5E5AB

Crystal structure of the chromatin-tethering domain of human cytomegalovirus ie1 protein bound to the nucleosome core particle
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
79
structure length
79
Chain Sequence
DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (146-MER)
publication title Human cytomegalovirus IE1 protein alters the higher-order chromatin structure by targeting the acidic patch of the nucleosome
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/viral protein/dna
total genus 26
structure length 79
sequence length 79
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5e5aB00
3VH5W 5B1MA 3LZ1D 3AV1A 4J8XA 1P3PB 1ID3D 5CPIA 1P3FD 3UT9C 4QLCC 2BYMA 3W99B 5B31B 5B33C 5B1MD 3AV1D 3LELB 4J8XD 5B24A 5CPID 2NQBC 3UTAB 1S32C 1H3OA 3B0DB 3VH6A 4J8WC 3MGPC 3AZIC 5AV8B 5B24D 3KWQA 5JA4B 3MGSB 1P3GA 4UUZA 5AY8C 2HUEB 5C3IB 3REIB 4CAYA 4NE6A 1P3GD 2BYKB 5AV9A 4XUJA 3B6GB 3KUYA 5AV9D 1P3PC 1HQ3D 4XUJD 5B2JB 3KUYD 5B32A 3UTAC 2YFVB 1KX4A 1R4VA 3B0DC 2PYOA 3WKJA 4EO5B 3R45B 4NE3A 5B32D 5AV8C 4R8PB 1KX4D 5B40B 1P34A 2PYOD 2HUEC 2AROC 3WKJD 4XZQB 5C3IC 4Z66C 3LJAA 1U35D 1P3LC 1KX5B 1P34D 1BFMA 4WNNA 3LZ0C 3B0CW 3LJAD 3TU4B 5B33A 3B0BA 5CP6B 3MGQC 3WA9B 5B1LB 5B33D 4J8WA 5AVBB 3AZIA 3AZJB 1ZLAA 4Z5TB 5AVCB 3AN2B 1M19B 1BH8B 3KXBB 5B32G 2CWEA 4J8WD 4LD9A 3MGPD 3AZID 1ZLAD 4EO5C 5B2IC 3X1VB 4R8PC 4AWLC 3AZHB 3WTPA 1KX5C 4HGAB 4YS3B 3AZLB 3WTPD 1N1JB 5JRGB 3MNNA 1P3BB 5CP6C 3MNND 5AVBC 3AZJC 1M18C 4Z5TC 5GT0C 4JJNB 1M19C 3KXBC 2FJ7B 3W98C 2AROA 4Z66A 1P3LA 1JFIA 2AROD 4Z66D 1P3LD 1KX3C 3AZEB 3C1CB 5F99B 4CSRB 3LZ0D 3MGQA 1P3BC 3KWQB 3AZNA 3MGQD 3W96A 3AFAA 3AZGB 5B2IA 5B0ZB 3AZND 1TZYA 1P3OA 4WU8B 4X23A 3NQJA 5B2ID 3A6NB 1P3OD 3MVDA 3REJA 2HIOC 4X23D 4YM6A 4NFTA 4Z2MH 3AZEC 3C1CC 3B6FB 5F99C 3MVDD 3REJD 1B67A 4YM6D 3REKA 2F8NK 4ZUXB 4J8VB 3VH6W 2CV5C 1M18A 5DNMC 5GT0A 3W98A 2L5AA 3MGRB 3UTBA 3AZKA 3AZGC 1M18D 1ID3A 5GT0D 2F8NB 5AV5C 3W98D 4WU8C 3W97C 3UTBD 3AZKD 3A6NC 4KHAA 1AOIB 4ZBJC 5FUGB 5BNXA 1KX3D 4KGCC 5BT1C 3B6FC 1M1AB 5BO0B 3O62C 3C1BB 1F66C 3AZMC 1WWIA 4ZUXC 5E5AC 5GT3B 5KDMA 4G92B 1TAFB 3RELC 1P3MC 3MGRC 2YFWA 1HQ3A 4G91B 2HIOA 1P3IB 3KSYA 3X1UB 3X1SA 3W99C 5B31C 2HIOD 2NZDB 5CPKA 3LELC 4WU9B 5CPJA 3X1SD 5F99D 5CPKD 1U35A 3C1BC 2RVQD 5CPJD 1P3KB 3MGSC 2CV5D 5DNNB 5GT3C 5B0YB 4KUDB 3AYWB 5DNMD 4G92C 3WAAB 3REIC 3W97A 4J8UB 3UT9A 3B6GC 4QLCA 5AV5D 1KU5A 3W97D 5GXQB 3WTPE 5B2JC 3UT9D 5G49B 1P3IC 4QLCD 1BH9B 3X1UC 1S32A 2NQBA 5GSUB 2NZDC 3O62A 3MGPA 1P3AB 4KGCD 3W96B 1F66A 1WWSA 2NQBD 4WU9C 5BNVB 1S32D 3AFAB 1EQZB 4H9RA 1TZYB 5AY8A 3V9RB 3O62D 3RELA 1F66D 3AZMD 5E5AD 3X1TB 5AY8D 5B0YC 5B40C 3AYWC 3B0CT 3RELD 4XZQC 4H9QA 1P3MD 4DRBA 5AV6B 4J8UC 1P3PA 3TU4C 3REKB 3W99A 3AV2B 3LELA 5GXQC 1HTAA 1P3PD 3UTAA 3NQUB 3AZFB 3WA9C 3W99D 5GSUC 5B1LC 5B31D 3REHB 3LELD 1P3AC 4H9OB 5AV8A 3LZ1B 3UTAD 4H9PA 5AVCC 3AN2C 3MGSA 1EQZC 1P3FB 5AV8D 3X1VC 5CHLB 5B1MB 3C1BD 3AV1B 4J8XB 2F8NH 3MGSD 2BYKA 3X1TC 5CPIB 3AZHC 2BYMB 3B6GA 3LZ0A 3REID 4HGAC 4YS3C 5B24B 3AZLC 5B2JA 1H3OB 1Q9CA 3B6GD 5JRGC 3AV2C 1F1EA 4H9SC 5B2JD 1P3GB 3AZFC 4UUZB 2YFVA 3REHC 3R45A 4CAYB 3LZ1C 4R8PA 5AV9B 4JJNC 4XUJB 2FJ7C 5B40A 2IO5B 3KUYB 1KX5A 5B1MC 3AV1C 4R8PD 5CPIC 5B40D 4XZQD 1KX5D 3TU4A 5B32B 5B24C 5CP6A 1KX4B 3TU4D 5B1LA 2PYOB 3WKJB 1U35B 5AVBA 4Z2MG 3AZJA 5CP6D 3KWQC 4Z5TA 3AN2A 3WA9D 1M19A 1BH8A 3KXBA 5B1LD 1P34B 5AVBD 3LJAB 3AZJD 3X1VA 5B0ZC 4Z5TD 5AVCD 3AN2D 1M19D 3KXBD 4XUJC 4WNNB 3AZHA 2IO5C 3KUYC 3X1VD 5B33B 4WZSB 1KX3A 4YS3A 4E44A 3X1TD 3AZLA 3AZHD 4J8WB 3MGPB 4YS3D 3AZIB 5JRGA 5B32C 1P3BA 4H9NA 3AZLD 1ZLAB 1KX4C 1B6WA 2PYOC 4J8VC 4LD9B 5JRGD 1P3BD 3WKJC 3VH5T 3WTPB 1P34C 2FJ7A 3LJAC 4JJND 2FJ7D 3AZEA 3MNNB 3C1CA 1AOIC 5F99A 4CSRA 3AZED 3C1CD 1ZLAC 2CV5A 1M1AC 4H9PB 5DNMA 2AROB 4LD9C 4Z66B 1P3LB 3KWQD 3AZGA 5B0ZA 3VH5A 1JFIB 5AV5A 3WTPC 4WU8A 3LZ0B 3A6NA 3AZGD 5B0ZD 1A7WA 4G91C 4WU8D 3MGQB 3A6ND 4KGCA 3MNNC 3B6FA 3AZNB 3AZMA 5BT1D 4ZUXA 4J8VA 5E5AA 1P3OB 5B2IB 3B6FD 4WV4B 4AWLB 4X23B 1P3MA 4ZUXD 3MGRA 4J8VD 3NQJB 1P3KC 5DNNC 4KUDC 4DRAA 3MVDB 3WAAC 3REJB 2F8NA 4YM6B 3MGRD 1AOIA 2F8ND 5B31A 2LY8A 5FUGA 5BS7C 1AOID 1M18B 3AZNC 1M1AA 5GT0B 5BO0A 3W98B 3W96C 3C1BA 3UTBB 3AZKB 3AFAC 5JA4A 1P3OC 1ID3B 1M1AD 5GT3A 1TZYC 1TAFA 3REIA 4X23C 4LD9D 1KX3B 5GT3D 4KHAB 3MVDC 3REJC 4E45A 5BNXB 4YM6C 5AV6C 2F8NG 1P3IA 1ULYA 3X1UA 4H9NB 3REKC 2NZDA 1P3ID 5B31G 4NE5A 3X1UD 4WU9A 5KDMB 2NZDD 4WU9D 2YFWB 3UTBC 3AZKC 1P3KA 1HQ3B 1ID3C 5DNNA 1P3FC 5B0YA 4KUDA 3AYWA 4XZQA 3WAAA 2HIOB 4J8XC 1P3KD 4J8UA 5DNND 5B0YD 4KUDD 3AYWD 3X1SB 3WAAD 5CPKB 5BS7A 5GXQA 4J8UD 5CPJB 5G49A 2CV5B 1BH9A 3WA9A 5GSUA 5DNMB 5GXQD 1P3AA 5AVCA 5BNVA 1P3GC 5GSUD 1EQZA 2JSSA 3V9RA 5AV5B 1P3AD 3W96D 3W97B 3AFAD 5AV9C 1EQZD 1HQ3C 3X1TA 1TZYD 3UT9B 4QLCB 4ZBJB 4M6BA 5AV6A 4KGCB 2NQBB 1S32B 3X1SC 1N1JA 5CPKC 3VH6T 3O62B 5AV6D 3AV2A 1F66B 2RVQC 3AZMB 4H9SA 5CPJC 5E5AB 3NQUA 4H9RB 3AZFA 5AY8B 3REHA 3REKD 3RELB 3AV2D 1U35C 4H9OA 1P3MB 3LZ1A 3AZFD 4JJNA 3REHD 1P3FA 4H9QB
chains in the Genus database with same CATH superfamily
3VH5W 5B1MA 3LZ1D 3AV1A 4J8XA 1P3PB 1ID3D 5CPIA 1P3FD 3UT9C 2JCHA 4QLCC 2BYMA 3W99B 5B31B 5B33C 5B1MD 3AV1D 3LELB 4J8XD 5B24A 5CPID 2NQBC 3UTAB 1S32C 1H3OA 3B0DB 3VH6A 4J8WC 3MGPC 3AZIC 5AV8B 5B24D 3KWQA 5JA4B 3MGSB 1P3GA 4UUZA 5AY8C 2HUEB 5C3IB 3A1KA 3REIB 4CAYA 4NE6A 1P3GD 2BYKB 5AV9A 4WJ3C 4XUJA 3B6GB 3KUYA 5AV9D 1P3PC 1HQ3D 4XUJD 5B2JB 3KUYD 5B32A 3IP4C 3UTAC 2YFVB 1KX4A 1R4VA 3B0DC 2PYOA 3WKJA 4EO5B 3R45B 4NE3A 5B32D 5AV8C 4R8PB 1KX4D 5B40B 1P34A 2PYOD 2HUEC 2AROC 3WKJD 4XZQB 5C3IC 4Z66C 3LJAA 1U35D 1P3LC 1KX5B 1P34D 1BFMA 4WNNA 3LZ0C 3B0CW 3LJAD 3TU4B 5B33A 3B0BA 5CP6B 3MGQC 3WA9B 5B1LB 5B33D 4J8WA 5AVBB 3AZIA 3AZJB 1ZLAA 4Z5TB 5AVCB 3AN2B 1M19B 1BH8B 3KXBB 5B32G 2CWEA 4J8WD 4LD9A 3MGPD 3H0MC 3AZID 1ZLAD 4EO5C 5B2IC 3X1VB 4R8PC 4AWLC 3AZHB 3WTPA 1KX5C 4HGAB 4YS3B 3AZLB 3WTPD 3EPJA 1N1JB 5JRGB 3MNNA 1P3BB 5CP6C 1W2EA 2XD5A 3MNND 5AVBC 3AZJC 3KFUG 1M18C 4Z5TC 5GT0C 4JJNB 1M19C 3KXBC 2FJ7B 3W98C 2AROA 4Z66A 1P3LA 1JFIA 2Y2NA 2AROD 4Z66D 1P3LD 1KX3C 3AZEB 3C1CB 5F99B 4CSRB 3LZ0D 3MGQA 1P3BC 1PZRA 3KWQB 3AZNA 3MGQD 3W96A 2Y2IA 3AFAA 2ZY4A 3EPKA 5B2IA 5B0ZB 3AZND 1TZYA 3AZGB 1P3OA 4WU8B 4X23A 3NQJA 5B2ID 3A6NB 1P3OD 3MVDA 3REJA 2HIOC 4X23D 4YM6A 4NFTA 4Z2MH 3AZEC 3C1CC 3B6FB 5F99C 3MVDD 3REJD 1B67A 4YM6D 3REKA 2F8NK 4ZUXB 4J8VB 3VH6W 2CV5C 1M18A 5DNMC 5GT0A 3W98A 2L5AA 3MGRB 3UTBA 3AZKA 3AZGC 1Z2CB 1M18D 1ID3A 5GT0D 2F8NB 5AV5C 3W98D 4WU8C 3W97C 3UTBD 3AZKD 3A6NC 4KHAA 1AOIB 4ZBJC 5FUGB 5BNXA 1KX3D 4KGCC 5BT1C 3B6FC 2DQNC 1M1AB 5BO0B 3O62C 3C1BB 1F66C 3AZMC 1WWIA 4ZUXC 3F6TA 5E5AC 5GT3B 5KDMA 4G92B 1TAFB 3RELC 1P3MC 3MGRC 2YFWA 1HQ3A 4G91B 2HIOA 1P3IB 3KSYA 3X1UB 3X1SA 3W99C 5B31C 2HIOD 2NZDB 5CPKA 3LELC 4UPKA 4WU9B 5CPJA 3X1SD 5F99D 2G5IC 5CPKD 1U35A 3C1BC 2RVQD 5CPJD 1P3KB 2ZY5A 3MGSC 5DNNB 2CV5D 5GT3C 5B0YB 4KUDB 3AYWB 5DNMD 4G92C 3WAAB 3REIC 4DQYB 3W97A 4J8UB 3EG5B 3UT9A 3B6GC 4QLCA 5AV5D 1KU5A 3W97D 5GXQB 2XD1A 3WTPE 5B2JC 3UT9D 5G49B 1P3IC 4QLCD 1BH9B 3X1UC 1S32A 2NQBA 5GSUB 2NZDC 2G5HC 3O62A 3MGPA 1P3AB 4KGCD 3W96B 1F66A 1WWSA 2NQBD 4WU9C 5BNVB 1S32D 3AFAB 1EQZB 4H9RA 1TZYB 5AY8A 2VQRA 3V9RB 3O62D 3RELA 1F66D 3AZMD 5E5AD 3X1TB 5AY8D 5B0YC 5B40C 3AYWC 3B0CT 3RELD 4XZQC 4H9QA 1P3MD 4DRBA 5AV6B 4J8UC 1P3PA 3TU4C 3REKB 3W99A 3AV2B 3LELA 5GXQC 1HTAA 1P3PD 3UTAA 3NQUB 3AZFB 3WA9C 3W99D 5GSUC 5B1LC 5B31D 3REHB 3LELD 1P3AC 4H9OB 5AV8A 3LZ1B 3UTAD 4H9PA 5AVCC 3AN2C 3MGSA 1EQZC 1P3FB 5AV8D 3X1VC 5CHLB 5B1MB 3EPLA 3C1BD 4J8XB 3AV1B 2F8NH 3MGSD 2BYKA 3X1TC 5CPIB 3AZHC 2BYMB 3B6GA 3LZ0A 3REID 4HGAC 4YS3C 2DF4C 5B24B 2BG1A 3AZLC 5B2JA 1H3OB 1Q9CA 3B6GD 5JRGC 3AV2C 1F1EA 4H9SC 5B2JD 1P3GB 3AZFC 4UUZB 2YFVA 3REHC 3R45A 4CAYB 3LZ1C 4R8PA 5AV9B 4JJNC 4XUJB 2FJ7C 5B40A 2IO5B 3KUYB 1KX5A 5B1MC 3AV1C 2Y2KA 4R8PD 5CPIC 2Y2GA 5B40D 4XZQD 1KX5D 3TU4A 2ZY2A 2Y2OA 5B32B 5B24C 5CP6A 1KX4B 3TU4D 5B1LA 2PYOB 3WKJB 1U35B 5AVBA 4Z2MG 3AZJA 5CP6D 2JE5A 3KWQC 4Z5TA 3AN2A 3WA9D 1M19A 1BH8A 3KXBA 5B1LD 1P34B 5AVBD 3LJAB 3AZJD 3X1VA 5B0ZC 3FDDA 4Z5TD 5AVCD 3AN2D 1M19D 3KXBD 4XUJC 4WNNB 3AZHA 2IO5C 3KUYC 3X1VD 5B33B 4WZSB 1KX3A 2Y2LA 4YS3A 4E44A 3X1TD 3AZLA 3AZHD 4J8WB 3MGPB 4YS3D 3AZIB 5JRGA 5B32C 1P3BA 4H9NA 3AZLD 1ZLAB 1KX4C 1T3UA 1B6WA 2PYOC 4J8VC 4LD9B 5JRGD 1P3BD 3WKJC 3VH5T 3WTPB 1P34C 2FJ7A 3LJAC 4JJND 2FJ7D 3AZEA 3MNNB 3C1CA 1AOIC 5F99A 2ZM5A 4CSRA 3AZED 3C1CD 2Y2QA 1ZLAC 2CV5A 1M1AC 4H9PB 5DNMA 2AROB 4LD9C 4Z66B 1P3LB 3KWQD 3AZGA 5B0ZA 3VH5A 1JFIB 5AV5A 3WTPC 4WU8A 3H0LC 3LZ0B 3A6NA 3AZGD 5B0ZD 1A7WA 4G91C 4WU8D 3MGQB 3A6ND 4KGCA 3MNNC 3B6FA 3AZNB 3AZMA 5BT1D 4ZUXA 4J8VA 5E5AA 1P3OB 5B2IB 3B6FD 4WV4B 3EPHA 3H0RC 2Y2JA 4AWLB 4X23B 1P3MA 4ZUXD 3MGRA 4J8VD 3NQJB 1P3KC 5DNNC 4KUDC 4DRAA 3MVDB 3WAAC 3REJB 2F8NA 4YM6B 3MGRD 2RIQA 1AOIA 2F8ND 5B31A 2LY8A 5FUGA 5BS7C 1AOID 2Y2PA 1M18B 3AZNC 1M1AA 5GT0B 5BO0A 3W98B 3W96C 3C1BA 3UTBB 3AZKB 3AFAC 5JA4A 1P3OC 1ID3B 1M1AD 5GT3A 1TZYC 1TAFA 2J8PA 3REIA 4X23C 4LD9D 1KX3B 5GT3D 4KHAB 3MVDC 3REJC 4E45A 5BNXB 4YM6C 5AV6C 2F8NG 1P3IA 1ULYA 3X1UA 4H9NB 3REKC 2NZDA 1P3ID 5B31G 4NE5A 3X1UD 4WU9A 5KDMB 2NZDD 2Y2HA 4WU9D 2YFWB 3UTBC 3AZKC 1P3KA 1HQ3B 1ID3C 5DNNA 1P3FC 5B0YA 4KUDA 3AYWA 2Y2MA 4XZQA 2W8SA 2HIOB 3WAAA 4J8XC 1P3KD 4J8UA 5DNND 5B0YD 4KUDD 3AYWD 3X1SB 3WAAD 5CPKB 5BS7A 5GXQA 4J8UD 5CPJB 5G49A 2CV5B 1BH9A 2UWXA 3WA9A 5GSUA 3AL0C 3A1IA 5DNMB 5GXQD 1P3AA 5AVCA 5BNVA 1P3GC 5GSUD 1EQZA 2JSSA 3V9RA 5AV5B 1P3AD 3P5JB 3W96D 3W97B 3AFAD 5AV9C 1EQZD 1HQ3C 3X1TA 1TZYD 3UT9B 4QLCB 2ZY3A 4ZBJB 4M6BA 2F2AC 5AV6A 4KGCB 2NQBB 1S32B 3X1SC 1N1JA 5CPKC 2FFFB 3VH6T 3O62B 5AV6D 3AV2A 1F66B 2RVQC 3AZMB 4H9SA 5CPJC 5E5AB 3NQUA 4H9RB 3AZFA 5AY8B 3REHA 3REKD 3RELB 3AV2D 1U35C 4H9OA 1P3MB 3LZ1A 3AZFD 4JJNA 3REHD 1P3FA 4H9QB
chains in the Genus database with same CATH topology
3VH5W 5B1MA 3LZ1D 3AV1A 4J8XA 1P3PB 1ID3D 5CPIA 1P3FD 3UT9C 2JCHA 4QLCC 2BYMA 3W99B 5B31B 5B33C 5B1MD 3AV1D 3LELB 4J8XD 5B24A 5CPID 2NQBC 3UTAB 1S32C 1H3OA 3B0DB 3VH6A 4J8WC 3MGPC 3AZIC 5AV8B 5B24D 3KWQA 5JA4B 3MGSB 1P3GA 4UUZA 5AY8C 2HUEB 5C3IB 3A1KA 3REIB 4CAYA 4NE6A 1P3GD 2BYKB 5AV9A 4WJ3C 4XUJA 3B6GB 3KUYA 5AV9D 1P3PC 1HQ3D 4XUJD 5B2JB 3KUYD 5B32A 3IP4C 3UTAC 2YFVB 1KX4A 1R4VA 3B0DC 2PYOA 3WKJA 4EO5B 3R45B 4NE3A 5B32D 5AV8C 4R8PB 1KX4D 5B40B 1P34A 2PYOD 2HUEC 2AROC 3WKJD 4XZQB 5C3IC 4Z66C 3LJAA 1U35D 1P3LC 1KX5B 1P34D 1BFMA 4WNNA 3LZ0C 3B0CW 3LJAD 3TU4B 5B33A 3B0BA 5CP6B 3MGQC 3WA9B 5B1LB 5B33D 4J8WA 5AVBB 3AZIA 3AZJB 1ZLAA 4Z5TB 5AVCB 3AN2B 1M19B 1BH8B 3KXBB 5B32G 2CWEA 4J8WD 4LD9A 3MGPD 3H0MC 3AZID 1ZLAD 4EO5C 5B2IC 3X1VB 4R8PC 4AWLC 3AZHB 3WTPA 1KX5C 4HGAB 4YS3B 3AZLB 3WTPD 3EPJA 1N1JB 5JRGB 3MNNA 1P3BB 5CP6C 1W2EA 2XD5A 3MNND 5AVBC 3AZJC 3KFUG 1M18C 4Z5TC 5GT0C 4JJNB 1M19C 3KXBC 2FJ7B 3W98C 2AROA 4Z66A 1P3LA 1JFIA 2Y2NA 2AROD 4Z66D 1P3LD 1KX3C 3AZEB 3C1CB 5F99B 4CSRB 3LZ0D 3MGQA 1P3BC 1PZRA 3KWQB 3AZNA 3MGQD 3W96A 2Y2IA 3AFAA 2ZY4A 3EPKA 5B2IA 5B0ZB 3AZND 1TZYA 3AZGB 1P3OA 4WU8B 4X23A 3NQJA 5B2ID 3A6NB 1P3OD 3MVDA 3REJA 2HIOC 4X23D 4YM6A 4NFTA 4Z2MH 3AZEC 3C1CC 3B6FB 5F99C 3MVDD 3REJD 1B67A 4YM6D 3REKA 2F8NK 4ZUXB 4J8VB 3VH6W 2CV5C 1M18A 5DNMC 5GT0A 3W98A 2L5AA 3MGRB 3UTBA 3AZKA 3AZGC 1Z2CB 1M18D 1ID3A 5GT0D 2F8NB 5AV5C 3W98D 4WU8C 3W97C 3UTBD 3AZKD 3A6NC 4KHAA 1AOIB 4ZBJC 5FUGB 5BNXA 1KX3D 4KGCC 5BT1C 3B6FC 2DQNC 1M1AB 5BO0B 3O62C 3C1BB 1F66C 3AZMC 1WWIA 4ZUXC 3F6TA 5E5AC 5GT3B 5KDMA 4G92B 1TAFB 3RELC 1P3MC 3MGRC 2YFWA 1HQ3A 4G91B 2HIOA 1P3IB 3KSYA 3X1UB 3X1SA 3W99C 5B31C 2HIOD 2NZDB 5CPKA 3LELC 4UPKA 4WU9B 5CPJA 3X1SD 5F99D 2G5IC 5CPKD 1U35A 3C1BC 2RVQD 5CPJD 1P3KB 2ZY5A 3MGSC 5DNNB 2CV5D 5GT3C 5B0YB 4KUDB 3AYWB 5DNMD 4G92C 3WAAB 3REIC 4DQYB 3W97A 4J8UB 3EG5B 3UT9A 3B6GC 4QLCA 5AV5D 1KU5A 3W97D 5GXQB 2XD1A 3WTPE 5B2JC 3UT9D 5G49B 1P3IC 4QLCD 1BH9B 3X1UC 1S32A 2NQBA 5GSUB 2NZDC 2G5HC 3O62A 3MGPA 1P3AB 4KGCD 3W96B 1F66A 1WWSA 2NQBD 4WU9C 5BNVB 1S32D 3AFAB 1EQZB 4H9RA 1TZYB 5AY8A 2VQRA 3V9RB 3O62D 3RELA 1F66D 3AZMD 5E5AD 3X1TB 5AY8D 5B0YC 5B40C 3AYWC 3B0CT 3RELD 4XZQC 4H9QA 1P3MD 4DRBA 5AV6B 4J8UC 1P3PA 3TU4C 3REKB 3W99A 3AV2B 3LELA 5GXQC 1HTAA 1P3PD 3UTAA 3NQUB 3AZFB 3WA9C 3W99D 5GSUC 5B1LC 5B31D 3REHB 3LELD 1P3AC 4H9OB 5AV8A 3LZ1B 3UTAD 4H9PA 5AVCC 3AN2C 3MGSA 1EQZC 1P3FB 5AV8D 3X1VC 5CHLB 5B1MB 3EPLA 3C1BD 4J8XB 3AV1B 2F8NH 3MGSD 2BYKA 3X1TC 5CPIB 3AZHC 2BYMB 3B6GA 3LZ0A 3REID 4HGAC 4YS3C 2DF4C 5B24B 2BG1A 3AZLC 5B2JA 1H3OB 1Q9CA 3B6GD 5JRGC 3AV2C 1F1EA 4H9SC 5B2JD 1P3GB 3AZFC 4UUZB 2YFVA 3REHC 3R45A 4CAYB 3LZ1C 4R8PA 5AV9B 4JJNC 4XUJB 2FJ7C 5B40A 2IO5B 3KUYB 1KX5A 5B1MC 3AV1C 2Y2KA 4R8PD 5CPIC 2Y2GA 5B40D 4XZQD 1KX5D 3TU4A 2ZY2A 2Y2OA 5B32B 5B24C 5CP6A 1KX4B 3TU4D 5B1LA 2PYOB 3WKJB 1U35B 5AVBA 4Z2MG 3AZJA 5CP6D 2JE5A 3KWQC 4Z5TA 3AN2A 3WA9D 1M19A 1BH8A 3KXBA 5B1LD 1P34B 5AVBD 3LJAB 3AZJD 3X1VA 5B0ZC 3FDDA 4Z5TD 5AVCD 3AN2D 1M19D 3KXBD 4XUJC 4WNNB 3AZHA 2IO5C 3KUYC 3X1VD 5B33B 4WZSB 1KX3A 2Y2LA 4YS3A 4E44A 3X1TD 3AZLA 3AZHD 4J8WB 3MGPB 4YS3D 3AZIB 5JRGA 5B32C 1P3BA 4H9NA 3AZLD 1ZLAB 1KX4C 1T3UA 1B6WA 2PYOC 4J8VC 4LD9B 5JRGD 1P3BD 3WKJC 3VH5T 3WTPB 1P34C 2FJ7A 3LJAC 4JJND 2FJ7D 3AZEA 3MNNB 3C1CA 1AOIC 5F99A 2ZM5A 4CSRA 3AZED 3C1CD 2Y2QA 1ZLAC 2CV5A 1M1AC 4H9PB 5DNMA 2AROB 4LD9C 4Z66B 1P3LB 3KWQD 3AZGA 5B0ZA 3VH5A 1JFIB 5AV5A 3WTPC 4WU8A 3H0LC 3LZ0B 3A6NA 3AZGD 5B0ZD 1A7WA 4G91C 4WU8D 3MGQB 3A6ND 4KGCA 3MNNC 3B6FA 3AZNB 3AZMA 5BT1D 4ZUXA 4J8VA 5E5AA 1P3OB 5B2IB 3B6FD 4WV4B 3EPHA 3H0RC 2Y2JA 4AWLB 4X23B 1P3MA 4ZUXD 3MGRA 4J8VD 3NQJB 1P3KC 5DNNC 4KUDC 4DRAA 3MVDB 3WAAC 3REJB 2F8NA 4YM6B 3MGRD 2RIQA 1AOIA 2F8ND 5B31A 2LY8A 5FUGA 5BS7C 1AOID 2Y2PA 1M18B 3AZNC 1M1AA 5GT0B 5BO0A 3W98B 3W96C 3C1BA 3UTBB 3AZKB 3AFAC 5JA4A 1P3OC 1ID3B 1M1AD 5GT3A 1TZYC 1TAFA 2J8PA 3REIA 4X23C 4LD9D 1KX3B 5GT3D 4KHAB 3MVDC 3REJC 4E45A 5BNXB 4YM6C 5AV6C 2F8NG 1P3IA 1ULYA 3X1UA 4H9NB 3REKC 2NZDA 1P3ID 5B31G 4NE5A 3X1UD 4WU9A 5KDMB 2NZDD 2Y2HA 4WU9D 2YFWB 3UTBC 3AZKC 1P3KA 1HQ3B 1ID3C 5DNNA 1P3FC 5B0YA 4KUDA 3AYWA 2Y2MA 4XZQA 2W8SA 2HIOB 3WAAA 4J8XC 1P3KD 4J8UA 5DNND 5B0YD 4KUDD 3AYWD 3X1SB 3WAAD 5CPKB 5BS7A 5GXQA 4J8UD 5CPJB 5G49A 2CV5B 1BH9A 2UWXA 3WA9A 5GSUA 3AL0C 3A1IA 5DNMB 5GXQD 1P3AA 5AVCA 5BNVA 1P3GC 5GSUD 1EQZA 2JSSA 3V9RA 5AV5B 1P3AD 3P5JB 3W96D 3W97B 3AFAD 5AV9C 1EQZD 1HQ3C 3X1TA 1TZYD 3UT9B 4QLCB 2ZY3A 4ZBJB 4M6BA 2F2AC 5AV6A 4KGCB 2NQBB 1S32B 3X1SC 1N1JA 5CPKC 2FFFB 3VH6T 3O62B 5AV6D 3AV2A 1F66B 2RVQC 3AZMB 4H9SA 5CPJC 5E5AB 3NQUA 4H9RB 3AZFA 5AY8B 3REHA 3REKD 3RELB 3AV2D 1U35C 4H9OA 1P3MB 3LZ1A 3AZFD 4JJNA 3REHD 1P3FA 4H9QB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VH5 W;  5B1M A;  3LZ1 D;  3AV1 A;  4J8X A;  1P3P B;  1ID3 D;  5CPI A;  1P3F D;  3UT9 C;  4QLC C;  2BYM A;  3W99 B;  5B31 B;  5B33 C;  5B1M D;  3AV1 D;  3LEL B;  4J8X D;  5B24 A;  5CPI D;  2NQB C;  3UTA B;  1S32 C;  1H3O A;  3B0D B;  3VH6 A;  4J8W C;  3MGP C;  3AZI C;  5AV8 B;  5B24 D;  3KWQ A;  5JA4 B;  3MGS B;  1P3G A;  4UUZ A;  5AY8 C;  2HUE B;  5C3I B;  3REI B;  4CAY A;  4NE6 A;  1P3G D;  2BYK B;  5AV9 A;  4XUJ A;  3B6G B;  3KUY A;  5AV9 D;  1P3P C;  1HQ3 D;  4XUJ D;  5B2J B;  3KUY D;  5B32 A;  3UTA C;  2YFV B;  1KX4 A;  1R4V A;  3B0D C;  2PYO A;  3WKJ A;  4EO5 B;  3R45 B;  4NE3 A;  5B32 D;  5AV8 C;  4R8P B;  1KX4 D;  5B40 B;  1P34 A;  2PYO D;  2HUE C;  2ARO C;  3WKJ D;  4XZQ B;  5C3I C;  4Z66 C;  3LJA A;  1U35 D;  1P3L C;  1KX5 B;  1P34 D;  1BFM A;  4WNN A;  3LZ0 C;  3B0C W;  3LJA D;  3TU4 B;  5B33 A;  3B0B A;  5CP6 B;  3MGQ C;  3WA9 B;  5B1L B;  5B33 D;  4J8W A;  5AVB B;  3AZI A;  3AZJ B;  1ZLA A;  4Z5T B;  5AVC B;  3AN2 B;  1M19 B;  1BH8 B;  3KXB B;  5B32 G;  2CWE A;  4J8W D;  4LD9 A;  3MGP D;  3AZI D;  1ZLA D;  4EO5 C;  5B2I C;  3X1V B;  4R8P C;  4AWL C;  3AZH B;  3WTP A;  1KX5 C;  4HGA B;  4YS3 B;  3AZL B;  3WTP D;  1N1J B;  5JRG B;  3MNN A;  1P3B B;  5CP6 C;  3MNN D;  5AVB C;  3AZJ C;  1M18 C;  4Z5T C;  5GT0 C;  4JJN B;  1M19 C;  3KXB C;  2FJ7 B;  3W98 C;  2ARO A;  4Z66 A;  1P3L A;  1JFI A;  2ARO D;  4Z66 D;  1P3L D;  1KX3 C;  3AZE B;  3C1C B;  5F99 B;  4CSR B;  3LZ0 D;  3MGQ A;  1P3B C;  3KWQ B;  3AZN A;  3MGQ D;  3W96 A;  3AFA A;  3AZG B;  5B2I A;  5B0Z B;  3AZN D;  1TZY A;  1P3O A;  4WU8 B;  4X23 A;  3NQJ A;  5B2I D;  3A6N B;  1P3O D;  3MVD A;  3REJ A;  2HIO C;  4X23 D;  4YM6 A;  4NFT A;  4Z2M H;  3AZE C;  3C1C C;  3B6F B;  5F99 C;  3MVD D;  3REJ D;  1B67 A;  4YM6 D;  3REK A;  2F8N K;  4ZUX B;  4J8V B;  3VH6 W;  2CV5 C;  1M18 A;  5DNM C;  5GT0 A;  3W98 A;  2L5A A;  3MGR B;  3UTB A;  3AZK A;  3AZG C;  1M18 D;  1ID3 A;  5GT0 D;  2F8N B;  5AV5 C;  3W98 D;  4WU8 C;  3W97 C;  3UTB D;  3AZK D;  3A6N C;  4KHA A;  1AOI B;  4ZBJ C;  5FUG B;  5BNX A;  1KX3 D;  4KGC C;  5BT1 C;  3B6F C;  1M1A B;  5BO0 B;  3O62 C;  3C1B B;  1F66 C;  3AZM C;  1WWI A;  4ZUX C;  5E5A C;  5GT3 B;  5KDM A;  4G92 B;  1TAF B;  3REL C;  1P3M C;  3MGR C;  2YFW A;  1HQ3 A;  4G91 B;  2HIO A;  1P3I B;  3KSY A;  3X1U B;  3X1S A;  3W99 C;  5B31 C;  2HIO D;  2NZD B;  5CPK A;  3LEL C;  4WU9 B;  5CPJ A;  3X1S D;  5F99 D;  5CPK D;  1U35 A;  3C1B C;  2RVQ D;  5CPJ D;  1P3K B;  3MGS C;  2CV5 D;  5DNN B;  5GT3 C;  5B0Y B;  4KUD B;  3AYW B;  5DNM D;  4G92 C;  3WAA B;  3REI C;  3W97 A;  4J8U B;  3UT9 A;  3B6G C;  4QLC A;  5AV5 D;  1KU5 A;  3W97 D;  5GXQ B;  3WTP E;  5B2J C;  3UT9 D;  5G49 B;  1P3I C;  4QLC D;  1BH9 B;  3X1U C;  1S32 A;  2NQB A;  5GSU B;  2NZD C;  3O62 A;  3MGP A;  1P3A B;  4KGC D;  3W96 B;  1F66 A;  1WWS A;  2NQB D;  4WU9 C;  5BNV B;  1S32 D;  3AFA B;  1EQZ B;  4H9R A;  1TZY B;  5AY8 A;  3V9R B;  3O62 D;  3REL A;  1F66 D;  3AZM D;  5E5A D;  3X1T B;  5AY8 D;  5B0Y C;  5B40 C;  3AYW C;  3B0C T;  3REL D;  4XZQ C;  4H9Q A;  1P3M D;  4DRB A;  5AV6 B;  4J8U C;  1P3P A;  3TU4 C;  3REK B;  3W99 A;  3AV2 B;  3LEL A;  5GXQ C;  1HTA A;  1P3P D;  3UTA A;  3NQU B;  3AZF B;  3WA9 C;  3W99 D;  5GSU C;  5B1L C;  5B31 D;  3REH B;  3LEL D;  1P3A C;  4H9O B;  5AV8 A;  3LZ1 B;  3UTA D;  4H9P A;  5AVC C;  3AN2 C;  3MGS A;  1EQZ C;  1P3F B;  5AV8 D;  3X1V C;  5CHL B;  5B1M B;  3C1B D;  3AV1 B;  4J8X B;  2F8N H;  3MGS D;  2BYK A;  3X1T C;  5CPI B;  3AZH C;  2BYM B;  3B6G A;  3LZ0 A;  3REI D;  4HGA C;  4YS3 C;  5B24 B;  3AZL C;  5B2J A;  1H3O B;  1Q9C A;  3B6G D;  5JRG C;  3AV2 C;  1F1E A;  4H9S C;  5B2J D;  1P3G B;  3AZF C;  4UUZ B;  2YFV A;  3REH C;  3R45 A;  4CAY B;  3LZ1 C;  4R8P A;  5AV9 B;  4JJN C;  4XUJ B;  2FJ7 C;  5B40 A;  2IO5 B;  3KUY B;  1KX5 A;  5B1M C;  3AV1 C;  4R8P D;  5CPI C;  5B40 D;  4XZQ D;  1KX5 D;  3TU4 A;  5B32 B;  5B24 C;  5CP6 A;  1KX4 B;  3TU4 D;  5B1L A;  2PYO B;  3WKJ B;  1U35 B;  5AVB A;  4Z2M G;  3AZJ A;  5CP6 D;  3KWQ C;  4Z5T A;  3AN2 A;  3WA9 D;  1M19 A;  1BH8 A;  3KXB A;  5B1L D;  1P34 B;  5AVB D;  3LJA B;  3AZJ D;  3X1V A;  5B0Z C;  4Z5T D;  5AVC D;  3AN2 D;  1M19 D;  3KXB D;  4XUJ C;  4WNN B;  3AZH A;  2IO5 C;  3KUY C;  3X1V D;  5B33 B;  4WZS B;  1KX3 A;  4YS3 A;  4E44 A;  3X1T D;  3AZL A;  3AZH D;  4J8W B;  3MGP B;  4YS3 D;  3AZI B;  5JRG A;  5B32 C;  1P3B A;  4H9N A;  3AZL D;  1ZLA B;  1KX4 C;  1B6W A;  2PYO C;  4J8V C;  4LD9 B;  5JRG D;  1P3B D;  3WKJ C;  3VH5 T;  3WTP B;  1P34 C;  2FJ7 A;  3LJA C;  4JJN D;  2FJ7 D;  3AZE A;  3MNN B;  3C1C A;  1AOI C;  5F99 A;  4CSR A;  3AZE D;  3C1C D;  1ZLA C;  2CV5 A;  1M1A C;  4H9P B;  5DNM A;  2ARO B;  4LD9 C;  4Z66 B;  1P3L B;  3KWQ D;  3AZG A;  5B0Z A;  3VH5 A;  1JFI B;  5AV5 A;  3WTP C;  4WU8 A;  3LZ0 B;  3A6N A;  3AZG D;  5B0Z D;  1A7W A;  4G91 C;  4WU8 D;  3MGQ B;  3A6N D;  4KGC A;  3MNN C;  3B6F A;  3AZN B;  3AZM A;  5BT1 D;  4ZUX A;  4J8V A;  5E5A A;  1P3O B;  5B2I B;  3B6F D;  4WV4 B;  4AWL B;  4X23 B;  1P3M A;  4ZUX D;  3MGR A;  4J8V D;  3NQJ B;  1P3K C;  5DNN C;  4KUD C;  4DRA A;  3MVD B;  3WAA C;  3REJ B;  2F8N A;  4YM6 B;  3MGR D;  1AOI A;  2F8N D;  5B31 A;  2LY8 A;  5FUG A;  5BS7 C;  1AOI D;  1M18 B;  3AZN C;  1M1A A;  5GT0 B;  5BO0 A;  3W98 B;  3W96 C;  3C1B A;  3UTB B;  3AZK B;  3AFA C;  5JA4 A;  1P3O C;  1ID3 B;  1M1A D;  5GT3 A;  1TZY C;  1TAF A;  3REI A;  4X23 C;  4LD9 D;  1KX3 B;  5GT3 D;  4KHA B;  3MVD C;  3REJ C;  4E45 A;  5BNX B;  4YM6 C;  5AV6 C;  2F8N G;  1P3I A;  1ULY A;  3X1U A;  4H9N B;  3REK C;  2NZD A;  1P3I D;  5B31 G;  4NE5 A;  3X1U D;  4WU9 A;  5KDM B;  2NZD D;  4WU9 D;  2YFW B;  3UTB C;  3AZK C;  1P3K A;  1HQ3 B;  1ID3 C;  5DNN A;  1P3F C;  5B0Y A;  4KUD A;  3AYW A;  4XZQ A;  3WAA A;  2HIO B;  4J8X C;  1P3K D;  4J8U A;  5DNN D;  5B0Y D;  4KUD D;  3AYW D;  3X1S B;  3WAA D;  5CPK B;  5BS7 A;  5GXQ A;  4J8U D;  5CPJ B;  5G49 A;  2CV5 B;  1BH9 A;  3WA9 A;  5GSU A;  5DNM B;  5GXQ D;  1P3A A;  5AVC A;  5BNV A;  1P3G C;  5GSU D;  1EQZ A;  2JSS A;  3V9R A;  5AV5 B;  1P3A D;  3W96 D;  3W97 B;  3AFA D;  5AV9 C;  1EQZ D;  1HQ3 C;  3X1T A;  1TZY D;  3UT9 B;  4QLC B;  4ZBJ B;  4M6B A;  5AV6 A;  4KGC B;  2NQB B;  1S32 B;  3X1S C;  1N1J A;  5CPK C;  3VH6 T;  3O62 B;  5AV6 D;  3AV2 A;  1F66 B;  2RVQ C;  3AZM B;  4H9S A;  5CPJ C;  5E5A B;  3NQU A;  4H9R B;  3AZF A;  5AY8 B;  3REH A;  3REK D;  3REL B;  3AV2 D;  1U35 C;  4H9O A;  1P3M B;  3LZ1 A;  3AZF D;  4JJN A;  3REH D;  1P3F A;  4H9Q B; 
#chains in the Genus database with same CATH topology
 3VH5 W;  5B1M A;  3LZ1 D;  3AV1 A;  4J8X A;  1P3P B;  1ID3 D;  5CPI A;  1P3F D;  3UT9 C;  2JCH A;  4QLC C;  2BYM A;  3W99 B;  5B31 B;  5B33 C;  5B1M D;  3AV1 D;  3LEL B;  4J8X D;  5B24 A;  5CPI D;  2NQB C;  3UTA B;  1S32 C;  1H3O A;  3B0D B;  3VH6 A;  4J8W C;  3MGP C;  3AZI C;  5AV8 B;  5B24 D;  3KWQ A;  5JA4 B;  3MGS B;  1P3G A;  4UUZ A;  5AY8 C;  2HUE B;  5C3I B;  3A1K A;  3REI B;  4CAY A;  4NE6 A;  1P3G D;  2BYK B;  5AV9 A;  4WJ3 C;  4XUJ A;  3B6G B;  3KUY A;  5AV9 D;  1P3P C;  1HQ3 D;  4XUJ D;  5B2J B;  3KUY D;  5B32 A;  3IP4 C;  3UTA C;  2YFV B;  1KX4 A;  1R4V A;  3B0D C;  2PYO A;  3WKJ A;  4EO5 B;  3R45 B;  4NE3 A;  5B32 D;  5AV8 C;  4R8P B;  1KX4 D;  5B40 B;  1P34 A;  2PYO D;  2HUE C;  2ARO C;  3WKJ D;  4XZQ B;  5C3I C;  4Z66 C;  3LJA A;  1U35 D;  1P3L C;  1KX5 B;  1P34 D;  1BFM A;  4WNN A;  3LZ0 C;  3B0C W;  3LJA D;  3TU4 B;  5B33 A;  3B0B A;  5CP6 B;  3MGQ C;  3WA9 B;  5B1L B;  5B33 D;  4J8W A;  5AVB B;  3AZI A;  3AZJ B;  1ZLA A;  4Z5T B;  5AVC B;  3AN2 B;  1M19 B;  1BH8 B;  3KXB B;  5B32 G;  2CWE A;  4J8W D;  4LD9 A;  3MGP D;  3H0M C;  3AZI D;  1ZLA D;  4EO5 C;  5B2I C;  3X1V B;  4R8P C;  4AWL C;  3AZH B;  3WTP A;  1KX5 C;  4HGA B;  4YS3 B;  3AZL B;  3WTP D;  3EPJ A;  1N1J B;  5JRG B;  3MNN A;  1P3B B;  5CP6 C;  1W2E A;  2XD5 A;  3MNN D;  5AVB C;  3AZJ C;  3KFU G;  1M18 C;  4Z5T C;  5GT0 C;  4JJN B;  1M19 C;  3KXB C;  2FJ7 B;  3W98 C;  2ARO A;  4Z66 A;  1P3L A;  1JFI A;  2Y2N A;  2ARO D;  4Z66 D;  1P3L D;  1KX3 C;  3AZE B;  3C1C B;  5F99 B;  4CSR B;  3LZ0 D;  3MGQ A;  1P3B C;  1PZR A;  3KWQ B;  3AZN A;  3MGQ D;  3W96 A;  2Y2I A;  3AFA A;  2ZY4 A;  3EPK A;  5B2I A;  5B0Z B;  3AZN D;  1TZY A;  3AZG B;  1P3O A;  4WU8 B;  4X23 A;  3NQJ A;  5B2I D;  3A6N B;  1P3O D;  3MVD A;  3REJ A;  2HIO C;  4X23 D;  4YM6 A;  4NFT A;  4Z2M H;  3AZE C;  3C1C C;  3B6F B;  5F99 C;  3MVD D;  3REJ D;  1B67 A;  4YM6 D;  3REK A;  2F8N K;  4ZUX B;  4J8V B;  3VH6 W;  2CV5 C;  1M18 A;  5DNM C;  5GT0 A;  3W98 A;  2L5A A;  3MGR B;  3UTB A;  3AZK A;  3AZG C;  1Z2C B;  1M18 D;  1ID3 A;  5GT0 D;  2F8N B;  5AV5 C;  3W98 D;  4WU8 C;  3W97 C;  3UTB D;  3AZK D;  3A6N C;  4KHA A;  1AOI B;  4ZBJ C;  5FUG B;  5BNX A;  1KX3 D;  4KGC C;  5BT1 C;  3B6F C;  2DQN C;  1M1A B;  5BO0 B;  3O62 C;  3C1B B;  1F66 C;  3AZM C;  1WWI A;  4ZUX C;  3F6T A;  5E5A C;  5GT3 B;  5KDM A;  4G92 B;  1TAF B;  3REL C;  1P3M C;  3MGR C;  2YFW A;  1HQ3 A;  4G91 B;  2HIO A;  1P3I B;  3KSY A;  3X1U B;  3X1S A;  3W99 C;  5B31 C;  2HIO D;  2NZD B;  5CPK A;  3LEL C;  4UPK A;  4WU9 B;  5CPJ A;  3X1S D;  5F99 D;  2G5I C;  5CPK D;  1U35 A;  3C1B C;  2RVQ D;  5CPJ D;  1P3K B;  2ZY5 A;  3MGS C;  5DNN B;  2CV5 D;  5GT3 C;  5B0Y B;  4KUD B;  3AYW B;  5DNM D;  4G92 C;  3WAA B;  3REI C;  4DQY B;  3W97 A;  4J8U B;  3EG5 B;  3UT9 A;  3B6G C;  4QLC A;  5AV5 D;  1KU5 A;  3W97 D;  5GXQ B;  2XD1 A;  3WTP E;  5B2J C;  3UT9 D;  5G49 B;  1P3I C;  4QLC D;  1BH9 B;  3X1U C;  1S32 A;  2NQB A;  5GSU B;  2NZD C;  2G5H C;  3O62 A;  3MGP A;  1P3A B;  4KGC D;  3W96 B;  1F66 A;  1WWS A;  2NQB D;  4WU9 C;  5BNV B;  1S32 D;  3AFA B;  1EQZ B;  4H9R A;  1TZY B;  5AY8 A;  2VQR A;  3V9R B;  3O62 D;  3REL A;  1F66 D;  3AZM D;  5E5A D;  3X1T B;  5AY8 D;  5B0Y C;  5B40 C;  3AYW C;  3B0C T;  3REL D;  4XZQ C;  4H9Q A;  1P3M D;  4DRB A;  5AV6 B;  4J8U C;  1P3P A;  3TU4 C;  3REK B;  3W99 A;  3AV2 B;  3LEL A;  5GXQ C;  1HTA A;  1P3P D;  3UTA A;  3NQU B;  3AZF B;  3WA9 C;  3W99 D;  5GSU C;  5B1L C;  5B31 D;  3REH B;  3LEL D;  1P3A C;  4H9O B;  5AV8 A;  3LZ1 B;  3UTA D;  4H9P A;  5AVC C;  3AN2 C;  3MGS A;  1EQZ C;  1P3F B;  5AV8 D;  3X1V C;  5CHL B;  5B1M B;  3EPL A;  3C1B D;  4J8X B;  3AV1 B;  2F8N H;  3MGS D;  2BYK A;  3X1T C;  5CPI B;  3AZH C;  2BYM B;  3B6G A;  3LZ0 A;  3REI D;  4HGA C;  4YS3 C;  2DF4 C;  5B24 B;  2BG1 A;  3AZL C;  5B2J A;  1H3O B;  1Q9C A;  3B6G D;  5JRG C;  3AV2 C;  1F1E A;  4H9S C;  5B2J D;  1P3G B;  3AZF C;  4UUZ B;  2YFV A;  3REH C;  3R45 A;  4CAY B;  3LZ1 C;  4R8P A;  5AV9 B;  4JJN C;  4XUJ B;  2FJ7 C;  5B40 A;  2IO5 B;  3KUY B;  1KX5 A;  5B1M C;  3AV1 C;  2Y2K A;  4R8P D;  5CPI C;  2Y2G A;  5B40 D;  4XZQ D;  1KX5 D;  3TU4 A;  2ZY2 A;  2Y2O A;  5B32 B;  5B24 C;  5CP6 A;  1KX4 B;  3TU4 D;  5B1L A;  2PYO B;  3WKJ B;  1U35 B;  5AVB A;  4Z2M G;  3AZJ A;  5CP6 D;  2JE5 A;  3KWQ C;  4Z5T A;  3AN2 A;  3WA9 D;  1M19 A;  1BH8 A;  3KXB A;  5B1L D;  1P34 B;  5AVB D;  3LJA B;  3AZJ D;  3X1V A;  5B0Z C;  3FDD A;  4Z5T D;  5AVC D;  3AN2 D;  1M19 D;  3KXB D;  4XUJ C;  4WNN B;  3AZH A;  2IO5 C;  3KUY C;  3X1V D;  5B33 B;  4WZS B;  1KX3 A;  2Y2L A;  4YS3 A;  4E44 A;  3X1T D;  3AZL A;  3AZH D;  4J8W B;  3MGP B;  4YS3 D;  3AZI B;  5JRG A;  5B32 C;  1P3B A;  4H9N A;  3AZL D;  1ZLA B;  1KX4 C;  1T3U A;  1B6W A;  2PYO C;  4J8V C;  4LD9 B;  5JRG D;  1P3B D;  3WKJ C;  3VH5 T;  3WTP B;  1P34 C;  2FJ7 A;  3LJA C;  4JJN D;  2FJ7 D;  3AZE A;  3MNN B;  3C1C A;  1AOI C;  5F99 A;  2ZM5 A;  4CSR A;  3AZE D;  3C1C D;  2Y2Q A;  1ZLA C;  2CV5 A;  1M1A C;  4H9P B;  5DNM A;  2ARO B;  4LD9 C;  4Z66 B;  1P3L B;  3KWQ D;  3AZG A;  5B0Z A;  3VH5 A;  1JFI B;  5AV5 A;  3WTP C;  4WU8 A;  3H0L C;  3LZ0 B;  3A6N A;  3AZG D;  5B0Z D;  1A7W A;  4G91 C;  4WU8 D;  3MGQ B;  3A6N D;  4KGC A;  3MNN C;  3B6F A;  3AZN B;  3AZM A;  5BT1 D;  4ZUX A;  4J8V A;  5E5A A;  1P3O B;  5B2I B;  3B6F D;  4WV4 B;  3EPH A;  3H0R C;  2Y2J A;  4AWL B;  4X23 B;  1P3M A;  4ZUX D;  3MGR A;  4J8V D;  3NQJ B;  1P3K C;  5DNN C;  4KUD C;  4DRA A;  3MVD B;  3WAA C;  3REJ B;  2F8N A;  4YM6 B;  3MGR D;  2RIQ A;  1AOI A;  2F8N D;  5B31 A;  2LY8 A;  5FUG A;  5BS7 C;  1AOI D;  2Y2P A;  1M18 B;  3AZN C;  1M1A A;  5GT0 B;  5BO0 A;  3W98 B;  3W96 C;  3C1B A;  3UTB B;  3AZK B;  3AFA C;  5JA4 A;  1P3O C;  1ID3 B;  1M1A D;  5GT3 A;  1TZY C;  1TAF A;  2J8P A;  3REI A;  4X23 C;  4LD9 D;  1KX3 B;  5GT3 D;  4KHA B;  3MVD C;  3REJ C;  4E45 A;  5BNX B;  4YM6 C;  5AV6 C;  2F8N G;  1P3I A;  1ULY A;  3X1U A;  4H9N B;  3REK C;  2NZD A;  1P3I D;  5B31 G;  4NE5 A;  3X1U D;  4WU9 A;  5KDM B;  2NZD D;  2Y2H A;  4WU9 D;  2YFW B;  3UTB C;  3AZK C;  1P3K A;  1HQ3 B;  1ID3 C;  5DNN A;  1P3F C;  5B0Y A;  4KUD A;  3AYW A;  2Y2M A;  4XZQ A;  2W8S A;  2HIO B;  3WAA A;  4J8X C;  1P3K D;  4J8U A;  5DNN D;  5B0Y D;  4KUD D;  3AYW D;  3X1S B;  3WAA D;  5CPK B;  5BS7 A;  5GXQ A;  4J8U D;  5CPJ B;  5G49 A;  2CV5 B;  1BH9 A;  2UWX A;  3WA9 A;  5GSU A;  3AL0 C;  3A1I A;  5DNM B;  5GXQ D;  1P3A A;  5AVC A;  5BNV A;  1P3G C;  5GSU D;  1EQZ A;  2JSS A;  3V9R A;  5AV5 B;  1P3A D;  3P5J B;  3W96 D;  3W97 B;  3AFA D;  5AV9 C;  1EQZ D;  1HQ3 C;  3X1T A;  1TZY D;  3UT9 B;  4QLC B;  2ZY3 A;  4ZBJ B;  4M6B A;  2F2A C;  5AV6 A;  4KGC B;  2NQB B;  1S32 B;  3X1S C;  1N1J A;  5CPK C;  2FFF B;  3VH6 T;  3O62 B;  5AV6 D;  3AV2 A;  1F66 B;  2RVQ C;  3AZM B;  4H9S A;  5CPJ C;  5E5A B;  3NQU A;  4H9R B;  3AZF A;  5AY8 B;  3REH A;  3REK D;  3REL B;  3AV2 D;  1U35 C;  4H9O A;  1P3M B;  3LZ1 A;  3AZF D;  4JJN A;  3REH D;  1P3F A;  4H9Q B; 
#chains in the Genus database with same CATH homology
 3VH5 W;  5B1M A;  3LZ1 D;  3AV1 A;  4J8X A;  1P3P B;  1ID3 D;  5CPI A;  1P3F D;  3UT9 C;  2JCH A;  4QLC C;  2BYM A;  3W99 B;  5B31 B;  5B33 C;  5B1M D;  3AV1 D;  3LEL B;  4J8X D;  5B24 A;  5CPI D;  2NQB C;  3UTA B;  1S32 C;  1H3O A;  3B0D B;  3VH6 A;  4J8W C;  3MGP C;  3AZI C;  5AV8 B;  5B24 D;  3KWQ A;  5JA4 B;  3MGS B;  1P3G A;  4UUZ A;  5AY8 C;  2HUE B;  5C3I B;  3A1K A;  3REI B;  4CAY A;  4NE6 A;  1P3G D;  2BYK B;  5AV9 A;  4WJ3 C;  4XUJ A;  3B6G B;  3KUY A;  5AV9 D;  1P3P C;  1HQ3 D;  4XUJ D;  5B2J B;  3KUY D;  5B32 A;  3IP4 C;  3UTA C;  2YFV B;  1KX4 A;  1R4V A;  3B0D C;  2PYO A;  3WKJ A;  4EO5 B;  3R45 B;  4NE3 A;  5B32 D;  5AV8 C;  4R8P B;  1KX4 D;  5B40 B;  1P34 A;  2PYO D;  2HUE C;  2ARO C;  3WKJ D;  4XZQ B;  5C3I C;  4Z66 C;  3LJA A;  1U35 D;  1P3L C;  1KX5 B;  1P34 D;  1BFM A;  4WNN A;  3LZ0 C;  3B0C W;  3LJA D;  3TU4 B;  5B33 A;  3B0B A;  5CP6 B;  3MGQ C;  3WA9 B;  5B1L B;  5B33 D;  4J8W A;  5AVB B;  3AZI A;  3AZJ B;  1ZLA A;  4Z5T B;  5AVC B;  3AN2 B;  1M19 B;  1BH8 B;  3KXB B;  5B32 G;  2CWE A;  4J8W D;  4LD9 A;  3MGP D;  3H0M C;  3AZI D;  1ZLA D;  4EO5 C;  5B2I C;  3X1V B;  4R8P C;  4AWL C;  3AZH B;  3WTP A;  1KX5 C;  4HGA B;  4YS3 B;  3AZL B;  3WTP D;  3EPJ A;  1N1J B;  5JRG B;  3MNN A;  1P3B B;  5CP6 C;  1W2E A;  2XD5 A;  3MNN D;  5AVB C;  3AZJ C;  3KFU G;  1M18 C;  4Z5T C;  5GT0 C;  4JJN B;  1M19 C;  3KXB C;  2FJ7 B;  3W98 C;  2ARO A;  4Z66 A;  1P3L A;  1JFI A;  2Y2N A;  2ARO D;  4Z66 D;  1P3L D;  1KX3 C;  3AZE B;  3C1C B;  5F99 B;  4CSR B;  3LZ0 D;  3MGQ A;  1P3B C;  1PZR A;  3KWQ B;  3AZN A;  3MGQ D;  3W96 A;  2Y2I A;  3AFA A;  2ZY4 A;  3EPK A;  5B2I A;  5B0Z B;  3AZN D;  1TZY A;  3AZG B;  1P3O A;  4WU8 B;  4X23 A;  3NQJ A;  5B2I D;  3A6N B;  1P3O D;  3MVD A;  3REJ A;  2HIO C;  4X23 D;  4YM6 A;  4NFT A;  4Z2M H;  3AZE C;  3C1C C;  3B6F B;  5F99 C;  3MVD D;  3REJ D;  1B67 A;  4YM6 D;  3REK A;  2F8N K;  4ZUX B;  4J8V B;  3VH6 W;  2CV5 C;  1M18 A;  5DNM C;  5GT0 A;  3W98 A;  2L5A A;  3MGR B;  3UTB A;  3AZK A;  3AZG C;  1Z2C B;  1M18 D;  1ID3 A;  5GT0 D;  2F8N B;  5AV5 C;  3W98 D;  4WU8 C;  3W97 C;  3UTB D;  3AZK D;  3A6N C;  4KHA A;  1AOI B;  4ZBJ C;  5FUG B;  5BNX A;  1KX3 D;  4KGC C;  5BT1 C;  3B6F C;  2DQN C;  1M1A B;  5BO0 B;  3O62 C;  3C1B B;  1F66 C;  3AZM C;  1WWI A;  4ZUX C;  3F6T A;  5E5A C;  5GT3 B;  5KDM A;  4G92 B;  1TAF B;  3REL C;  1P3M C;  3MGR C;  2YFW A;  1HQ3 A;  4G91 B;  2HIO A;  1P3I B;  3KSY A;  3X1U B;  3X1S A;  3W99 C;  5B31 C;  2HIO D;  2NZD B;  5CPK A;  3LEL C;  4UPK A;  4WU9 B;  5CPJ A;  3X1S D;  5F99 D;  2G5I C;  5CPK D;  1U35 A;  3C1B C;  2RVQ D;  5CPJ D;  1P3K B;  2ZY5 A;  3MGS C;  5DNN B;  2CV5 D;  5GT3 C;  5B0Y B;  4KUD B;  3AYW B;  5DNM D;  4G92 C;  3WAA B;  3REI C;  4DQY B;  3W97 A;  4J8U B;  3EG5 B;  3UT9 A;  3B6G C;  4QLC A;  5AV5 D;  1KU5 A;  3W97 D;  5GXQ B;  2XD1 A;  3WTP E;  5B2J C;  3UT9 D;  5G49 B;  1P3I C;  4QLC D;  1BH9 B;  3X1U C;  1S32 A;  2NQB A;  5GSU B;  2NZD C;  2G5H C;  3O62 A;  3MGP A;  1P3A B;  4KGC D;  3W96 B;  1F66 A;  1WWS A;  2NQB D;  4WU9 C;  5BNV B;  1S32 D;  3AFA B;  1EQZ B;  4H9R A;  1TZY B;  5AY8 A;  2VQR A;  3V9R B;  3O62 D;  3REL A;  1F66 D;  3AZM D;  5E5A D;  3X1T B;  5AY8 D;  5B0Y C;  5B40 C;  3AYW C;  3B0C T;  3REL D;  4XZQ C;  4H9Q A;  1P3M D;  4DRB A;  5AV6 B;  4J8U C;  1P3P A;  3TU4 C;  3REK B;  3W99 A;  3AV2 B;  3LEL A;  5GXQ C;  1HTA A;  1P3P D;  3UTA A;  3NQU B;  3AZF B;  3WA9 C;  3W99 D;  5GSU C;  5B1L C;  5B31 D;  3REH B;  3LEL D;  1P3A C;  4H9O B;  5AV8 A;  3LZ1 B;  3UTA D;  4H9P A;  5AVC C;  3AN2 C;  3MGS A;  1EQZ C;  1P3F B;  5AV8 D;  3X1V C;  5CHL B;  5B1M B;  3EPL A;  3C1B D;  4J8X B;  3AV1 B;  2F8N H;  3MGS D;  2BYK A;  3X1T C;  5CPI B;  3AZH C;  2BYM B;  3B6G A;  3LZ0 A;  3REI D;  4HGA C;  4YS3 C;  2DF4 C;  5B24 B;  2BG1 A;  3AZL C;  5B2J A;  1H3O B;  1Q9C A;  3B6G D;  5JRG C;  3AV2 C;  1F1E A;  4H9S C;  5B2J D;  1P3G B;  3AZF C;  4UUZ B;  2YFV A;  3REH C;  3R45 A;  4CAY B;  3LZ1 C;  4R8P A;  5AV9 B;  4JJN C;  4XUJ B;  2FJ7 C;  5B40 A;  2IO5 B;  3KUY B;  1KX5 A;  5B1M C;  3AV1 C;  2Y2K A;  4R8P D;  5CPI C;  2Y2G A;  5B40 D;  4XZQ D;  1KX5 D;  3TU4 A;  2ZY2 A;  2Y2O A;  5B32 B;  5B24 C;  5CP6 A;  1KX4 B;  3TU4 D;  5B1L A;  2PYO B;  3WKJ B;  1U35 B;  5AVB A;  4Z2M G;  3AZJ A;  5CP6 D;  2JE5 A;  3KWQ C;  4Z5T A;  3AN2 A;  3WA9 D;  1M19 A;  1BH8 A;  3KXB A;  5B1L D;  1P34 B;  5AVB D;  3LJA B;  3AZJ D;  3X1V A;  5B0Z C;  3FDD A;  4Z5T D;  5AVC D;  3AN2 D;  1M19 D;  3KXB D;  4XUJ C;  4WNN B;  3AZH A;  2IO5 C;  3KUY C;  3X1V D;  5B33 B;  4WZS B;  1KX3 A;  2Y2L A;  4YS3 A;  4E44 A;  3X1T D;  3AZL A;  3AZH D;  4J8W B;  3MGP B;  4YS3 D;  3AZI B;  5JRG A;  5B32 C;  1P3B A;  4H9N A;  3AZL D;  1ZLA B;  1KX4 C;  1T3U A;  1B6W A;  2PYO C;  4J8V C;  4LD9 B;  5JRG D;  1P3B D;  3WKJ C;  3VH5 T;  3WTP B;  1P34 C;  2FJ7 A;  3LJA C;  4JJN D;  2FJ7 D;  3AZE A;  3MNN B;  3C1C A;  1AOI C;  5F99 A;  2ZM5 A;  4CSR A;  3AZE D;  3C1C D;  2Y2Q A;  1ZLA C;  2CV5 A;  1M1A C;  4H9P B;  5DNM A;  2ARO B;  4LD9 C;  4Z66 B;  1P3L B;  3KWQ D;  3AZG A;  5B0Z A;  3VH5 A;  1JFI B;  5AV5 A;  3WTP C;  4WU8 A;  3H0L C;  3LZ0 B;  3A6N A;  3AZG D;  5B0Z D;  1A7W A;  4G91 C;  4WU8 D;  3MGQ B;  3A6N D;  4KGC A;  3MNN C;  3B6F A;  3AZN B;  3AZM A;  5BT1 D;  4ZUX A;  4J8V A;  5E5A A;  1P3O B;  5B2I B;  3B6F D;  4WV4 B;  3EPH A;  3H0R C;  2Y2J A;  4AWL B;  4X23 B;  1P3M A;  4ZUX D;  3MGR A;  4J8V D;  3NQJ B;  1P3K C;  5DNN C;  4KUD C;  4DRA A;  3MVD B;  3WAA C;  3REJ B;  2F8N A;  4YM6 B;  3MGR D;  2RIQ A;  1AOI A;  2F8N D;  5B31 A;  2LY8 A;  5FUG A;  5BS7 C;  1AOI D;  2Y2P A;  1M18 B;  3AZN C;  1M1A A;  5GT0 B;  5BO0 A;  3W98 B;  3W96 C;  3C1B A;  3UTB B;  3AZK B;  3AFA C;  5JA4 A;  1P3O C;  1ID3 B;  1M1A D;  5GT3 A;  1TZY C;  1TAF A;  2J8P A;  3REI A;  4X23 C;  4LD9 D;  1KX3 B;  5GT3 D;  4KHA B;  3MVD C;  3REJ C;  4E45 A;  5BNX B;  4YM6 C;  5AV6 C;  2F8N G;  1P3I A;  1ULY A;  3X1U A;  4H9N B;  3REK C;  2NZD A;  1P3I D;  5B31 G;  4NE5 A;  3X1U D;  4WU9 A;  5KDM B;  2NZD D;  2Y2H A;  4WU9 D;  2YFW B;  3UTB C;  3AZK C;  1P3K A;  1HQ3 B;  1ID3 C;  5DNN A;  1P3F C;  5B0Y A;  4KUD A;  3AYW A;  2Y2M A;  4XZQ A;  2W8S A;  2HIO B;  3WAA A;  4J8X C;  1P3K D;  4J8U A;  5DNN D;  5B0Y D;  4KUD D;  3AYW D;  3X1S B;  3WAA D;  5CPK B;  5BS7 A;  5GXQ A;  4J8U D;  5CPJ B;  5G49 A;  2CV5 B;  1BH9 A;  2UWX A;  3WA9 A;  5GSU A;  3AL0 C;  3A1I A;  5DNM B;  5GXQ D;  1P3A A;  5AVC A;  5BNV A;  1P3G C;  5GSU D;  1EQZ A;  2JSS A;  3V9R A;  5AV5 B;  1P3A D;  3P5J B;  3W96 D;  3W97 B;  3AFA D;  5AV9 C;  1EQZ D;  1HQ3 C;  3X1T A;  1TZY D;  3UT9 B;  4QLC B;  2ZY3 A;  4ZBJ B;  4M6B A;  2F2A C;  5AV6 A;  4KGC B;  2NQB B;  1S32 B;  3X1S C;  1N1J A;  5CPK C;  2FFF B;  3VH6 T;  3O62 B;  5AV6 D;  3AV2 A;  1F66 B;  2RVQ C;  3AZM B;  4H9S A;  5CPJ C;  5E5A B;  3NQU A;  4H9R B;  3AZF A;  5AY8 B;  3REH A;  3REK D;  3REL B;  3AV2 D;  1U35 C;  4H9O A;  1P3M B;  3LZ1 A;  3AZF D;  4JJN A;  3REH D;  1P3F A;  4H9Q B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...