D;  3W98 D;  3AZE D;  5BS7 C;  1KX3 D;  5AV9 C;  5B2I A;  1ID3 B;  5CPI D;  3AV1 B;  3X1V B;  5GT0 C;  3AN2 D;  3B0B A;  3AYW A;  3AZJ C;  5AV6 A;  3VH6 A;  3MGP D;  3KUY A;  4YS3 C;  3B6G B;  1P3F B;  3AZN A;  3NQJ A;  3WA9 D;  4J8U D;  5CP6 D;  3V9R A;  3WAA C;  3WTP C;  5B31 G;  3W98 B;  3AZE B;  1N1J A;  5CPK D;  1KX3 B;  5CPI B;  2CV5 D;  1KX4 D;  3AN2 B;  3MGQ D;  3LZ1 C;  3MGP B;  4H9O A;  3LJA C;  4Z5T A;  3WA9 B;  3B6F C;  4J8U B;  1HQ3 D;  5BNV B;  5GSU A;  5DNM C;  5B0Y B;  3AFA D;  1TAF A;  5CPK B;  5B24 A;  2CV5 B;  2BYM B;  1KX4 B;  4AWL B;  3REK B;  3MGQ B;  3AZJ D;  1EQZ B;  2FJ7 A;  4X23 C;  4WU9 C;  1P3A C;  4CAY A;  1HQ3 B;  1KX5 A;  2ARO C;  5KDM B;  3LEL A;  2YFW B;  5B1M A;  5AV5 A;  3AZK B;  5AV8 D;  5AY8 D;  3AZL D;  4ZBJ C;  4J8X A;  1ZLA C;  3AZJ B;  3A6N C;  3TU4 D;  3AZM D;  4YS3 B;  5B1L A;  5BO0 B;  5JRG C;  3UT9 A;  1M1A C;  4NE3 A;  5AV8 B;  5AY8 B;  3REL A;  3X1U D;  5GXQ D;  1F66 A;  3KSY A;  4WV4 B;  2NQB D;  4LD9 C;  1P3M A;  5AVB D;  3LJA B;  3AZH A;  5B32 A;  5DNN D;  3AZM B;  2HIO A;  1P34 D;  3UTB C;  4J8W A;  5B2J A;  1Q9C A;  1TZY A;  3C1B C;  3X1U B;  2F8N H;  5GXQ B;  3R45 B;  1AOI A;  4G92 B;  2NQB B;  2NZD A;  3W96 A;  1P3G A;  5AVB B;  1M19 A;  5B2I C;  4X23 B;  3B0D B;  3MGR D;  4ZUX A;  3AYW C;  1P3L D;  5AV6 C;  3MVD D;  4KUD A;  4H9P A;  3KUY C;  4M6B A;  3AZN C;  2F8N B;  1BH8 A;  3REJ D;  4ZBJ B;  5B32 G;  4WNN B;  1M18 C;  4LD9 D;  5B33 A;  4H9R A;  3C1C A;  3MNN A;  4YM6 A;  3LZ0 A;  1P3L B;  5E5A A;  3X1T D;  3MVD B;  1ULY A;  5B0Z A;  4XZQ A;  5AVC A;  3O62 A;  4E45 A;  3AV2 D;  5GSU C;  4LD9 B;  3WKJ A;  4HGA C;  2PYO A;  1P3I A;  4H9N A;  1H3O B;  3W99 A;  1P3B A;  5B24 C;  4G91 C;  2CWE A;  4H9Q A;  5B31 A;  1ID3 D;  2FJ7 C;  5B40 D;  3AZF D;  4WZS B;  5BT1 C;  3X1V D;  2IO5 C;  1KX5 C;  3AV2 B;  3LEL C;  5B1M C;  5AV5 C;  1P3F D;  1WWS A;  1M18 D;  4Z66 A;  5B2I B;  4NE6 A;  2HUE B;  4R8P A;  1JFI A;  4J8X C;  3REH D;  3AYW B;  5AV6 B;  3NQU A;  1P3K A;  5B40 B;  3AZF B;  5F99 A;  3KUY B;  4XUJ D;  5B1L C;  4J8V C;  3UTA A;  4UUZ A;  3UT9 C;  1M18 B;  3W97 A;  3REL C;  1F66 C;  5B0Y D;  3REH B;  1U35 A;  3AZI D;  3AZG D;  1P3M C;  4H9O B;  4WU8 D;  5B32 C;  4XUJ B;  3X1S D;  4JJN A;  2HIO C;  4KHA A;  5CPJ D;  3REK D;  1BH9 A;  1EQZ D;  4J8W C;  5B2J C;  1TZY C;  3KWQ D;  4HGA B;  1P3P D;  5C3I C;  3MGS D;  3AV1 A;  1AOI C;  4H9S A;  3KXB D;  3AZK D;  1S32 A;  2NZD C;  3AZI B;  1P3G C;  3AZG B;  5AV9 D;  3REI A;  1M19 C;  4WU8 B;  2FJ7 B;  3B6G A;  3X1S B;  5CPJ B;  4KGC A;  5GT0 D;  2IO5 B;  5GT3 A;  3VH5 W;  4E44 A;  4J8V D;  1KX5 B;  4KUD C;  4YS3 D;  5B1M B;  4QLC A;  3W98 A;  3AZE A;  3KWQ B;  1P3P B;  1KX3 A;  3MGS B;  5CPI A;  1R4V A;  3WAA D;  3KXB B;  3WTP D;  1B6W A;  3AN2 A;  4NE5 A;  3MGP A;  5AV9 B;  5B33 C;  3C1C C;  3MNN C;  3WA9 A;  4YM6 C;  5GT0 B;  1WWI A;  4J8U A;  5CP6 A;  3LZ0 C;  3LZ1 D;  4J8V B;  5E5A C;  5BNV A;  3LJA D;  5B0Z C;  3B6F D;  5CPK A;  4XZQ C;  3WAA B;  3WTP B;  5AVC C;  5DNM D;  3O62 C;  2CV5 A;  3B0C W;  1KX4 A;  3MGQ A;  3WKJ C;  1P3I C;  1P3M B;  1P3B C;  5G49 B;  1P3O C;  1HQ3 A;  3LZ1 B;  5KDM A;  5B31 C;  4J8W B;  2YFW A;  4X23 D;  4WU9 D;  4DRA A;  3AFA A;  1P3A D;  3B6F B;  2ARO D;  5DNM B;  2YFV B;  2F8N D;  3AZJ A;  2BYK B;  4Z66 C;  4CSR B;  4Z2M H;  4R8P C;  1ZLA D;  5BO0 A;  3A6N D;  4KUD B;  4WU9 B;  1P3K C;  1P3A B;  5AV8 A;  5AY8 A;  5BNX B;  2ARO B;  3AZL A;  5JRG D;  1M1A D;  3UTA C;  3TU4 A;  3W97 C;  3C1C B;  3AZM A;  3MNN B;  4YM6 B;  1P3O D;  1ZLA B;  1U35 C;  3A6N B;  5E5A B;  5B0Z B;  2F8N K;  4JJN C;  3UTB D;  4XZQ B;  3X1U A;  5GXQ A;  3R45 A;  4Z5T C;  5JRG B;  1M1A B;  5AVC B;  3VH5 T;  2NQB A;  2RVQ C;  3C1B D;  5AVB A;  5DNN A;  4H9S C;  1P34 A;  1P3O B;  1S32 C;  5B31 B;  3REI C;  5B2I D;  5FUG B;  4KGC C;  3UTB B;  3AYW D;  5GT3 C;  5AV6 D;  3KUY D;  4QLC C;  3AZN D;  4WNN A;  3W98 C;  3C1B B;  1KX3 C;  2L5A A;  2LY8 A;  4Z66 B;  3MGR A;  1P3L A;  3B0C T;  3MVD A;  3MGP C;  3WA9 C;  4J8U C;  3REJ A;  5CP6 C;  1A7W A;  4Z5T D;  3AZN B;  4LD9 A;  3NQJ B;  5CPK C;  5JA4 A;  3V9R B;  5GSU D;  2CV5 C;  1KX4 C;  3MGQ C;  1N1J B;  3X1T A;  1U35 B;  2F8N G;  3VH6 W;  4Z2M G;  5B24 D;  1HQ3 C;  1BH9 B;  3AV2 A;  3AZH C;  4Z5T B;  2FJ7 D;  5BT1 D;  3AFA C;  1KX5 D;  3LEL D;  5GSU B;  5B1M D;  5AV5 D;  1TAF B;  1S32 B;  1ID3 A;  3REI B;  5B40 A;  3AZF A;  5B24 B;  3X1V A;  4G91 B;  3W96 C;  4KGC B;  4J8X D;  5GT3 B;  2JSS A;  1BFM A;  1P3F A;  4QLC B;  4CAY B;  5AV8 C;  5AY8 C;  1M18 A;  4ZUX C;  5B1L D;  1F1E A;  3LEL B;  4EO5 C;  3AZL C;  5CHL B;  1B67 A;  5AV5 B;  3UT9 D;  3REH A;  3REL D;  3TU4 C;  1F66 D;  3AZM C;  4XUJ A;  4J8X B;  5CP6 B;  1P3M D;  3AZH D;  5B32 D;  3VH5 A;  2HIO D;  5B1L B;  3X1U C;  4J8W D;  5GXQ C;  5B2J D;  5B0Y A;  3UT9 B;  4G92 C;  2NQB C;  3AZI A;  1TZY D;  3AZG A;  3REL B;  5AVB C;  4WU8 A;  1F66 B;  5DNN C;  2BYM A;  3X1S A;  1AOI D;  4NFT A;  3REK A;  5CPJ A;  1P34 C;  2NZD D;  3W96 D;  1P3G D;  3B0D C;  1EQZ A;  2PYO C;  1M19 D;  3W99 C;  3AZH B;  5B32 B;  2HIO B;  3AFA B;  3KWQ A;  1P3P A;  3MGS A;  4ZUX D;  4KUD D;  5B2J B;  3KXB A;  3AZK A;  1TZY B;  5BS7 A;  5AV9 A;  5C3I B;  1AOI B;  5GT0 A;  2NZD B;  3W96 B;  1P3G B;  1HTA A;  3MGR C;  1P3L C;  4J8V A;  3MVD C;  1M19 B;  5B33 D;  3C1C D;  4YS3 A;  3MNN D;  4YM6 D;  3VH6 T;  4ZUX B;  3LZ0 D;  3REJ C;  5E5A D;  3WAA A;  3WTP A;  4H9P B;  4EO5 B;  3AZL B;  5F99 C;  5B0Z D;  4XZQ D;  1BH8 B;  3TU4 B;  5AVC D;  3O62 D;  5G49 A;  3LZ1 A;  3WKJ D;  2PYO D;  3X1T C;  3LJA A;  5B33 B;  4H9R B;  1P3I D;  3W99 D;  1P3B D;  3B6F A;  3LZ0 B;  5B31 D;  5DNM A;  3AV2 C;  2YFV A;  2BYK A;  3O62 B;  5DNN B;  4CSR A;  4DRB A;  2HUE C;  1P34 B;  3WKJ B;  2PYO B;  1P3I B;  1ID3 C;  4H9N B;  4X23 A;  3AV1 C;  4WU9 A;  3W99 B;  4Z66 D;  5B40 C;  3AZF C;  1P3A A;  1P3B B;  5BNX A;  3X1V C;  4R8P D;  4H9Q B;  2ARO A;  3B6G C;  1P3F C;  1P3K D;  2F8N A;  5F99 D;  3UTA D;  3AZE C;  1ZLA A;  3REH C;  3MGR B;  3A6N A;  3W97 D;  5CPI C;  1KU5 A;  4XUJ C;  3AN2 C;  4R8P B;  1JFI B;  1U35 D;  3REJ B;  3NQU B;  5JRG A;  1M1A A;  1P3K B;  5F99 B;  4JJN D;  5JA4 B;  5B0Y C;  3UTA B;  4UUZ B;  1P3O A;  2RVQ D;  3AZI C;  3AZG C;  3W97 B;  1H3O A;  3X1T B; 
#chains in the Genus database with same CATH topology
 3AV1 D;  4WU8 C;  3X1S C;  5FUG A;  4AWL C;  3REK C;  2XD1 A;  3P5J B;  3WTP E;  3UTB A;  5CPJ C;  1S32 D;  1EQZ C;  3REI D;  3B6G D;  4JJN B;  4KHA B;  3C1B A;  3KWQ C;  1P3P C;  4KGC D;  5GT3 D;  3MGS C;  3KXB C;  3AZK C;  4QLC D;  3W98 D;  3AZE D;  5BS7 C;  1KX3 D;  5AV9 C;  5B2I A;  1ID3 B;  5CPI D;  3AV1 B;  3X1V B;  5GT0 C;  3AN2 D;  3B0B A;  3AYW A;  3AZJ C;  5AV6 A;  3VH6 A;  3MGP D;  3EPJ A;  3KUY A;  2ZY5 A;  4YS3 C;  1P3F B;  3B6G B;  3AZN A;  3NQJ A;  3WA9 D;  4J8U D;  5CP6 D;  3V9R A;  3WAA C;  3WTP C;  5B31 G;  3W98 B;  3AZE B;  1N1J A;  5CPK D;  1KX3 B;  5CPI B;  2CV5 D;  1KX4 D;  3AN2 B;  3MGQ D;  3LZ1 C;  3MGP B;  4H9O A;  3LJA C;  4Z5T A;  2Y2P A;  3B6F C;  3WA9 B;  2Y2L A;  4J8U B;  1HQ3 D;  5BNV B;  2Y2J A;  5DNM C;  5GSU A;  5B0Y B;  3AFA D;  1TAF A;  5CPK B;  5B24 A;  2CV5 B;  2BYM B;  4DQY B;  1KX4 B;  4AWL B;  3REK B;  2Y2K A;  3MGQ B;  3AZJ D;  1EQZ B;  2FJ7 A;  4X23 C;  4WU9 C;  1P3A C;  4CAY A;  1HQ3 B;  1KX5 A;  2ARO C;  5KDM B;  3LEL A;  2YFW B;  5B1M A;  5AV5 A;  3AZK B;  5AV8 D;  5AY8 D;  2ZY3 A;  4ZBJ C;  3AZL D;  4J8X A;  1ZLA C;  3AZJ B;  3A6N C;  2UWX A;  3TU4 D;  3AZM D;  4YS3 B;  5B1L A;  2ZY4 A;  5BO0 B;  5JRG C;  3UT9 A;  1M1A C;  4NE3 A;  5AV8 B;  5AY8 B;  2Y2O A;  3REL A;  3X1U D;  5GXQ D;  1F66 A;  3KSY A;  4WV4 B;  2NQB D;  4LD9 C;  1P3M A;  5AVB D;  3LJA B;  3AZH A;  5B32 A;  5DNN D;  3AZM B;  2HIO A;  3EPL A;  2JCH A;  1P34 D;  3UTB C;  4J8W A;  5B2J A;  1Q9C A;  1TZY A;  3C1B C;  3X1U B;  2F8N H;  5GXQ B;  3R45 B;  1AOI A;  4G92 B;  2NQB B;  2NZD A;  3W96 A;  1P3G A;  5AVB B;  1M19 A;  5B2I C;  4X23 B;  1PZR A;  3B0D B;  3MGR D;  4ZUX A;  3AYW C;  1P3L D;  5AV6 C;  3MVD D;  4KUD A;  4H9P A;  3KUY C;  4M6B A;  3AZN C;  2F8N B;  1BH8 A;  3REJ D;  4ZBJ B;  5B32 G;  4WNN B;  1M18 C;  4LD9 D;  3H0L C;  4H9R A;  5B33 A;  3C1C A;  3MNN A;  1T3U A;  4YM6 A;  2Y2N A;  3LZ0 A;  1P3L B;  5E5A A;  3X1T D;  3MVD B;  1ULY A;  5B0Z A;  4XZQ A;  5AVC A;  3O62 A;  4E45 A;  3AV2 D;  5GSU C;  3F6T A;  4LD9 B;  3WKJ A;  4HGA C;  2PYO A;  1P3I A;  4H9N A;  1H3O B;  3W99 A;  1P3B A;  5B24 C;  4G91 C;  2CWE A;  4H9Q A;  5B31 A;  1ID3 D;  2FJ7 C;  5B40 D;  3AZF D;  4WZS B;  5BT1 C;  3X1V D;  2IO5 C;  1KX5 C;  3AV2 B;  3LEL C;  5B1M C;  5AV5 C;  1P3F D;  3AL0 C;  1WWS A;  1M18 D;  4Z66 A;  5B2I B;  4NE6 A;  2HUE B;  2Y2Q A;  4R8P A;  1JFI A;  4J8X C;  3REH D;  3AYW B;  5AV6 B;  3NQU A;  1P3K A;  5B40 B;  3AZF B;  5F99 A;  3KUY B;  4XUJ D;  5B1L C;  4J8V C;  3UTA A;  4UUZ A;  3UT9 C;  1M18 B;  3W97 A;  3REL C;  3FDD A;  2JE5 A;  1F66 C;  5B0Y D;  2VQR A;  3REH B;  1U35 A;  3AZI D;  3AZG D;  1P3M C;  4H9O B;  2ZY2 A;  3H0M C;  4WU8 D;  5B32 C;  4XUJ B;  3X1S D;  4JJN A;  2HIO C;  4KHA A;  5CPJ D;  3REK D;  1BH9 A;  1EQZ D;  4J8W C;  5B2J C;  2ZM5 A;  1TZY C;  3KWQ D;  4HGA B;  1P3P D;  5C3I C;  3MGS D;  3AV1 A;  1AOI C;  4H9S A;  3KXB D;  3AZK D;  1S32 A;  2NZD C;  3AZI B;  1P3G C;  3AZG B;  5AV9 D;  3REI A;  1M19 C;  4WU8 B;  2FJ7 B;  3B6G A;  3X1S B;  5CPJ B;  4KGC A;  5GT0 D;  2IO5 B;  5GT3 A;  3VH5 W;  4E44 A;  4J8V D;  1KX5 B;  4KUD C;  4YS3 D;  5B1M B;  4QLC A;  3W98 A;  3AZE A;  3KWQ B;  1P3P B;  1KX3 A;  3MGS B;  2Y2H A;  5CPI A;  1R4V A;  2DQN C;  3KXB B;  3H0R C;  3WTP D;  3WAA D;  1B6W A;  3AN2 A;  4NE5 A;  3MGP A;  5AV9 B;  5B33 C;  3C1C C;  3MNN C;  3WA9 A;  4YM6 C;  5GT0 B;  1WWI A;  4J8U A;  5CP6 A;  3LZ0 C;  3LZ1 D;  4J8V B;  5E5A C;  5BNV A;  3LJA D;  5B0Z C;  3B6F D;  5CPK A;  4XZQ C;  3WAA B;  3WTP B;  5AVC C;  5DNM D;  3O62 C;  2CV5 A;  3B0C W;  1KX4 A;  3MGQ A;  3WKJ C;  1P3I C;  1P3M B;  3IP4 C;  1P3B C;  5G49 B;  1P3O C;  1HQ3 A;  3LZ1 B;  5KDM A;  5B31 C;  4J8W B;  2YFW A;  4X23 D;  4UPK A;  4DRA A;  4WU9 D;  3AFA A;  1P3A D;  3B6F B;  2ARO D;  5DNM B;  2YFV B;  2F8N D;  3AZJ A;  2BYK B;  4Z66 C;  4CSR B;  4Z2M H;  4R8P C;  1ZLA D;  5BO0 A;  3KFU G;  3A6N D;  4KUD B;  4WU9 B;  1P3K C;  1P3A B;  5AV8 A;  5AY8 A;  5BNX B;  2ARO B;  2FFF B;  3AZL A;  5JRG D;  1M1A D;  3UTA C;  3TU4 A;  3W97 C;  3C1C B;  3AZM A;  3MNN B;  2Y2G A;  4YM6 B;  1P3O D;  2BG1 A;  1ZLA B;  1U35 C;  3A6N B;  5E5A B;  5B0Z B;  2F8N K;  4JJN C;  3UTB D;  4XZQ B;  3X1U A;  5GXQ A;  3R45 A;  4Z5T C;  5JRG B;  1M1A B;  5AVC B;  3VH5 T;  2NQB A;  2RVQ C;  3C1B D;  5AVB A;  5DNN A;  1W2E A;  4H9S C;  1P34 A;  1P3O B;  1S32 C;  5B31 B;  3REI C;  5B2I D;  3A1I A;  5FUG B;  4KGC C;  3UTB B;  3AYW D;  5GT3 C;  5AV6 D;  3KUY D;  4QLC C;  3AZN D;  4WNN A;  3W98 C;  3C1B B;  1KX3 C;  2L5A A;  2LY8 A;  4Z66 B;  3MGR A;  1P3L A;  2G5I C;  3B0C T;  3MVD A;  3MGP C;  3WA9 C;  4J8U C;  3REJ A;  5CP6 C;  1A7W A;  4Z5T D;  1Z2C B;  3AZN B;  4LD9 A;  3NQJ B;  5CPK C;  5JA4 A;  3V9R B;  5GSU D;  2CV5 C;  1KX4 C;  3MGQ C;  1N1J B;  3X1T A;  1U35 B;  2F8N G;  3VH6 W;  4Z2M G;  5B24 D;  1HQ3 C;  1BH9 B;  3AV2 A;  3AZH C;  4Z5T B;  2FJ7 D;  5BT1 D;  3AFA C;  1KX5 D;  3LEL D;  5GSU B;  5B1M D;  5AV5 D;  1TAF B;  1S32 B;  1ID3 A;  3REI B;  5B40 A;  3AZF A;  5B24 B;  3X1V A;  4G91 B;  3W96 C;  4KGC B;  4J8X D;  5GT3 B;  2JSS A;  1BFM A;  1P3F A;  4QLC B;  4CAY B;  5AV8 C;  5AY8 C;  1M18 A;  4ZUX C;  5B1L D;  1F1E A;  3LEL B;  4EO5 C;  3AZL C;  5CHL B;  1B67 A;  5AV5 B;  3UT9 D;  3REH A;  2RIQ A;  3REL D;  3TU4 C;  1F66 D;  3AZM C;  4XUJ A;  4J8X B;  2Y2M A;  5CP6 B;  1P3M D;  3AZH D;  5B32 D;  3VH5 A;  2HIO D;  5B1L B;  3X1U C;  4J8W D;  5GXQ C;  5B2J D;  5B0Y A;  3UT9 B;  4G92 C;  2NQB C;  3AZI A;  1TZY D;  3AZG A;  3REL B;  5AVB C;  4WU8 A;  1F66 B;  5DNN C;  2BYM A;  3X1S A;  1AOI D;  4NFT A;  3REK A;  5CPJ A;  1P34 C;  2NZD D;  3W96 D;  1P3G D;  3B0D C;  1EQZ A;  2PYO C;  1M19 D;  3W99 C;  3AZH B;  5B32 B;  2HIO B;  3AFA B;  3KWQ A;  1P3P A;  3MGS A;  4ZUX D;  4KUD D;  5B2J B;  3KXB A;  3AZK A;  1TZY B;  5BS7 A;  5AV9 A;  3EPK A;  5C3I B;  4WJ3 C;  1AOI B;  5GT0 A;  2NZD B;  3W96 B;  1P3G B;  1HTA A;  3MGR C;  1P3L C;  4J8V A;  3MVD C;  3A1K A;  1M19 B;  5B33 D;  3C1C D;  4YS3 A;  3MNN D;  4YM6 D;  3VH6 T;  4ZUX B;  3LZ0 D;  3REJ C;  5E5A D;  3WAA A;  3WTP A;  4H9P B;  4EO5 B;  3AZL B;  5F99 C;  5B0Z D;  4XZQ D;  1BH8 B;  3TU4 B;  5AVC D;  3O62 D;  5G49 A;  3LZ1 A;  3WKJ D;  2PYO D;  3X1T C;  3LJA A;  5B33 B;  4H9R B;  1P3I D;  3W99 D;  1P3B D;  3B6F A;  2W8S A;  3LZ0 B;  5B31 D;  5DNM A;  3AV2 C;  2YFV A;  2F2A C;  2BYK A;  3O62 B;  5DNN B;  4CSR A;  4DRB A;  2HUE C;  1P34 B;  3WKJ B;  2J8P A;  1P3I B;  2PYO B;  1ID3 C;  4H9N B;  3EG5 B;  4X23 A;  3AV1 C;  4WU9 A;  3W99 B;  4Z66 D;  5B40 C;  3AZF C;  1P3A A;  1P3B B;  5BNX A;  3X1V C;  4R8P D;  4H9Q B;  2ARO A;  3B6G C;  1P3F C;  1P3K D;  2F8N A;  5F99 D;  2DF4 C;  3UTA D;  2XD5 A;  3AZE C;  1ZLA A;  3REH C;  3MGR B;  3A6N A;  3W97 D;  5CPI C;  1KU5 A;  4XUJ C;  3AN2 C;  4R8P B;  1JFI B;  1U35 D;  3REJ B;  3NQU B;  5JRG A;  2G5H C;  1M1A A;  3EPH A;  1P3K B;  5F99 B;  4JJN D;  2Y2I A;  5JA4 B;  5B0Y C;  3UTA B;  4UUZ B;  1P3O A;  2RVQ D;  3AZI C;  3AZG C;  3W97 B;  1H3O A;  3X1T B; 
#chains in the Genus database with same CATH homology
 3AV1 D;  4WU8 C;  3X1S C;  5FUG A;  4AWL C;  3REK C;  2XD1 A;  3P5J B;  3WTP E;  3UTB A;  5CPJ C;  1S32 D;  1EQZ C;  3REI D;  3B6G D;  4JJN B;  4KHA B;  3C1B A;  3KWQ C;  1P3P C;  4KGC D;  5GT3 D;  3MGS C;  3KXB C;  3AZK C;  4QLC D;  3W98 D;  3AZE D;  5BS7 C;  1KX3 D;  5AV9 C;  5B2I A;  1ID3 B;  5CPI D;  3AV1 B;  3X1V B;  5GT0 C;  3AN2 D;  3B0B A;  3AYW A;  3AZJ C;  5AV6 A;  3VH6 A;  3MGP D;  3EPJ A;  3KUY A;  2ZY5 A;  4YS3 C;  1P3F B;  3B6G B;  3AZN A;  3NQJ A;  3WA9 D;  4J8U D;  5CP6 D;  3V9R A;  3WAA C;  3WTP C;  5B31 G;  3W98 B;  3AZE B;  1N1J A;  5CPK D;  1KX3 B;  5CPI B;  2CV5 D;  1KX4 D;  3AN2 B;  3MGQ D;  3LZ1 C;  3MGP B;  4H9O A;  3LJA C;  4Z5T A;  2Y2P A;  3B6F C;  3WA9 B;  2Y2L A;  4J8U B;  1HQ3 D;  5BNV B;  2Y2J A;  5DNM C;  5GSU A;  5B0Y B;  3AFA D;  1TAF A;  5CPK B;  5B24 A;  2CV5 B;  2BYM B;  4DQY B;  1KX4 B;  4AWL B;  3REK B;  2Y2K A;  3MGQ B;  3AZJ D;  1EQZ B;  2FJ7 A;  4X23 C;  4WU9 C;  1P3A C;  4CAY A;  1HQ3 B;  1KX5 A;  2ARO C;  5KDM B;  3LEL A;  2YFW B;  5B1M A;  5AV5 A;  3AZK B;  5AV8 D;  5AY8 D;  2ZY3 A;  4ZBJ C;  3AZL D;  4J8X A;  1ZLA C;  3AZJ B;  3A6N C;  2UWX A;  3TU4 D;  3AZM D;  4YS3 B;  5B1L A;  2ZY4 A;  5BO0 B;  5JRG C;  3UT9 A;  1M1A C;  4NE3 A;  5AV8 B;  5AY8 B;  2Y2O A;  3REL A;  3X1U D;  5GXQ D;  1F66 A;  3KSY A;  4WV4 B;  2NQB D;  4LD9 C;  1P3M A;  5AVB D;  3LJA B;  3AZH A;  5B32 A;  5DNN D;  3AZM B;  2HIO A;  3EPL A;  2JCH A;  1P34 D;  3UTB C;  4J8W A;  5B2J A;  1Q9C A;  1TZY A;  3C1B C;  3X1U B;  2F8N H;  5GXQ B;  3R45 B;  1AOI A;  4G92 B;  2NQB B;  2NZD A;  3W96 A;  1P3G A;  5AVB B;  1M19 A;  5B2I C;  4X23 B;  1PZR A;  3B0D B;  3MGR D;  4ZUX A;  3AYW C;  1P3L D;  5AV6 C;  3MVD D;  4KUD A;  4H9P A;  3KUY C;  4M6B A;  3AZN C;  2F8N B;  1BH8 A;  3REJ D;  4ZBJ B;  5B32 G;  4WNN B;  1M18 C;  4LD9 D;  3H0L C;  4H9R A;  5B33 A;  3C1C A;  3MNN A;  1T3U A;  4YM6 A;  2Y2N A;  3LZ0 A;  1P3L B;  5E5A A;  3X1T D;  3MVD B;  1ULY A;  5B0Z A;  4XZQ A;  5AVC A;  3O62 A;  4E45 A;  3AV2 D;  5GSU C;  3F6T A;  4LD9 B;  3WKJ A;  4HGA C;  2PYO A;  1P3I A;  4H9N A;  1H3O B;  3W99 A;  1P3B A;  5B24 C;  4G91 C;  2CWE A;  4H9Q A;  5B31 A;  1ID3 D;  2FJ7 C;  5B40 D;  3AZF D;  4WZS B;  5BT1 C;  3X1V D;  2IO5 C;  1KX5 C;  3AV2 B;  3LEL C;  5B1M C;  5AV5 C;  1P3F D;  3AL0 C;  1WWS A;  1M18 D;  4Z66 A;  5B2I B;  4NE6 A;  2HUE B;  2Y2Q A;  4R8P A;  1JFI A;  4J8X C;  3REH D;  3AYW B;  5AV6 B;  3NQU A;  1P3K A;  5B40 B;  3AZF B;  5F99 A;  3KUY B;  4XUJ D;  5B1L C;  4J8V C;  3UTA A;  4UUZ A;  3UT9 C;  1M18 B;  3W97 A;  3REL C;  3FDD A;  2JE5 A;  1F66 C;  5B0Y D;  2VQR A;  3REH B;  1U35 A;  3AZI D;  3AZG D;  1P3M C;  4H9O B;  2ZY2 A;  3H0M C;  4WU8 D;  5B32 C;  4XUJ B;  3X1S D;  4JJN A;  2HIO C;  4KHA A;  5CPJ D;  3REK D;  1BH9 A;  1EQZ D;  4J8W C;  5B2J C;  2ZM5 A;  1TZY C;  3KWQ D;  4HGA B;  1P3P D;  5C3I C;  3MGS D;  3AV1 A;  1AOI C;  4H9S A;  3KXB D;  3AZK D;  1S32 A;  2NZD C;  3AZI B;  1P3G C;  3AZG B;  5AV9 D;  3REI A;  1M19 C;  4WU8 B;  2FJ7 B;  3B6G A;  3X1S B;  5CPJ B;  4KGC A;  5GT0 D;  2IO5 B;  5GT3 A;  3VH5 W;  4E44 A;  4J8V D;  1KX5 B;  4KUD C;  4YS3 D;  5B1M B;  4QLC A;  3W98 A;  3AZE A;  3KWQ B;  1P3P B;  1KX3 A;  3MGS B;  2Y2H A;  5CPI A;  1R4V A;  2DQN C;  3KXB B;  3H0R C;  3WTP D;  3WAA D;  1B6W A;  3AN2 A;  4NE5 A;  3MGP A;  5AV9 B;  5B33 C;  3C1C C;  3MNN C;  3WA9 A;  4YM6 C;  5GT0 B;  1WWI A;  4J8U A;  5CP6 A;  3LZ0 C;  3LZ1 D;  4J8V B;  5E5A C;  5BNV A;  3LJA D;  5B0Z C;  3B6F D;  5CPK A;  4XZQ C;  3WAA B;  3WTP B;  5AVC C;  5DNM D;  3O62 C;  2CV5 A;  3B0C W;  1KX4 A;  3MGQ A;  3WKJ C;  1P3I C;  1P3M B;  3IP4 C;  1P3B C;  5G49 B;  1P3O C;  1HQ3 A;  3LZ1 B;  5KDM A;  5B31 C;  4J8W B;  2YFW A;  4X23 D;  4UPK A;  4DRA A;  4WU9 D;  3AFA A;  1P3A D;  3B6F B;  2ARO D;  5DNM B;  2YFV B;  2F8N D;  3AZJ A;  2BYK B;  4Z66 C;  4CSR B;  4Z2M H;  4R8P C;  1ZLA D;  5BO0 A;  3KFU G;  3A6N D;  4KUD B;  4WU9 B;  1P3K C;  1P3A B;  5AV8 A;  5AY8 A;  5BNX B;  2ARO B;  2FFF B;  3AZL A;  5JRG D;  1M1A D;  3UTA C;  3TU4 A;  3W97 C;  3C1C B;  3AZM A;  3MNN B;  2Y2G A;  4YM6 B;  1P3O D;  2BG1 A;  1ZLA B;  1U35 C;  3A6N B;  5E5A B;  5B0Z B;  2F8N K;  4JJN C;  3UTB D;  4XZQ B;  3X1U A;  5GXQ A;  3R45 A;  4Z5T C;  5JRG B;  1M1A B;  5AVC B;  3VH5 T;  2NQB A;  2RVQ C;  3C1B D;  5AVB A;  5DNN A;  1W2E A;  4H9S C;  1P34 A;  1P3O B;  1S32 C;  5B31 B;  3REI C;  5B2I D;  3A1I A;  5FUG B;  4KGC C;  3UTB B;  3AYW D;  5GT3 C;  5AV6 D;  3KUY D;  4QLC C;  3AZN D;  4WNN A;  3W98 C;  3C1B B;  1KX3 C;  2L5A A;  2LY8 A;  4Z66 B;  3MGR A;  1P3L A;  2G5I C;  3B0C T;  3MVD A;  3MGP C;  3WA9 C;  4J8U C;  3REJ A;  5CP6 C;  1A7W A;  4Z5T D;  1Z2C B;  3AZN B;  4LD9 A;  3NQJ B;  5CPK C;  5JA4 A;  3V9R B;  5GSU D;  2CV5 C;  1KX4 C;  3MGQ C;  1N1J B;  3X1T A;  1U35 B;  2F8N G;  3VH6 W;  4Z2M G;  5B24 D;  1HQ3 C;  1BH9 B;  3AV2 A;  3AZH C;  4Z5T B;  2FJ7 D;  5BT1 D;  3AFA C;  1KX5 D;  3LEL D;  5GSU B;  5B1M D;  5AV5 D;  1TAF B;  1S32 B;  1ID3 A;  3REI B;  5B40 A;  3AZF A;  5B24 B;  3X1V A;  4G91 B;  3W96 C;  4KGC B;  4J8X D;  5GT3 B;  2JSS A;  1BFM A;  1P3F A;  4QLC B;  4CAY B;  5AV8 C;  5AY8 C;  1M18 A;  4ZUX C;  5B1L D;  1F1E A;  3LEL B;  4EO5 C;  3AZL C;  5CHL B;  1B67 A;  5AV5 B;  3UT9 D;  3REH A;  2RIQ A;  3REL D;  3TU4 C;  1F66 D;  3AZM C;  4XUJ A;  4J8X B;  2Y2M A;  5CP6 B;  1P3M D;  3AZH D;  5B32 D;  3VH5 A;  2HIO D;  5B1L B;  3X1U C;  4J8W D;  5GXQ C;  5B2J D;  5B0Y A;  3UT9 B;  4G92 C;  2NQB C;  3AZI A;  1TZY D;  3AZG A;  3REL B;  5AVB C;  4WU8 A;  1F66 B;  5DNN C;  2BYM A;  3X1S A;  1AOI D;  4NFT A;  3REK A;  5CPJ A;  1P34 C;  2NZD D;  3W96 D;  1P3G D;  3B0D C;  1EQZ A;  2PYO C;  1M19 D;  3W99 C;  3AZH B;  5B32 B;  2HIO B;  3AFA B;  3KWQ A;  1P3P A;  3MGS A;  4ZUX D;  4KUD D;  5B2J B;  3KXB A;  3AZK A;  1TZY B;  5BS7 A;  5AV9 A;  3EPK A;  5C3I B;  4WJ3 C;  1AOI B;  5GT0 A;  2NZD B;  3W96 B;  1P3G B;  1HTA A;  3MGR C;  1P3L C;  4J8V A;  3MVD C;  3A1K A;  1M19 B;  5B33 D;  3C1C D;  4YS3 A;  3MNN D;  4YM6 D;  3VH6 T;  4ZUX B;  3LZ0 D;  3REJ C;  5E5A D;  3WAA A;  3WTP A;  4H9P B;  4EO5 B;  3AZL B;  5F99 C;  5B0Z D;  4XZQ D;  1BH8 B;  3TU4 B;  5AVC D;  3O62 D;  5G49 A;  3LZ1 A;  3WKJ D;  2PYO D;  3X1T C;  3LJA A;  5B33 B;  4H9R B;  1P3I D;  3W99 D;  1P3B D;  3B6F A;  2W8S A;  3LZ0 B;  5B31 D;  5DNM A;  3AV2 C;  2YFV A;  2F2A C;  2BYK A;  3O62 B;  5DNN B;  4CSR A;  4DRB A;  2HUE C;  1P34 B;  3WKJ B;  2J8P A;  1P3I B;  2PYO B;  1ID3 C;  4H9N B;  3EG5 B;  4X23 A;  3AV1 C;  4WU9 A;  3W99 B;  4Z66 D;  5B40 C;  3AZF C;  1P3A A;  1P3B B;  5BNX A;  3X1V C;  4R8P D;  4H9Q B;  2ARO A;  3B6G C;  1P3F C;  1P3K D;  2F8N A;  5F99 D;  2DF4 C;  3UTA D;  2XD5 A;  3AZE C;  1ZLA A;  3REH C;  3MGR B;  3A6N A;  3W97 D;  5CPI C;  1KU5 A;  4XUJ C;  3AN2 C;  4R8P B;  1JFI B;  1U35 D;  3REJ B;  3NQU B;  5JRG A;  2G5H C;  1M1A A;  3EPH A;  1P3K B;  5F99 B;  4JJN D;  2Y2I A;  5JA4 B;  5B0Y C;  3UTA B;  4UUZ B;  1P3O A;  2RVQ D;  3AZI C;  3AZG C;  3W97 B;  1H3O A;  3X1T B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...