4YS3C

Nucleosome disassembly by rsc and swi/snf is enhanced by h3 acetylation near the nucleosome dyad axis
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
107
structure length
107
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Histone Acetylation near the Nucleosome Dyad Axis Enhances Nucleosome Disassembly by RSC and SWI/SNF.
pubmed doi rcsb
source organism Xenopus laevis
total genus 30
structure length 107
sequence length 107
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-03-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4ys3C00
3MGPB 1AOIC 2NQBD 4J8VA 3W97C 5CPIB 2IO5B 1EQZC 1ID3C 5JRGB 5F99D 4KGCD 2YFWA 4KUDB 1TZYC 4Z5TC 1U35B 3REHD 3NQUB 5CPJC 3AFAA 4NE3A 3V9RA 5AV5A 5GXQA 1M1AA 5B31C 4WU9A 3X1UC 1B67A 3AZHD 1KX3A 1P3LA 4J8VB 3C1BA 3C1CA 4WNNA 4ZBJC 5AVBA 3REKD 2YFWB 4DRAA 4LD9D 4AWLB 1P34C 3W99C 1M1AB 3AFAB 5AV5B 3V9RB 5GXQB 4XUJD 3UT9D 5B32C 3B6GA 5C3IB 3WTPA 4WU9B 1M19C 5B0ZA 1P3LB 1AOID 5CPKA 3C1BB 3W97D 2BYKA 4EO5B 1KX5A 2F8NB 5DNMA 1EQZD 1ID3D 3C1CB 4WNNB 5AVBB 4J8WD 3RELC 1TZYD 5BO0A 4Z5TD 5CPJD 4JJNC 5B31D 3WTPB 5AY8C 3X1UD 1P3FA 1S32A 4WU8A 5CPKB 2AROC 3AN2A 3WTPE 2BYKB 5G49A 4H9QA 1KX5B 1F66C 3KXBC 1KX4C 5BO0B 1P34D 3W99D 3VH6A 5B32D 3X1TC 1M19D 4YM6C 3REJC 3A6NC 2F8NK 1P3AC 1P3FB 1S32B 4WU8B 3MGRC 3AN2B 5AV6A 3AZID 5G49B 4H9QB 2HUEB 5GT0A 1P3GA 3RELD 3B0BA 5GT3A 4JJND 3AZJA 3LZ0B 4G92C 5JA4A 4E44A 5AY8D 5GSUA 5B33C 1P3IC 4J8XC 5B40C 2AROD 5AV6B 1F66D 5DNNC 3KXBD 5GT0B 1P3GB 2NZDA 4KHAB 4ZUXA 4H9SC 3MGQA 3AZJB 4G91B 5JA4B 3X1TD 3W98A 4YM6D 3REJD 3A6ND 5GSUB 1P3AD 3WAAA 1P3BC 3MGRD 2HIOA 5CP6C 5AV8A 3LJAC 5AVCC 3AV2C 4KGCC 2NZDB 5CHLB 2BYMA 3UTBC 3AYWA 3AZGC 4X23C 4H9NB 3LZ1D 3MGQB 5F99B 3B6FC 3W98B 3O62A 3KWQC 3REHB 5B33D 2PYOA 3MVDC 3UTAC 4J8XD 3WAAB 3UT9A 5B40D 2HIOB 5CPIA 4XZQA 5AV8B 5DNND 5BT1C 3REKC 2BYMB 3W97A 5B1LC 3AYWB 2CV5C 3REIA 2F8NG 1U35A 1EQZA 4HGAB 5B1MC 3AZNA 3TU4C 3VH6W 3O62B 5B2IC 2PYOB 3UT9B 3AZKC 1P3BD 1F1EA 5BNXA 4XZQB 5CP6D 3LJAD 5AVCD 3AZLC 3AV2D 3WA9C 3W97B 4J8WC 4H9OA 3UTBD 4Z66A 3AV1A 3REIB 4X23D 3AZGD 1EQZB 1P3MA 1P3KA 5B24C 3LELA 3B6FD 3AZNB 3KWQD 1HTAA 3MGPC 3MVDD 3UTAD 1P3OC 1M19A 5BNXB 2F8NA 1TAFA 3MGSC 5BT1D 5JRGC 1WWIA 5B1LD 3AV1B 4H9OB 4Z66B 2CV5D 4E45A 1WWSA 5BS7C 3WKJA 1P3MB 1P3KB 3LELB 5B1MD 3TU4D 3RELA 1ZLAA 5B2ID 4JJNA 3AZKD 5E5AA 4J8VC 1M19B 4R8PA 3AZIC 1TAFB 5AY8A 3B0DC 3AZLD 5BNVA 3WA9D 5B2JD 3VH6T 3WKJB 1JFIB 2JSSA 1BH8A 1M1AC 3AFAC 5AV5C 5GXQC 5B24D 1P3PA 1KX4A 5C3IC 3RELB 1ZLAB 3MGPD 4JJNB 1KX3C 2FJ7A 2F8NH 1P3LC 5E5AB 1P3OD 4YM6A 4R8PB 5AY8B 1P3AA 5BNVB 1ULYA 3MGSD 3C1CC 2AROB 5JRGD 5AVBC 3W96A 5B0YA 4NFTA 1BH8B 3X1SA 3KXBB 3AZMA 1P3PB 3B6GC 1KX4B 3LZ0A 1BFMA 3AZFC 3AZEA 5B0ZC 2FJ7B 5FUGA 4J8VD 4YM6B 5AV9C 3REJB 1P3AB 5B33A 5DNMC 1P3IA 3KUYA 5B0YB 3W96B 4KHAA 3LZ1C 3X1SB 1M1AD 3AFAD 4QLCA 5AV5D 5GXQD 3AZMB 3AZEB 1N1JA 2RVQC 1HQ3A 1KX3D 1P3FC 1P3LD 5FUGB 4WU8C 1S32C 3AN2C 3MNNC 1M18A 5B33B 1P3IB 2HUEC 2NQBA 1P3BA 3C1CD 3KUYB 5AVBD 5CP6A 3X1VC 5DNNB 4H9NA 4QLCB 4KGCA 5F99A 3B6GD 3UTBA 3AZFD 1N1JB 3AZGA 4YS3C 1HQ3B 4X23A 5B0ZD 3REHA 4H9PB 5AV6C 5AV9D 4Z2MH 1M18B 3AZHA 5DNMD 2NQBB 5GT0C 1P3BB 1P3GC 5CP6B 3LJAB 3AV2B 5GT3C 4KGCB 3REKA 3UTBB 4LD9A 3AZGB 2RVQD 4X23B 1P3FD 3VH5W 4XUJA 1S32D 4WU8D 4NE5A 3AN2D 3B0CW 3MNND 5B2IA 3AZHB 1AOIA 3R45A 5B32G 2NZDC 3X1VD 3AZLA 1ID3A 4ZUXC 3MGQC 3REKB 4J8UC 3NQJA 4DRBA 4J8WA 1TZYA 3W98C 4LD9B 4YS3D 4Z5TA 2LY8A 5CPJA 3WAAC 4XUJB 5B24A 5B31A 1B6WA 5B1MB 2HIOC 5AV6D 5AV8C 3X1UA 5B2IB 1H3OA 1AOIB 3R45B 5B2JC 5GT0D 1P3GD 1P3OA 3AYWC 3AZLB 5GT3D 1ID3B 3MGSA 3AZJD 4HGAC 3NQJB 4J8WB 1Q9CA 1TZYB 3O62C 1P34A 3W99A 4UUZA 4Z5TB 5CPJB 4CSRA 5GSUD 2PYOC 5B24B 5B31B 5B32A 2YFVA 4WV4B 5CPIC 4XZQC 2IO5C 3X1UB 1H3OB 1P3OB 2NZDD 4KUDC 3AZIA 3REIC 1JFIA 1U35C 3VH5T 4ZUXD 3MGSB 4ZBJB 3MGQD 4J8UD 3AZNC 3B0CT 3W98D 1P34B 3W99B 4UUZB 4CSRB 3WAAD 5B32B 2YFVB 2HIOD 5AV8D 2AROA 3AV1C 3AZIB 4Z66C 4AWLC 3AYWD 3B0DB 1F66A 3KXBA 1P3MC 1P3KC 3LELC 4Z2MG 4WU9C 3O62D 3VH5A 2PYOD 3X1TA 3AZFA 3C1BC 3REJA 4XZQD 3A6NA 5CPID 4EO5C 2L5AA 1KX3B 3MGRA 5AV9A 4KUDD 1F66B 3WKJC 3REID 1U35D 3WTPC 3AZND 1ZLAC 3LZ1A 3B6GB 5E5AC 3X1TB 5CPKC 3AZFB 3A6NB 4R8PC 4NE6A 1KX5C 5B0ZB 2CWEA 4J8XA 3MGRB 5B40A 5AV9B 3MNNA 3AV1D 4Z66D 5DNNA 5DNMB 1P3MD 1BH9A 1P3KD 1P3PC 3LELD 4WU9D 3X1VA 3LZ1B 2FJ7C 4H9PA 4H9SA 5KDMA 4G92B 3C1BD 3KSYA 4YS3A 2F8ND 4J8XB 1KU5A 5B40B 4H9RA 3MNNB 3W96C 5B0YC 3LJAA 3WKJD 5AVCA 3AV2A 4M6BA 3X1SC 1BH9B 3AZMC 3WTPD 3LZ0C 1ZLAD 3X1VB 3AZEC 5KDMB 3B6FA 5E5AD 5CPKD 4R8PD 4YS3B 1KX5D 4WZSB 3KWQA 3MVDA 3UTAA 5B31G 4H9RB 3KUYC 5AVCB 4QLCC 1P3PD 3AZJC 5B1LA 1KX4D 4G91C 2CV5A 1HQ3C 5GT3B 5GSUC 2FJ7D 3B6FB 5B1MA 4J8UA 3TU4A 3KWQB 1M18C 3MVDB 3UTAB 2NQBC 3AZKA 1A7WA 5B0YD 3W96D 3X1SD 3WA9A 5B2JA 3AZMD 5F99C 5B1LB 3LZ0D 2CV5B 3AZED 3REHC 4ZUXB 4CAYA 4J8UB 3TU4B 3MGPA 3AZHC 1P3ID 3AZKB 3KUYD 3WA9B 5B2JB 4QLCD 5JRGA 4LD9C 4KUDA 5BS7A 1HQ3D 3NQUA 4XUJC 3UT9C 4CAYB 1R4VA 1M18D
chains in the Genus database with same CATH superfamily
3MGPB 1AOIC 2NQBD 4J8VA 3W97C 5CPIB 2IO5B 1EQZC 1ID3C 5JRGB 5F99D 4DQYB 4KGCD 2YFWA 4KUDB 1TZYC 4Z5TC 1U35B 3REHD 3NQUB 5CPJC 3AFAA 4NE3A 3V9RA 5AV5A 5GXQA 1M1AA 5B31C 4WU9A 3X1UC 2Y2QA 1B67A 3AZHD 1KX3A 3F6TA 1P3LA 4J8VB 3C1BA 3C1CA 4WNNA 4ZBJC 5AVBA 3REKD 2YFWB 4DRAA 4LD9D 4AWLB 1P34C 3W99C 1M1AB 3AFAB 5AV5B 3V9RB 5GXQB 4XUJD 3UT9D 5B32C 3B6GA 5C3IB 3WTPA 4WU9B 1M19C 5B0ZA 1P3LB 1AOID 5CPKA 3C1BB 3W97D 2BYKA 4EO5B 1KX5A 2F8NB 5DNMA 1EQZD 1ID3D 3C1CB 4WNNB 5AVBB 4J8WD 3RELC 1TZYD 5BO0A 2Y2OA 4Z5TD 5CPJD 4JJNC 2Y2PA 5B31D 3WTPB 2RIQA 5AY8C 3X1UD 1P3FA 1S32A 4WU8A 5CPKB 2AROC 3AN2A 3WTPE 2BYKB 2JCHA 4H9QA 5G49A 1KX5B 1F66C 3KXBC 1KX4C 5BO0B 1P34D 3W99D 3VH6A 5B32D 3X1TC 1M19D 4YM6C 3REJC 3A6NC 2F8NK 1P3AC 1P3FB 1S32B 4WU8B 3MGRC 3AN2B 5AV6A 3AZID 5G49B 4H9QB 2HUEB 5GT0A 1P3GA 3RELD 3B0BA 5GT3A 4JJND 3AZJA 3LZ0B 4G92C 5JA4A 4E44A 2XD1A 5AY8D 5GSUA 5B33C 1P3IC 4J8XC 5B40C 2AROD 5AV6B 1F66D 5DNNC 3KXBD 5GT0B 1P3GB 2NZDA 4KHAB 2ZM5A 2G5IC 4H9SC 4ZUXA 3MGQA 3AZJB 4G91B 5JA4B 3A1IA 3X1TD 4YM6D 3EPLA 3A6ND 3REJD 3W98A 5GSUB 1P3AD 3WAAA 1P3BC 3MGRD 2HIOA 5CP6C 5AV8A 3LJAC 5AVCC 3AV2C 2DQNC 4KGCC 2NZDB 5CHLB 2BYMA 2VQRA 3UTBC 3AYWA 2Y2JA 3AZGC 4X23C 4H9NB 3LZ1D 2F2AC 3MGQB 5F99B 3B6FC 3W98B 3O62A 3KWQC 3REHB 5B33D 2PYOA 3MVDC 3UTAC 4J8XD 3WAAB 3UT9A 5B40D 2HIOB 5CPIA 4XZQA 5AV8B 1W2EA 5DNND 5BT1C 3REKC 2FFFB 2BYMB 3W97A 5B1LC 3AYWB 2CV5C 3REIA 3IP4C 2F8NG 1U35A 1EQZA 4HGAB 5B1MC 3AZNA 3TU4C 2Y2MA 3VH6W 3O62B 5B2IC 2PYOB 3UT9B 3AZKC 1P3BD 1F1EA 5BNXA 4XZQB 5CP6D 3LJAD 5AVCD 3AZLC 3AV2D 3WA9C 3W97B 4J8WC 4H9OA 3UTBD 4Z66A 3AV1A 3REIB 4X23D 3AZGD 1EQZB 1P3MA 4UPKA 1P3KA 5B24C 3LELA 3B6FD 3AZNB 3KWQD 1HTAA 3MGPC 3MVDD 3UTAD 1P3OC 1M19A 5BNXB 2F8NA 1TAFA 1T3UA 3MGSC 5BT1D 5JRGC 1WWIA 5B1LD 3AV1B 4H9OB 4Z66B 2CV5D 4E45A 1WWSA 5BS7C 3WKJA 1P3MB 1P3KB 3LELB 5B1MD 3TU4D 3RELA 1ZLAA 5B2ID 4JJNA 1Z2CB 3AZKD 5E5AA 4J8VC 1M19B 2G5HC 4R8PA 3AZIC 1TAFB 5AY8A 3B0DC 3AZLD 5BNVA 3WA9D 5B2JD 3VH6T 4WJ3C 3WKJB 1JFIB 2JSSA 1BH8A 1M1AC 3AFAC 5AV5C 5GXQC 5B24D 1P3PA 1KX4A 5C3IC 3RELB 1ZLAB 2Y2GA 2Y2LA 3MGPD 4JJNB 1KX3C 2F8NH 2FJ7A 1P3LC 5E5AB 1P3OD 4YM6A 4R8PB 5AY8B 1P3AA 5BNVB 1ULYA 3MGSD 3C1CC 2AROB 5JRGD 5AVBC 3W96A 5B0YA 4NFTA 1BH8B 3X1SA 3KXBB 3AZMA 3A1KA 1P3PB 3B6GC 1KX4B 3LZ0A 1BFMA 1PZRA 3AZFC 3AZEA 5B0ZC 2FJ7B 5FUGA 4J8VD 4YM6B 5AV9C 3REJB 1P3AB 5B33A 5DNMC 1P3IA 3KUYA 5B0YB 3W96B 4KHAA 3LZ1C 3X1SB 1M1AD 3AFAD 4QLCA 5AV5D 5GXQD 3AZMB 3AZEB 1N1JA 2RVQC 1HQ3A 1KX3D 1P3FC 1P3LD 5FUGB 4WU8C 1S32C 3EPHA 3AN2C 3MNNC 1M18A 5B33B 1P3IB 2HUEC 2NQBA 1P3BA 3C1CD 3KUYB 5AVBD 5CP6A 3X1VC 5DNNB 4H9NA 4QLCB 4KGCA 5F99A 3B6GD 3UTBA 3AZFD 1N1JB 3AZGA 4YS3C 1HQ3B 4X23A 5B0ZD 3REHA 2XD5A 4H9PB 5AV6C 5AV9D 4Z2MH 3EPJA 1M18B 3AZHA 5DNMD 2NQBB 5GT0C 1P3BB 1P3GC 5CP6B 3LJAB 3AV2B 5GT3C 4KGCB 3REKA 3UTBB 4LD9A 3AZGB 2RVQD 4X23B 1P3FD 3VH5W 4XUJA 1S32D 4WU8D 4NE5A 3AN2D 2J8PA 3B0CW 3MNND 5B2IA 3AZHB 1AOIA 3R45A 5B32G 2NZDC 3X1VD 3KFUG 3AZLA 1ID3A 4ZUXC 3MGQC 3EPKA 3REKB 2Y2HA 4J8UC 3NQJA 4DRBA 4J8WA 1TZYA 3W98C 2ZY4A 4LD9B 4YS3D 4Z5TA 2LY8A 5CPJA 3WAAC 4XUJB 5B24A 5B31A 1B6WA 5B1MB 2HIOC 3H0MC 5AV6D 5AV8C 3X1UA 5B2IB 1H3OA 1AOIB 3R45B 5B2JC 5GT0D 1P3GD 1P3OA 3AYWC 3AZLB 5GT3D 1ID3B 3MGSA 2UWXA 3AZJD 4HGAC 3NQJB 3P5JB 4J8WB 1Q9CA 1TZYB 3O62C 1P34A 3W99A 4UUZA 4Z5TB 5CPJB 4CSRA 5GSUD 2PYOC 5B24B 5B31B 5B32A 2YFVA 4WV4B 5CPIC 4XZQC 2IO5C 3X1UB 1H3OB 1P3OB 2NZDD 4KUDC 3AZIA 3REIC 1JFIA 1U35C 3VH5T 4ZUXD 3MGSB 4ZBJB 3MGQD 4J8UD 3AZNC 3B0CT 3W98D 1P34B 3W99B 4UUZB 2Y2IA 4CSRB 3WAAD 5B32B 2YFVB 2HIOD 5AV8D 3EG5B 2AROA 2W8SA 3AV1C 3AZIB 4Z66C 4AWLC 3AYWD 3B0DB 1F66A 3KXBA 1P3MC 1P3KC 2Y2KA 3LELC 4Z2MG 4WU9C 2ZY5A 3O62D 2JE5A 3VH5A 2PYOD 3AL0C 3X1TA 3AZFA 3C1BC 3REJA 4XZQD 3A6NA 5CPID 4EO5C 2L5AA 1KX3B 3H0RC 3MGRA 5AV9A 4KUDD 1F66B 3WKJC 3REID 1U35D 3WTPC 3AZND 1ZLAC 3LZ1A 3B6GB 5E5AC 3X1TB 5CPKC 3AZFB 3A6NB 4R8PC 4NE6A 1KX5C 5B0ZB 2CWEA 4J8XA 3MGRB 5B40A 2BG1A 5AV9B 3MNNA 3AV1D 4Z66D 5DNNA 5DNMB 1P3MD 1BH9A 2ZY2A 1P3KD 1P3PC 3LELD 4WU9D 3X1VA 3LZ1B 2FJ7C 4H9PA 4H9SA 5KDMA 4G92B 3C1BD 3KSYA 4YS3A 2F8ND 2DF4C 4J8XB 1KU5A 5B40B 3H0LC 4H9RA 3W96C 5B0YC 3MNNB 3LJAA 3WKJD 5AVCA 3AV2A 4M6BA 3X1SC 1BH9B 3AZMC 3WTPD 3LZ0C 1ZLAD 3X1VB 3AZEC 5KDMB 3B6FA 5E5AD 5CPKD 4R8PD 4YS3B 1KX5D 4WZSB 3KWQA 3MVDA 3UTAA 5B31G 4H9RB 3KUYC 5AVCB 2Y2NA 4QLCC 1P3PD 3AZJC 5B1LA 1KX4D 4G91C 2ZY3A 2CV5A 1HQ3C 5GT3B 5GSUC 2FJ7D 3B6FB 5B1MA 4J8UA 3TU4A 3KWQB 1M18C 3MVDB 3UTAB 2NQBC 3AZKA 1A7WA 5B0YD 3W96D 3FDDA 3X1SD 3WA9A 5B2JA 3AZMD 5F99C 5B1LB 3LZ0D 2CV5B 3AZED 3REHC 4ZUXB 4CAYA 4J8UB 3TU4B 3MGPA 3AZHC 1P3ID 3AZKB 3KUYD 3WA9B 5B2JB 4QLCD 5JRGA 4LD9C 4KUDA 5BS7A 1HQ3D 3NQUA 4XUJC 3UT9C 4CAYB 1R4VA 1M18D
chains in the Genus database with same CATH topology
3MGPB 1AOIC 2NQBD 4J8VA 3W97C 5CPIB 2IO5B 1EQZC 1ID3C 5JRGB 5F99D 4DQYB 4KGCD 2YFWA 4KUDB 1TZYC 4Z5TC 1U35B 3REHD 3NQUB 5CPJC 3AFAA 4NE3A 3V9RA 5AV5A 5GXQA 1M1AA 5B31C 4WU9A 3X1UC 2Y2QA 1B67A 3AZHD 1KX3A 3F6TA 1P3LA 4J8VB 3C1BA 3C1CA 4WNNA 4ZBJC 5AVBA 3REKD 2YFWB 4DRAA 4LD9D 4AWLB 1P34C 3W99C 1M1AB 3AFAB 5AV5B 3V9RB 5GXQB 4XUJD 3UT9D 5B32C 3B6GA 5C3IB 3WTPA 4WU9B 1M19C 5B0ZA 1P3LB 1AOID 5CPKA 3C1BB 3W97D 2BYKA 4EO5B 1KX5A 2F8NB 5DNMA 1EQZD 1ID3D 3C1CB 4WNNB 5AVBB 4J8WD 3RELC 1TZYD 5BO0A 2Y2OA 4Z5TD 5CPJD 4JJNC 2Y2PA 5B31D 3WTPB 2RIQA 5AY8C 3X1UD 1P3FA 1S32A 4WU8A 5CPKB 2AROC 3AN2A 3WTPE 2BYKB 2JCHA 4H9QA 5G49A 1KX5B 1F66C 3KXBC 1KX4C 5BO0B 1P34D 3W99D 3VH6A 5B32D 3X1TC 1M19D 4YM6C 3REJC 3A6NC 2F8NK 1P3AC 1P3FB 1S32B 4WU8B 3MGRC 3AN2B 5AV6A 3AZID 5G49B 4H9QB 2HUEB 5GT0A 1P3GA 3RELD 3B0BA 5GT3A 4JJND 3AZJA 3LZ0B 4G92C 5JA4A 4E44A 2XD1A 5AY8D 5GSUA 5B33C 1P3IC 4J8XC 5B40C 2AROD 5AV6B 1F66D 5DNNC 3KXBD 5GT0B 1P3GB 2NZDA 4KHAB 2ZM5A 2G5IC 4H9SC 4ZUXA 3MGQA 3AZJB 4G91B 5JA4B 3A1IA 3X1TD 4YM6D 3EPLA 3A6ND 3REJD 3W98A 5GSUB 1P3AD 3WAAA 1P3BC 3MGRD 2HIOA 5CP6C 5AV8A 3LJAC 5AVCC 3AV2C 2DQNC 4KGCC 2NZDB 5CHLB 2BYMA 2VQRA 3UTBC 3AYWA 2Y2JA 3AZGC 4X23C 4H9NB 3LZ1D 2F2AC 3MGQB 5F99B 3B6FC 3W98B 3O62A 3KWQC 3REHB 5B33D 2PYOA 3MVDC 3UTAC 4J8XD 3WAAB 3UT9A 5B40D 2HIOB 5CPIA 4XZQA 5AV8B 1W2EA 5DNND 5BT1C 3REKC 2FFFB 2BYMB 3W97A 5B1LC 3AYWB 2CV5C 3REIA 3IP4C 2F8NG 1U35A 1EQZA 4HGAB 5B1MC 3AZNA 3TU4C 2Y2MA 3VH6W 3O62B 5B2IC 2PYOB 3UT9B 3AZKC 1P3BD 1F1EA 5BNXA 4XZQB 5CP6D 3LJAD 5AVCD 3AZLC 3AV2D 3WA9C 3W97B 4J8WC 4H9OA 3UTBD 4Z66A 3AV1A 3REIB 4X23D 3AZGD 1EQZB 1P3MA 4UPKA 1P3KA 5B24C 3LELA 3B6FD 3AZNB 3KWQD 1HTAA 3MGPC 3MVDD 3UTAD 1P3OC 1M19A 5BNXB 2F8NA 1TAFA 1T3UA 3MGSC 5BT1D 5JRGC 1WWIA 5B1LD 3AV1B 4H9OB 4Z66B 2CV5D 4E45A 1WWSA 5BS7C 3WKJA 1P3MB 1P3KB 3LELB 5B1MD 3TU4D 3RELA 1ZLAA 5B2ID 4JJNA 1Z2CB 3AZKD 5E5AA 4J8VC 1M19B 2G5HC 4R8PA 3AZIC 1TAFB 5AY8A 3B0DC 3AZLD 5BNVA 3WA9D 5B2JD 3VH6T 4WJ3C 3WKJB 1JFIB 2JSSA 1BH8A 1M1AC 3AFAC 5AV5C 5GXQC 5B24D 1P3PA 1KX4A 5C3IC 3RELB 1ZLAB 2Y2GA 2Y2LA 3MGPD 4JJNB 1KX3C 2F8NH 2FJ7A 1P3LC 5E5AB 1P3OD 4YM6A 4R8PB 5AY8B 1P3AA 5BNVB 1ULYA 3MGSD 3C1CC 2AROB 5JRGD 5AVBC 3W96A 5B0YA 4NFTA 1BH8B 3X1SA 3KXBB 3AZMA 3A1KA 1P3PB 3B6GC 1KX4B 3LZ0A 1BFMA 1PZRA 3AZFC 3AZEA 5B0ZC 2FJ7B 5FUGA 4J8VD 4YM6B 5AV9C 3REJB 1P3AB 5B33A 5DNMC 1P3IA 3KUYA 5B0YB 3W96B 4KHAA 3LZ1C 3X1SB 1M1AD 3AFAD 4QLCA 5AV5D 5GXQD 3AZMB 3AZEB 1N1JA 2RVQC 1HQ3A 1KX3D 1P3FC 1P3LD 5FUGB 4WU8C 1S32C 3EPHA 3AN2C 3MNNC 1M18A 5B33B 1P3IB 2HUEC 2NQBA 1P3BA 3C1CD 3KUYB 5AVBD 5CP6A 3X1VC 5DNNB 4H9NA 4QLCB 4KGCA 5F99A 3B6GD 3UTBA 3AZFD 1N1JB 3AZGA 4YS3C 1HQ3B 4X23A 5B0ZD 3REHA 2XD5A 4H9PB 5AV6C 5AV9D 4Z2MH 3EPJA 1M18B 3AZHA 5DNMD 2NQBB 5GT0C 1P3BB 1P3GC 5CP6B 3LJAB 3AV2B 5GT3C 4KGCB 3REKA 3UTBB 4LD9A 3AZGB 2RVQD 4X23B 1P3FD 3VH5W 4XUJA 1S32D 4WU8D 4NE5A 3AN2D 2J8PA 3B0CW 3MNND 5B2IA 3AZHB 1AOIA 3R45A 5B32G 2NZDC 3X1VD 3KFUG 3AZLA 1ID3A 4ZUXC 3MGQC 3EPKA 3REKB 2Y2HA 4J8UC 3NQJA 4DRBA 4J8WA 1TZYA 3W98C 2ZY4A 4LD9B 4YS3D 4Z5TA 2LY8A 5CPJA 3WAAC 4XUJB 5B24A 5B31A 1B6WA 5B1MB 2HIOC 3H0MC 5AV6D 5AV8C 3X1UA 5B2IB 1H3OA 1AOIB 3R45B 5B2JC 5GT0D 1P3GD 1P3OA 3AYWC 3AZLB 5GT3D 1ID3B 3MGSA 2UWXA 3AZJD 4HGAC 3NQJB 3P5JB 4J8WB 1Q9CA 1TZYB 3O62C 1P34A 3W99A 4UUZA 4Z5TB 5CPJB 4CSRA 5GSUD 2PYOC 5B24B 5B31B 5B32A 2YFVA 4WV4B 5CPIC 4XZQC 2IO5C 3X1UB 1H3OB 1P3OB 2NZDD 4KUDC 3AZIA 3REIC 1JFIA 1U35C 3VH5T 4ZUXD 3MGSB 4ZBJB 3MGQD 4J8UD 3AZNC 3B0CT 3W98D 1P34B 3W99B 4UUZB 2Y2IA 4CSRB 3WAAD 5B32B 2YFVB 2HIOD 5AV8D 3EG5B 2AROA 2W8SA 3AV1C 3AZIB 4Z66C 4AWLC 3AYWD 3B0DB 1F66A 3KXBA 1P3MC 1P3KC 2Y2KA 3LELC 4Z2MG 4WU9C 2ZY5A 3O62D 2JE5A 3VH5A 2PYOD 3AL0C 3X1TA 3AZFA 3C1BC 3REJA 4XZQD 3A6NA 5CPID 4EO5C 2L5AA 1KX3B 3H0RC 3MGRA 5AV9A 4KUDD 1F66B 3WKJC 3REID 1U35D 3WTPC 3AZND 1ZLAC 3LZ1A 3B6GB 5E5AC 3X1TB 5CPKC 3AZFB 3A6NB 4R8PC 4NE6A 1KX5C 5B0ZB 2CWEA 4J8XA 3MGRB 5B40A 2BG1A 5AV9B 3MNNA 3AV1D 4Z66D 5DNNA 5DNMB 1P3MD 1BH9A 2ZY2A 1P3KD 1P3PC 3LELD 4WU9D 3X1VA 3LZ1B 2FJ7C 4H9PA 4H9SA 5KDMA 4G92B 3C1BD 3KSYA 4YS3A 2F8ND 2DF4C 4J8XB 1KU5A 5B40B 3H0LC 4H9RA 3W96C 5B0YC 3MNNB 3LJAA 3WKJD 5AVCA 3AV2A 4M6BA 3X1SC 1BH9B 3AZMC 3WTPD 3LZ0C 1ZLAD 3X1VB 3AZEC 5KDMB 3B6FA 5E5AD 5CPKD 4R8PD 4YS3B 1KX5D 4WZSB 3KWQA 3MVDA 3UTAA 5B31G 4H9RB 3KUYC 5AVCB 2Y2NA 4QLCC 1P3PD 3AZJC 5B1LA 1KX4D 4G91C 2ZY3A 2CV5A 1HQ3C 5GT3B 5GSUC 2FJ7D 3B6FB 5B1MA 4J8UA 3TU4A 3KWQB 1M18C 3MVDB 3UTAB 2NQBC 3AZKA 1A7WA 5B0YD 3W96D 3FDDA 3X1SD 3WA9A 5B2JA 3AZMD 5F99C 5B1LB 3LZ0D 2CV5B 3AZED 3REHC 4ZUXB 4CAYA 4J8UB 3TU4B 3MGPA 3AZHC 1P3ID 3AZKB 3KUYD 3WA9B 5B2JB 4QLCD 5JRGA 4LD9C 4KUDA 5BS7A 1HQ3D 3NQUA 4XUJC 3UT9C 4CAYB 1R4VA 1M18D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MGP B;  1AOI C;  2NQB D;  4J8V A;  3W97 C;  5CPI B;  2IO5 B;  1EQZ C;  1ID3 C;  5JRG B;  5F99 D;  4KGC D;  2YFW A;  4KUD B;  1TZY C;  4Z5T C;  1U35 B;  3REH D;  3NQU B;  5CPJ C;  3AFA A;  4NE3 A;  3V9R A;  5AV5 A;  5GXQ A;  1M1A A;  5B31 C;  4WU9 A;  3X1U C;  1B67 A;  3AZH D;  1KX3 A;  1P3L A;  4J8V B;  3C1B A;  3C1C A;  4WNN A;  4ZBJ C;  5AVB A;  3REK D;  2YFW B;  4DRA A;  4LD9 D;  4AWL B;  1P34 C;  3W99 C;  1M1A B;  3AFA B;  5AV5 B;  3V9R B;  5GXQ B;  4XUJ D;  3UT9 D;  5B32 C;  3B6G A;  5C3I B;  3WTP A;  4WU9 B;  1M19 C;  5B0Z A;  1P3L B;  1AOI D;  5CPK A;  3C1B B;  3W97 D;  2BYK A;  4EO5 B;  1KX5 A;  2F8N B;  5DNM A;  1EQZ D;  1ID3 D;  3C1C B;  4WNN B;  5AVB B;  4J8W D;  3REL C;  1TZY D;  5BO0 A;  4Z5T D;  5CPJ D;  4JJN C;  5B31 D;  3WTP B;  5AY8 C;  3X1U D;  1P3F A;  1S32 A;  4WU8 A;  5CPK B;  2ARO C;  3AN2 A;  3WTP E;  2BYK B;  5G49 A;  4H9Q A;  1KX5 B;  1F66 C;  3KXB C;  1KX4 C;  5BO0 B;  1P34 D;  3W99 D;  3VH6 A;  5B32 D;  3X1T C;  1M19 D;  4YM6 C;  3REJ C;  3A6N C;  2F8N K;  1P3A C;  1P3F B;  1S32 B;  4WU8 B;  3MGR C;  3AN2 B;  5AV6 A;  3AZI D;  5G49 B;  4H9Q B;  2HUE B;  5GT0 A;  1P3G A;  3REL D;  3B0B A;  5GT3 A;  4JJN D;  3AZJ A;  3LZ0 B;  4G92 C;  5JA4 A;  4E44 A;  5AY8 D;  5GSU A;  5B33 C;  1P3I C;  4J8X C;  5B40 C;  2ARO D;  5AV6 B;  1F66 D;  5DNN C;  3KXB D;  5GT0 B;  1P3G B;  2NZD A;  4KHA B;  4ZUX A;  4H9S C;  3MGQ A;  3AZJ B;  4G91 B;  5JA4 B;  3X1T D;  3W98 A;  4YM6 D;  3REJ D;  3A6N D;  5GSU B;  1P3A D;  3WAA A;  1P3B C;  3MGR D;  2HIO A;  5CP6 C;  5AV8 A;  3LJA C;  5AVC C;  3AV2 C;  4KGC C;  2NZD B;  5CHL B;  2BYM A;  3UTB C;  3AYW A;  3AZG C;  4X23 C;  4H9N B;  3LZ1 D;  3MGQ B;  5F99 B;  3B6F C;  3W98 B;  3O62 A;  3KWQ C;  3REH B;  5B33 D;  2PYO A;  3MVD C;  3UTA C;  4J8X D;  3WAA B;  3UT9 A;  5B40 D;  2HIO B;  5CPI A;  4XZQ A;  5AV8 B;  5DNN D;  5BT1 C;  3REK C;  2BYM B;  3W97 A;  5B1L C;  3AYW B;  2CV5 C;  3REI A;  2F8N G;  1U35 A;  1EQZ A;  4HGA B;  5B1M C;  3AZN A;  3TU4 C;  3VH6 W;  3O62 B;  5B2I C;  2PYO B;  3UT9 B;  3AZK C;  1P3B D;  1F1E A;  5BNX A;  4XZQ B;  5CP6 D;  3LJA D;  5AVC D;  3AZL C;  3AV2 D;  3WA9 C;  3W97 B;  4J8W C;  4H9O A;  3UTB D;  4Z66 A;  3AV1 A;  3REI B;  4X23 D;  3AZG D;  1EQZ B;  1P3M A;  1P3K A;  5B24 C;  3LEL A;  3B6F D;  3AZN B;  3KWQ D;  1HTA A;  3MGP C;  3MVD D;  3UTA D;  1P3O C;  1M19 A;  5BNX B;  2F8N A;  1TAF A;  3MGS C;  5BT1 D;  5JRG C;  1WWI A;  5B1L D;  3AV1 B;  4H9O B;  4Z66 B;  2CV5 D;  4E45 A;  1WWS A;  5BS7 C;  3WKJ A;  1P3M B;  1P3K B;  3LEL B;  5B1M D;  3TU4 D;  3REL A;  1ZLA A;  5B2I D;  4JJN A;  3AZK D;  5E5A A;  4J8V C;  1M19 B;  4R8P A;  3AZI C;  1TAF B;  5AY8 A;  3B0D C;  3AZL D;  5BNV A;  3WA9 D;  5B2J D;  3VH6 T;  3WKJ B;  1JFI B;  2JSS A;  1BH8 A;  1M1A C;  3AFA C;  5AV5 C;  5GXQ C;  5B24 D;  1P3P A;  1KX4 A;  5C3I C;  3REL B;  1ZLA B;  3MGP D;  4JJN B;  1KX3 C;  2FJ7 A;  2F8N H;  1P3L C;  5E5A B;  1P3O D;  4YM6 A;  4R8P B;  5AY8 B;  1P3A A;  5BNV B;  1ULY A;  3MGS D;  3C1C C;  2ARO B;  5JRG D;  5AVB C;  3W96 A;  5B0Y A;  4NFT A;  1BH8 B;  3X1S A;  3KXB B;  3AZM A;  1P3P B;  3B6G C;  1KX4 B;  3LZ0 A;  1BFM A;  3AZF C;  3AZE A;  5B0Z C;  2FJ7 B;  5FUG A;  4J8V D;  4YM6 B;  5AV9 C;  3REJ B;  1P3A B;  5B33 A;  5DNM C;  1P3I A;  3KUY A;  5B0Y B;  3W96 B;  4KHA A;  3LZ1 C;  3X1S B;  1M1A D;  3AFA D;  4QLC A;  5AV5 D;  5GXQ D;  3AZM B;  3AZE B;  1N1J A;  2RVQ C;  1HQ3 A;  1KX3 D;  1P3F C;  1P3L D;  5FUG B;  4WU8 C;  1S32 C;  3AN2 C;  3MNN C;  1M18 A;  5B33 B;  1P3I B;  2HUE C;  2NQB A;  1P3B A;  3C1C D;  3KUY B;  5AVB D;  5CP6 A;  3X1V C;  5DNN B;  4H9N A;  4QLC B;  4KGC A;  5F99 A;  3B6G D;  3UTB A;  3AZF D;  1N1J B;  3AZG A;  4YS3 C;  1HQ3 B;  4X23 A;  5B0Z D;  3REH A;  4H9P B;  5AV6 C;  5AV9 D;  4Z2M H;  1M18 B;  3AZH A;  5DNM D;  2NQB B;  5GT0 C;  1P3B B;  1P3G C;  5CP6 B;  3LJA B;  3AV2 B;  5GT3 C;  4KGC B;  3REK A;  3UTB B;  4LD9 A;  3AZG B;  2RVQ D;  4X23 B;  1P3F D;  3VH5 W;  4XUJ A;  1S32 D;  4WU8 D;  4NE5 A;  3AN2 D;  3B0C W;  3MNN D;  5B2I A;  3AZH B;  1AOI A;  3R45 A;  5B32 G;  2NZD C;  3X1V D;  3AZL A;  1ID3 A;  4ZUX C;  3MGQ C;  3REK B;  4J8U C;  3NQJ A;  4DRB A;  4J8W A;  1TZY A;  3W98 C;  4LD9 B;  4YS3 D;  4Z5T A;  2LY8 A;  5CPJ A;  3WAA C;  4XUJ B;  5B24 A;  5B31 A;  1B6W A;  5B1M B;  2HIO C;  5AV6 D;  5AV8 C;  3X1U A;  5B2I B;  1H3O A;  1AOI B;  3R45 B;  5B2J C;  5GT0 D;  1P3G D;  1P3O A;  3AYW C;  3AZL B;  5GT3 D;  1ID3 B;  3MGS A;  3AZJ D;  4HGA C;  3NQJ B;  4J8W B;  1Q9C A;  1TZY B;  3O62 C;  1P34 A;  3W99 A;  4UUZ A;  4Z5T B;  5CPJ B;  4CSR A;  5GSU D;  2PYO C;  5B24 B;  5B31 B;  5B32 A;  2YFV A;  4WV4 B;  5CPI C;  4XZQ C;  2IO5 C;  3X1U B;  1H3O B;  1P3O B;  2NZD D;  4KUD C;  3AZI A;  3REI C;  1JFI A;  1U35 C;  3VH5 T;  4ZUX D;  3MGS B;  4ZBJ B;  3MGQ D;  4J8U D;  3AZN C;  3B0C T;  3W98 D;  1P34 B;  3W99 B;  4UUZ B;  4CSR B;  3WAA D;  5B32 B;  2YFV B;  2HIO D;  5AV8 D;  2ARO A;  3AV1 C;  3AZI B;  4Z66 C;  4AWL C;  3AYW D;  3B0D B;  1F66 A;  3KXB A;  1P3M C;  1P3K C;  3LEL C;  4Z2M G;  4WU9 C;  3O62 D;  3VH5 A;  2PYO D;  3X1T A;  3AZF A;  3C1B C;  3REJ A;  4XZQ D;  3A6N A;  5CPI D;  4EO5 C;  2L5A A;  1KX3 B;  3MGR A;  5AV9 A;  4KUD D;  1F66 B;  3WKJ C;  3REI D;  1U35 D;  3WTP C;  3AZN D;  1ZLA C;  3LZ1 A;  3B6G B;  5E5A C;  3X1T B;  5CPK C;  3AZF B;  3A6N B;  4R8P C;  4NE6 A;  1KX5 C;  5B0Z B;  2CWE A;  4J8X A;  3MGR B;  5B40 A;  5AV9 B;  3MNN A;  3AV1 D;  4Z66 D;  5DNN A;  5DNM B;  1P3M D;  1BH9 A;  1P3K D;  1P3P C;  3LEL D;  4WU9 D;  3X1V A;  3LZ1 B;  2FJ7 C;  4H9P A;  4H9S A;  5KDM A;  4G92 B;  3C1B D;  3KSY A;  4YS3 A;  2F8N D;  4J8X B;  1KU5 A;  5B40 B;  4H9R A;  3MNN B;  3W96 C;  5B0Y C;  3LJA A;  3WKJ D;  5AVC A;  3AV2 A;  4M6B A;  3X1S C;  1BH9 B;  3AZM C;  3WTP D;  3LZ0 C;  1ZLA D;  3X1V B;  3AZE C;  5KDM B;  3B6F A;  5E5A D;  5CPK D;  4R8P D;  4YS3 B;  1KX5 D;  4WZS B;  3KWQ A;  3MVD A;  3UTA A;  5B31 G;  4H9R B;  3KUY C;  5AVC B;  4QLC C;  1P3P D;  3AZJ C;  5B1L A;  1KX4 D;  4G91 C;  2CV5 A;  1HQ3 C;  5GT3 B;  5GSU C;  2FJ7 D;  3B6F B;  5B1M A;  4J8U A;  3TU4 A;  3KWQ B;  1M18 C;  3MVD B;  3UTA B;  2NQB C;  3AZK A;  1A7W A;  5B0Y D;  3W96 D;  3X1S D;  3WA9 A;  5B2J A;  3AZM D;  5F99 C;  5B1L B;  3LZ0 D;  2CV5 B;  3AZE D;  3REH C;  4ZUX B;  4CAY A;  4J8U B;  3TU4 B;  3MGP A;  3AZH C;  1P3I D;  3AZK B;  3KUY D;  3WA9 B;  5B2J B;  4QLC D;  5JRG A;  4LD9 C;  4KUD A;  5BS7 A;  1HQ3 D;  3NQU A;  4XUJ C;  3UT9 C;  4CAY B;  1R4V A;  1M18 D; 
#chains in the Genus database with same CATH topology
 3MGP B;  1AOI C;  2NQB D;  4J8V A;  3W97 C;  5CPI B;  2IO5 B;  1EQZ C;  1ID3 C;  5JRG B;  5F99 D;  4DQY B;  4KGC D;  2YFW A;  4KUD B;  1TZY C;  4Z5T C;  1U35 B;  3REH D;  3NQU B;  5CPJ C;  3AFA A;  4NE3 A;  3V9R A;  5AV5 A;  5GXQ A;  1M1A A;  5B31 C;  4WU9 A;  3X1U C;  2Y2Q A;  1B67 A;  3AZH D;  1KX3 A;  3F6T A;  1P3L A;  4J8V B;  3C1B A;  3C1C A;  4WNN A;  4ZBJ C;  5AVB A;  3REK D;  2YFW B;  4DRA A;  4LD9 D;  4AWL B;  1P34 C;  3W99 C;  1M1A B;  3AFA B;  5AV5 B;  3V9R B;  5GXQ B;  4XUJ D;  3UT9 D;  5B32 C;  3B6G A;  5C3I B;  3WTP A;  4WU9 B;  1M19 C;  5B0Z A;  1P3L B;  1AOI D;  5CPK A;  3C1B B;  3W97 D;  2BYK A;  4EO5 B;  1KX5 A;  2F8N B;  5DNM A;  1EQZ D;  1ID3 D;  3C1C B;  4WNN B;  5AVB B;  4J8W D;  3REL C;  1TZY D;  5BO0 A;  2Y2O A;  4Z5T D;  5CPJ D;  4JJN C;  2Y2P A;  5B31 D;  3WTP B;  2RIQ A;  5AY8 C;  3X1U D;  1P3F A;  1S32 A;  4WU8 A;  5CPK B;  2ARO C;  3AN2 A;  3WTP E;  2BYK B;  2JCH A;  4H9Q A;  5G49 A;  1KX5 B;  1F66 C;  3KXB C;  1KX4 C;  5BO0 B;  1P34 D;  3W99 D;  3VH6 A;  5B32 D;  3X1T C;  1M19 D;  4YM6 C;  3REJ C;  3A6N C;  2F8N K;  1P3A C;  1P3F B;  1S32 B;  4WU8 B;  3MGR C;  3AN2 B;  5AV6 A;  3AZI D;  5G49 B;  4H9Q B;  2HUE B;  5GT0 A;  1P3G A;  3REL D;  3B0B A;  5GT3 A;  4JJN D;  3AZJ A;  3LZ0 B;  4G92 C;  5JA4 A;  4E44 A;  2XD1 A;  5AY8 D;  5GSU A;  5B33 C;  1P3I C;  4J8X C;  5B40 C;  2ARO D;  5AV6 B;  1F66 D;  5DNN C;  3KXB D;  5GT0 B;  1P3G B;  2NZD A;  4KHA B;  2ZM5 A;  2G5I C;  4H9S C;  4ZUX A;  3MGQ A;  3AZJ B;  4G91 B;  5JA4 B;  3A1I A;  3X1T D;  4YM6 D;  3EPL A;  3A6N D;  3REJ D;  3W98 A;  5GSU B;  1P3A D;  3WAA A;  1P3B C;  3MGR D;  2HIO A;  5CP6 C;  5AV8 A;  3LJA C;  5AVC C;  3AV2 C;  2DQN C;  4KGC C;  2NZD B;  5CHL B;  2BYM A;  2VQR A;  3UTB C;  3AYW A;  2Y2J A;  3AZG C;  4X23 C;  4H9N B;  3LZ1 D;  2F2A C;  3MGQ B;  5F99 B;  3B6F C;  3W98 B;  3O62 A;  3KWQ C;  3REH B;  5B33 D;  2PYO A;  3MVD C;  3UTA C;  4J8X D;  3WAA B;  3UT9 A;  5B40 D;  2HIO B;  5CPI A;  4XZQ A;  5AV8 B;  1W2E A;  5DNN D;  5BT1 C;  3REK C;  2FFF B;  2BYM B;  3W97 A;  5B1L C;  3AYW B;  2CV5 C;  3REI A;  3IP4 C;  2F8N G;  1U35 A;  1EQZ A;  4HGA B;  5B1M C;  3AZN A;  3TU4 C;  2Y2M A;  3VH6 W;  3O62 B;  5B2I C;  2PYO B;  3UT9 B;  3AZK C;  1P3B D;  1F1E A;  5BNX A;  4XZQ B;  5CP6 D;  3LJA D;  5AVC D;  3AZL C;  3AV2 D;  3WA9 C;  3W97 B;  4J8W C;  4H9O A;  3UTB D;  4Z66 A;  3AV1 A;  3REI B;  4X23 D;  3AZG D;  1EQZ B;  1P3M A;  4UPK A;  1P3K A;  5B24 C;  3LEL A;  3B6F D;  3AZN B;  3KWQ D;  1HTA A;  3MGP C;  3MVD D;  3UTA D;  1P3O C;  1M19 A;  5BNX B;  2F8N A;  1TAF A;  1T3U A;  3MGS C;  5BT1 D;  5JRG C;  1WWI A;  5B1L D;  3AV1 B;  4H9O B;  4Z66 B;  2CV5 D;  4E45 A;  1WWS A;  5BS7 C;  3WKJ A;  1P3M B;  1P3K B;  3LEL B;  5B1M D;  3TU4 D;  3REL A;  1ZLA A;  5B2I D;  4JJN A;  1Z2C B;  3AZK D;  5E5A A;  4J8V C;  1M19 B;  2G5H C;  4R8P A;  3AZI C;  1TAF B;  5AY8 A;  3B0D C;  3AZL D;  5BNV A;  3WA9 D;  5B2J D;  3VH6 T;  4WJ3 C;  3WKJ B;  1JFI B;  2JSS A;  1BH8 A;  1M1A C;  3AFA C;  5AV5 C;  5GXQ C;  5B24 D;  1P3P A;  1KX4 A;  5C3I C;  3REL B;  1ZLA B;  2Y2G A;  2Y2L A;  3MGP D;  4JJN B;  1KX3 C;  2F8N H;  2FJ7 A;  1P3L C;  5E5A B;  1P3O D;  4YM6 A;  4R8P B;  5AY8 B;  1P3A A;  5BNV B;  1ULY A;  3MGS D;  3C1C C;  2ARO B;  5JRG D;  5AVB C;  3W96 A;  5B0Y A;  4NFT A;  1BH8 B;  3X1S A;  3KXB B;  3AZM A;  3A1K A;  1P3P B;  3B6G C;  1KX4 B;  3LZ0 A;  1BFM A;  1PZR A;  3AZF C;  3AZE A;  5B0Z C;  2FJ7 B;  5FUG A;  4J8V D;  4YM6 B;  5AV9 C;  3REJ B;  1P3A B;  5B33 A;  5DNM C;  1P3I A;  3KUY A;  5B0Y B;  3W96 B;  4KHA A;  3LZ1 C;  3X1S B;  1M1A D;  3AFA D;  4QLC A;  5AV5 D;  5GXQ D;  3AZM B;  3AZE B;  1N1J A;  2RVQ C;  1HQ3 A;  1KX3 D;  1P3F C;  1P3L D;  5FUG B;  4WU8 C;  1S32 C;  3EPH A;  3AN2 C;  3MNN C;  1M18 A;  5B33 B;  1P3I B;  2HUE C;  2NQB A;  1P3B A;  3C1C D;  3KUY B;  5AVB D;  5CP6 A;  3X1V C;  5DNN B;  4H9N A;  4QLC B;  4KGC A;  5F99 A;  3B6G D;  3UTB A;  3AZF D;  1N1J B;  3AZG A;  4YS3 C;  1HQ3 B;  4X23 A;  5B0Z D;  3REH A;  2XD5 A;  4H9P B;  5AV6 C;  5AV9 D;  4Z2M H;  3EPJ A;  1M18 B;  3AZH A;  5DNM D;  2NQB B;  5GT0 C;  1P3B B;  1P3G C;  5CP6 B;  3LJA B;  3AV2 B;  5GT3 C;  4KGC B;  3REK A;  3UTB B;  4LD9 A;  3AZG B;  2RVQ D;  4X23 B;  1P3F D;  3VH5 W;  4XUJ A;  1S32 D;  4WU8 D;  4NE5 A;  3AN2 D;  2J8P A;  3B0C W;  3MNN D;  5B2I A;  3AZH B;  1AOI A;  3R45 A;  5B32 G;  2NZD C;  3X1V D;  3KFU G;  3AZL A;  1ID3 A;  4ZUX C;  3MGQ C;  3EPK A;  3REK B;  2Y2H A;  4J8U C;  3NQJ A;  4DRB A;  4J8W A;  1TZY A;  3W98 C;  2ZY4 A;  4LD9 B;  4YS3 D;  4Z5T A;  2LY8 A;  5CPJ A;  3WAA C;  4XUJ B;  5B24 A;  5B31 A;  1B6W A;  5B1M B;  2HIO C;  3H0M C;  5AV6 D;  5AV8 C;  3X1U A;  5B2I B;  1H3O A;  1AOI B;  3R45 B;  5B2J C;  5GT0 D;  1P3G D;  1P3O A;  3AYW C;  3AZL B;  5GT3 D;  1ID3 B;  3MGS A;  2UWX A;  3AZJ D;  4HGA C;  3NQJ B;  3P5J B;  4J8W B;  1Q9C A;  1TZY B;  3O62 C;  1P34 A;  3W99 A;  4UUZ A;  4Z5T B;  5CPJ B;  4CSR A;  5GSU D;  2PYO C;  5B24 B;  5B31 B;  5B32 A;  2YFV A;  4WV4 B;  5CPI C;  4XZQ C;  2IO5 C;  3X1U B;  1H3O B;  1P3O B;  2NZD D;  4KUD C;  3AZI A;  3REI C;  1JFI A;  1U35 C;  3VH5 T;  4ZUX D;  3MGS B;  4ZBJ B;  3MGQ D;  4J8U D;  3AZN C;  3B0C T;  3W98 D;  1P34 B;  3W99 B;  4UUZ B;  2Y2I A;  4CSR B;  3WAA D;  5B32 B;  2YFV B;  2HIO D;  5AV8 D;  3EG5 B;  2ARO A;  2W8S A;  3AV1 C;  3AZI B;  4Z66 C;  4AWL C;  3AYW D;  3B0D B;  1F66 A;  3KXB A;  1P3M C;  1P3K C;  2Y2K A;  3LEL C;  4Z2M G;  4WU9 C;  2ZY5 A;  3O62 D;  2JE5 A;  3VH5 A;  2PYO D;  3AL0 C;  3X1T A;  3AZF A;  3C1B C;  3REJ A;  4XZQ D;  3A6N A;  5CPI D;  4EO5 C;  2L5A A;  1KX3 B;  3H0R C;  3MGR A;  5AV9 A;  4KUD D;  1F66 B;  3WKJ C;  3REI D;  1U35 D;  3WTP C;  3AZN D;  1ZLA C;  3LZ1 A;  3B6G B;  5E5A C;  3X1T B;  5CPK C;  3AZF B;  3A6N B;  4R8P C;  4NE6 A;  1KX5 C;  5B0Z B;  2CWE A;  4J8X A;  3MGR B;  5B40 A;  2BG1 A;  5AV9 B;  3MNN A;  3AV1 D;  4Z66 D;  5DNN A;  5DNM B;  1P3M D;  1BH9 A;  2ZY2 A;  1P3K D;  1P3P C;  3LEL D;  4WU9 D;  3X1V A;  3LZ1 B;  2FJ7 C;  4H9P A;  4H9S A;  5KDM A;  4G92 B;  3C1B D;  3KSY A;  4YS3 A;  2F8N D;  2DF4 C;  4J8X B;  1KU5 A;  5B40 B;  3H0L C;  4H9R A;  3W96 C;  5B0Y C;  3MNN B;  3LJA A;  3WKJ D;  5AVC A;  3AV2 A;  4M6B A;  3X1S C;  1BH9 B;  3AZM C;  3WTP D;  3LZ0 C;  1ZLA D;  3X1V B;  3AZE C;  5KDM B;  3B6F A;  5E5A D;  5CPK D;  4R8P D;  4YS3 B;  1KX5 D;  4WZS B;  3KWQ A;  3MVD A;  3UTA A;  5B31 G;  4H9R B;  3KUY C;  5AVC B;  2Y2N A;  4QLC C;  1P3P D;  3AZJ C;  5B1L A;  1KX4 D;  4G91 C;  2ZY3 A;  2CV5 A;  1HQ3 C;  5GT3 B;  5GSU C;  2FJ7 D;  3B6F B;  5B1M A;  4J8U A;  3TU4 A;  3KWQ B;  1M18 C;  3MVD B;  3UTA B;  2NQB C;  3AZK A;  1A7W A;  5B0Y D;  3W96 D;  3FDD A;  3X1S D;  3WA9 A;  5B2J A;  3AZM D;  5F99 C;  5B1L B;  3LZ0 D;  2CV5 B;  3AZE D;  3REH C;  4ZUX B;  4CAY A;  4J8U B;  3TU4 B;  3MGP A;  3AZH C;  1P3I D;  3AZK B;  3KUY D;  3WA9 B;  5B2J B;  4QLC D;  5JRG A;  4LD9 C;  4KUD A;  5BS7 A;  1HQ3 D;  3NQU A;  4XUJ C;  3UT9 C;  4CAY B;  1R4V A;  1M18 D; 
#chains in the Genus database with same CATH homology
 3MGP B;  1AOI C;  2NQB D;  4J8V A;  3W97 C;  5CPI B;  2IO5 B;  1EQZ C;  1ID3 C;  5JRG B;  5F99 D;  4DQY B;  4KGC D;  2YFW A;  4KUD B;  1TZY C;  4Z5T C;  1U35 B;  3REH D;  3NQU B;  5CPJ C;  3AFA A;  4NE3 A;  3V9R A;  5AV5 A;  5GXQ A;  1M1A A;  5B31 C;  4WU9 A;  3X1U C;  2Y2Q A;  1B67 A;  3AZH D;  1KX3 A;  3F6T A;  1P3L A;  4J8V B;  3C1B A;  3C1C A;  4WNN A;  4ZBJ C;  5AVB A;  3REK D;  2YFW B;  4DRA A;  4LD9 D;  4AWL B;  1P34 C;  3W99 C;  1M1A B;  3AFA B;  5AV5 B;  3V9R B;  5GXQ B;  4XUJ D;  3UT9 D;  5B32 C;  3B6G A;  5C3I B;  3WTP A;  4WU9 B;  1M19 C;  5B0Z A;  1P3L B;  1AOI D;  5CPK A;  3C1B B;  3W97 D;  2BYK A;  4EO5 B;  1KX5 A;  2F8N B;  5DNM A;  1EQZ D;  1ID3 D;  3C1C B;  4WNN B;  5AVB B;  4J8W D;  3REL C;  1TZY D;  5BO0 A;  2Y2O A;  4Z5T D;  5CPJ D;  4JJN C;  2Y2P A;  5B31 D;  3WTP B;  2RIQ A;  5AY8 C;  3X1U D;  1P3F A;  1S32 A;  4WU8 A;  5CPK B;  2ARO C;  3AN2 A;  3WTP E;  2BYK B;  2JCH A;  4H9Q A;  5G49 A;  1KX5 B;  1F66 C;  3KXB C;  1KX4 C;  5BO0 B;  1P34 D;  3W99 D;  3VH6 A;  5B32 D;  3X1T C;  1M19 D;  4YM6 C;  3REJ C;  3A6N C;  2F8N K;  1P3A C;  1P3F B;  1S32 B;  4WU8 B;  3MGR C;  3AN2 B;  5AV6 A;  3AZI D;  5G49 B;  4H9Q B;  2HUE B;  5GT0 A;  1P3G A;  3REL D;  3B0B A;  5GT3 A;  4JJN D;  3AZJ A;  3LZ0 B;  4G92 C;  5JA4 A;  4E44 A;  2XD1 A;  5AY8 D;  5GSU A;  5B33 C;  1P3I C;  4J8X C;  5B40 C;  2ARO D;  5AV6 B;  1F66 D;  5DNN C;  3KXB D;  5GT0 B;  1P3G B;  2NZD A;  4KHA B;  2ZM5 A;  2G5I C;  4H9S C;  4ZUX A;  3MGQ A;  3AZJ B;  4G91 B;  5JA4 B;  3A1I A;  3X1T D;  4YM6 D;  3EPL A;  3A6N D;  3REJ D;  3W98 A;  5GSU B;  1P3A D;  3WAA A;  1P3B C;  3MGR D;  2HIO A;  5CP6 C;  5AV8 A;  3LJA C;  5AVC C;  3AV2 C;  2DQN C;  4KGC C;  2NZD B;  5CHL B;  2BYM A;  2VQR A;  3UTB C;  3AYW A;  2Y2J A;  3AZG C;  4X23 C;  4H9N B;  3LZ1 D;  2F2A C;  3MGQ B;  5F99 B;  3B6F C;  3W98 B;  3O62 A;  3KWQ C;  3REH B;  5B33 D;  2PYO A;  3MVD C;  3UTA C;  4J8X D;  3WAA B;  3UT9 A;  5B40 D;  2HIO B;  5CPI A;  4XZQ A;  5AV8 B;  1W2E A;  5DNN D;  5BT1 C;  3REK C;  2FFF B;  2BYM B;  3W97 A;  5B1L C;  3AYW B;  2CV5 C;  3REI A;  3IP4 C;  2F8N G;  1U35 A;  1EQZ A;  4HGA B;  5B1M C;  3AZN A;  3TU4 C;  2Y2M A;  3VH6 W;  3O62 B;  5B2I C;  2PYO B;  3UT9 B;  3AZK C;  1P3B D;  1F1E A;  5BNX A;  4XZQ B;  5CP6 D;  3LJA D;  5AVC D;  3AZL C;  3AV2 D;  3WA9 C;  3W97 B;  4J8W C;  4H9O A;  3UTB D;  4Z66 A;  3AV1 A;  3REI B;  4X23 D;  3AZG D;  1EQZ B;  1P3M A;  4UPK A;  1P3K A;  5B24 C;  3LEL A;  3B6F D;  3AZN B;  3KWQ D;  1HTA A;  3MGP C;  3MVD D;  3UTA D;  1P3O C;  1M19 A;  5BNX B;  2F8N A;  1TAF A;  1T3U A;  3MGS C;  5BT1 D;  5JRG C;  1WWI A;  5B1L D;  3AV1 B;  4H9O B;  4Z66 B;  2CV5 D;  4E45 A;  1WWS A;  5BS7 C;  3WKJ A;  1P3M B;  1P3K B;  3LEL B;  5B1M D;  3TU4 D;  3REL A;  1ZLA A;  5B2I D;  4JJN A;  1Z2C B;  3AZK D;  5E5A A;  4J8V C;  1M19 B;  2G5H C;  4R8P A;  3AZI C;  1TAF B;  5AY8 A;  3B0D C;  3AZL D;  5BNV A;  3WA9 D;  5B2J D;  3VH6 T;  4WJ3 C;  3WKJ B;  1JFI B;  2JSS A;  1BH8 A;  1M1A C;  3AFA C;  5AV5 C;  5GXQ C;  5B24 D;  1P3P A;  1KX4 A;  5C3I C;  3REL B;  1ZLA B;  2Y2G A;  2Y2L A;  3MGP D;  4JJN B;  1KX3 C;  2F8N H;  2FJ7 A;  1P3L C;  5E5A B;  1P3O D;  4YM6 A;  4R8P B;  5AY8 B;  1P3A A;  5BNV B;  1ULY A;  3MGS D;  3C1C C;  2ARO B;  5JRG D;  5AVB C;  3W96 A;  5B0Y A;  4NFT A;  1BH8 B;  3X1S A;  3KXB B;  3AZM A;  3A1K A;  1P3P B;  3B6G C;  1KX4 B;  3LZ0 A;  1BFM A;  1PZR A;  3AZF C;  3AZE A;  5B0Z C;  2FJ7 B;  5FUG A;  4J8V D;  4YM6 B;  5AV9 C;  3REJ B;  1P3A B;  5B33 A;  5DNM C;  1P3I A;  3KUY A;  5B0Y B;  3W96 B;  4KHA A;  3LZ1 C;  3X1S B;  1M1A D;  3AFA D;  4QLC A;  5AV5 D;  5GXQ D;  3AZM B;  3AZE B;  1N1J A;  2RVQ C;  1HQ3 A;  1KX3 D;  1P3F C;  1P3L D;  5FUG B;  4WU8 C;  1S32 C;  3EPH A;  3AN2 C;  3MNN C;  1M18 A;  5B33 B;  1P3I B;  2HUE C;  2NQB A;  1P3B A;  3C1C D;  3KUY B;  5AVB D;  5CP6 A;  3X1V C;  5DNN B;  4H9N A;  4QLC B;  4KGC A;  5F99 A;  3B6G D;  3UTB A;  3AZF D;  1N1J B;  3AZG A;  4YS3 C;  1HQ3 B;  4X23 A;  5B0Z D;  3REH A;  2XD5 A;  4H9P B;  5AV6 C;  5AV9 D;  4Z2M H;  3EPJ A;  1M18 B;  3AZH A;  5DNM D;  2NQB B;  5GT0 C;  1P3B B;  1P3G C;  5CP6 B;  3LJA B;  3AV2 B;  5GT3 C;  4KGC B;  3REK A;  3UTB B;  4LD9 A;  3AZG B;  2RVQ D;  4X23 B;  1P3F D;  3VH5 W;  4XUJ A;  1S32 D;  4WU8 D;  4NE5 A;  3AN2 D;  2J8P A;  3B0C W;  3MNN D;  5B2I A;  3AZH B;  1AOI A;  3R45 A;  5B32 G;  2NZD C;  3X1V D;  3KFU G;  3AZL A;  1ID3 A;  4ZUX C;  3MGQ C;  3EPK A;  3REK B;  2Y2H A;  4J8U C;  3NQJ A;  4DRB A;  4J8W A;  1TZY A;  3W98 C;  2ZY4 A;  4LD9 B;  4YS3 D;  4Z5T A;  2LY8 A;  5CPJ A;  3WAA C;  4XUJ B;  5B24 A;  5B31 A;  1B6W A;  5B1M B;  2HIO C;  3H0M C;  5AV6 D;  5AV8 C;  3X1U A;  5B2I B;  1H3O A;  1AOI B;  3R45 B;  5B2J C;  5GT0 D;  1P3G D;  1P3O A;  3AYW C;  3AZL B;  5GT3 D;  1ID3 B;  3MGS A;  2UWX A;  3AZJ D;  4HGA C;  3NQJ B;  3P5J B;  4J8W B;  1Q9C A;  1TZY B;  3O62 C;  1P34 A;  3W99 A;  4UUZ A;  4Z5T B;  5CPJ B;  4CSR A;  5GSU D;  2PYO C;  5B24 B;  5B31 B;  5B32 A;  2YFV A;  4WV4 B;  5CPI C;  4XZQ C;  2IO5 C;  3X1U B;  1H3O B;  1P3O B;  2NZD D;  4KUD C;  3AZI A;  3REI C;  1JFI A;  1U35 C;  3VH5 T;  4ZUX D;  3MGS B;  4ZBJ B;  3MGQ D;  4J8U D;  3AZN C;  3B0C T;  3W98 D;  1P34 B;  3W99 B;  4UUZ B;  2Y2I A;  4CSR B;  3WAA D;  5B32 B;  2YFV B;  2HIO D;  5AV8 D;  3EG5 B;  2ARO A;  2W8S A;  3AV1 C;  3AZI B;  4Z66 C;  4AWL C;  3AYW D;  3B0D B;  1F66 A;  3KXB A;  1P3M C;  1P3K C;  2Y2K A;  3LEL C;  4Z2M G;  4WU9 C;  2ZY5 A;  3O62 D;  2JE5 A;  3VH5 A;  2PYO D;  3AL0 C;  3X1T A;  3AZF A;  3C1B C;  3REJ A;  4XZQ D;  3A6N A;  5CPI D;  4EO5 C;  2L5A A;  1KX3 B;  3H0R C;  3MGR A;  5AV9 A;  4KUD D;  1F66 B;  3WKJ C;  3REI D;  1U35 D;  3WTP C;  3AZN D;  1ZLA C;  3LZ1 A;  3B6G B;  5E5A C;  3X1T B;  5CPK C;  3AZF B;  3A6N B;  4R8P C;  4NE6 A;  1KX5 C;  5B0Z B;  2CWE A;  4J8X A;  3MGR B;  5B40 A;  2BG1 A;  5AV9 B;  3MNN A;  3AV1 D;  4Z66 D;  5DNN A;  5DNM B;  1P3M D;  1BH9 A;  2ZY2 A;  1P3K D;  1P3P C;  3LEL D;  4WU9 D;  3X1V A;  3LZ1 B;  2FJ7 C;  4H9P A;  4H9S A;  5KDM A;  4G92 B;  3C1B D;  3KSY A;  4YS3 A;  2F8N D;  2DF4 C;  4J8X B;  1KU5 A;  5B40 B;  3H0L C;  4H9R A;  3W96 C;  5B0Y C;  3MNN B;  3LJA A;  3WKJ D;  5AVC A;  3AV2 A;  4M6B A;  3X1S C;  1BH9 B;  3AZM C;  3WTP D;  3LZ0 C;  1ZLA D;  3X1V B;  3AZE C;  5KDM B;  3B6F A;  5E5A D;  5CPK D;  4R8P D;  4YS3 B;  1KX5 D;  4WZS B;  3KWQ A;  3MVD A;  3UTA A;  5B31 G;  4H9R B;  3KUY C;  5AVC B;  2Y2N A;  4QLC C;  1P3P D;  3AZJ C;  5B1L A;  1KX4 D;  4G91 C;  2ZY3 A;  2CV5 A;  1HQ3 C;  5GT3 B;  5GSU C;  2FJ7 D;  3B6F B;  5B1M A;  4J8U A;  3TU4 A;  3KWQ B;  1M18 C;  3MVD B;  3UTA B;  2NQB C;  3AZK A;  1A7W A;  5B0Y D;  3W96 D;  3FDD A;  3X1S D;  3WA9 A;  5B2J A;  3AZM D;  5F99 C;  5B1L B;  3LZ0 D;  2CV5 B;  3AZE D;  3REH C;  4ZUX B;  4CAY A;  4J8U B;  3TU4 B;  3MGP A;  3AZH C;  1P3I D;  3AZK B;  3KUY D;  3WA9 B;  5B2J B;  4QLC D;  5JRG A;  4LD9 C;  4KUD A;  5BS7 A;  1HQ3 D;  3NQU A;  4XUJ C;  3UT9 C;  4CAY B;  1R4V A;  1M18 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...