4YS3C

Nucleosome disassembly by rsc and swi/snf is enhanced by h3 acetylation near the nucleosome dyad axis
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
107
structure length
107
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone H3.2
publication title Histone Acetylation near the Nucleosome Dyad Axis Enhances Nucleosome Disassembly by RSC and SWI/SNF.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 30
structure length 107
sequence length 107
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-03-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4ys3C00
3W98C 3MGPD 3REHC 3AZLB 3W97C 3WKJC 4XZQB 3B6GD 3MGRC 1M18A 1AOIA 5B2IA 3REIA 3V9RA 5B2JA 2PYOD 4G91C 3AN2D 1KX4B 1ZLAD 5B0ZB 3C1BC 4H9QB 4J8XA 4Z66C 4WZSB 5AV6D 4X23D 3B6FC 1P3MD 3X1SC 3MGPB 1TZYA 1ULYA 3B0BA 3X1UA 3B6GB 4CSRA 5AV8C 5KDMA 2NQBC 4LD9C 4AWLB 3LJAC 4JJND 3AN2B 1ZLAB 2FJ7C 4J8UA 3UTAB 1KX5D 1H3OA 5AVBD 3AFAC 5AV6B 4X23B 2YFWB 1P3MB 5AV5D 4J8WD 5GXQC 5B1MC 5B24C 3WTPA 3AV1C 1A7WA 5BO0B 1HTAA 3RELD 3MVDA 3TU4C 3LZ0A 3W96A 5DNNA 1P3IC 2L5AA 3REKA 4JJNB 4KGCA 4Z5TA 3REHD 3VH6W 5E5AA 1P3LD 1P3BA 1KX5B 5AVBB 5CPJC 1P3AA 1KX3C 5CPIA 4YS3C 4WU8B 4WNNA 5AV5B 4YM6D 5B32C 4J8WB 1F66C 3WTPE 4EO5C 2NZDC 1P3KA 3KWQA 3AYWA 3RELB 3AZLC 3AZMD 5CPKA 1U35D 4XZQC 1P3LB 4KHAB 2HIOD 5AV9A 5G49A 5JRGA 1P3OA 1KX4C 4YM6B 5B0ZC 5GT0A 3AZJA 4LD9D 5GSUD 5DNMB 1P3GA 5B33A 3MGPC 3AZMB 1M1AA 1U35B 3UTBA 4H9PA 5AVCD 3KUYB 1EQZD 3B6GC 3AZKD 3AV2A 4ZBJB 5CP6A 4DRAA 3C1CA 2HIOB 3LELA 3AV1D 1P3FD 4AWLC 4H9NA 1BH8B 3AN2C 1ZLAC 3AZFA 3UTAC 3B0DB 5AV6C 1ID3A 1N1JA 5GSUB 4X23C 1P3MC 3X1VA 4KUDA 4HGAB 5AVCB 4J8VA 3WAAD 3VH5A 1S32A 1EQZB 3AZKB 3X1TD 4UUZB 5B0YA 2NZDD 2HUEB 1P3FB 5CHLB 4JJNC 1KX5C 1TAFB 4QLCA 4R8PD 5AVBC 3A6NB 5AY8D 5KDMB 3AZHD 3AZND 4WU8C 5AV5C 4J8WC 3AZID 3WAAB 1P34D 5BNVB 3MNNA 3X1TB 3RELC 1WWIA 2CV5D 5B31D 1P3LC 3W98A 3W97A 3REHA 3MGSD 4WU9B 3R45A 4R8PB 3WKJA 3LZ1D 2F8ND 5AY8B 3UT9B 3AZHB 3AZNB 4YM6C 3MGRA 3WA9D 3AZIB 3AZGD 1P34B 5DNMC 5FUGB 5B40D 3UTAD 3AZMC 1U35C 2CV5B 4E45A 3C1BA 5B31B 3AZED 1BH9B 3KUYC 3KXBB 4Z66A 5B1LD 4Z2MH 3B6FA 3X1SA 4ZBJC 2HIOC 3MGSB 1P3PD 3LZ1B 2F8NB 5AV8A 3NQJA 3B0DC 3WA9B 3AZGB 1WWSA 2NQBA 4LD9A 5GSUC 3LJAA 5B40B 2FJ7A 2BYMB 4HGAC 5AVCC 3AZEB 3AFAA 1EQZC 5B1LB 3AZKC 4WU8D 3NQUB 1B67A 1P3PB 4E44A 5GXQA 5B1MA 5B24A 3MGQD 3UTBB 2HUEC 3B0CT 1P3FC 2F8NK 1JFIA 3TU4A 3A6NC 1P3IA 5CPJA 3WAAC 5F99D 1KX3A 3O62D 3X1TC 4YS3A 3REJD 4H9RB 5B32A 4XUJD 4ZUXD 1F66A 3MGQB 5BNXB 5DNMD 2NZDA 1HQ3D 2AROD 3W99D 2YFVB 1M19B 3AZLA 4WU9C 5GT3D 4R8PC 3KUYD 1KU5A 4XZQA 5AY8C 3UT9C 3AZHC 4H9OB 5JA4B 3AZNC 3AZIC 1P34C 5F99B 3O62B 1KX4A 3REJB 5B0ZA 2CV5C 4XUJB 4ZUXB 1AOID 2BYKB 4H9QA 3VH5T 5B31C 5B2ID 3KXBC 3REID 5B2JD 3KSYA 2IO5B 1HQ3B 2AROB 3W99B 3MGPA 3MGSC 5GT3B 3LZ1C 4J8XD 4CAYB 3B6GA 5BT1D 4H9SC 1TZYD 3WA9C 3AZGC 3X1UD 2PYOA 5B40C 3AN2A 1ZLAA 3UTAA 1R4VA 1M18B 1AOIB 3AZEC 5B2IB 3A6ND 3REIB 3V9RB 5B2JB 5B1LC 5AV6A 4X23A 2YFWA 1P3MA 4J8UD 1P3PC 3UTBC 4J8XB 5BO0A 1TZYB 5C3IB 3WTPD 3X1UB 4JJNA 4CSRB 4WU9D 1KX5A 3MVDD 5AVBA 3LZ0D 4G92B 3W96D 5DNND 3UT9D 3REKD 4KGCD 4Z5TD 5AV5A 5E5AD 4J8UB 4J8WA 1H3OB 3MGQC 4NFTA 4DRBA 1P3AD 5CPID 1M19C 4NE6A 3RELA 3KXBD 3WTPB 3B0CW 3KWQD 1P3KD 1P3LA 4KHAA 5CPKD 3MVDB 3LZ0B 3W96B 5DNNB 5F99C 3O62C 3REKB 4KGCB 4Z5TB 4YM6A 3VH6A 5E5AB 3REJC 1P3BB 4XUJC 4ZUXC 5AV9D 1P3AB 2IO5C 1HQ3C 2AROC 3W99C 5BS7C 5CPIB 1P3OD 3AZMA 4WNNB 1U35A 5GT3C 5GT0D 3AZJD 1P3KB 3KWQB 3AYWB 1P3GD 5B33D 1M1AD 2HIOA 5CPKB 3UTBD 5B32G 1BH8A 3AV2D 5CP6D 3C1CD 5AV9B 1M18C 1AOIC 2F8NH 5B2IC 3REIC 3LELD 5G49B 5B2JC 5JRGB 1B6WA 5GSUA 1P3OB 3AZFD 5AVCA 4J8XC 5GT0B 3VH5W 3AZJB 1ID3D 1EQZA 5BT1C 3AZKA 1P3GB 5B33B 4UUZA 3X1VD 1M1AB 4KUDD 1TZYC 4Z2MG 5C3IC 3X1UC 4H9PB 4J8VD 3AV1A 1P3FA 1S32D 5B31G 1M19D 3AV2B 5CP6B 3C1CB 1TAFA 4G92C 3A6NA 5B0YD 3LELB 4H9NB 2PYOB 2F8NG 3AZFB 4J8UC 4QLCD 3WAAA 5BNVA 1ID3B 1N1JB 2RVQD 3X1TA 3X1VB 4KUDB 3WTPC 4J8VB 1S32B 1Q9CA 3MNND 4WU9A 3MVDC 4R8PA 3LZ0C 3W96C 5DNNC 5B0YB 5AY8A 3UT9A 3REKC 3AZHA 3AZNA 4Z5TC 4KGCC 3W98D 5E5AC 3W97D 1P3BC 4QLCB 3WKJD 3AZIA 2JSSA 1P34A 1P3AC 5CPIC 5FUGA 3MGRD 4M6BA 1M18D 2CV5A 5B31A 1BH9A 3KXBA 1P3KC 3KWQC 3AYWC 3MNNB 3MGSA 5CPKC 3C1BD 3LZ1A 2F8NA 4Z66D 4H9SA 3B6FD 3X1SD 3W98B 3W97B 3REHB 2CWEA 5AV9C 3WA9A 3R45B 3WKJB 3AZGA 5JRGC 1P3OC 5B40A 5AV8D 3MGRB 2BYMA 3AZEA 5GT0C 3AZJC 5B1LA 2NQBD 1P3GC 3LJAD 4G91B 3NQUA 5B33C 1M1AC 2FJ7D 1P3PA 3C1BB 3AFAD 4Z66B 3B6FB 3AV2C 1BFMA 3X1SB 5CP6C 3C1CC 5GXQD 5B1MD 5B24D 3LELC 4WV4B 2PYOC 3VH6T 5AV8B 3AZFC 3NQJB 3TU4D 1P3ID 1ID3C 2NQBB 4LD9B 4WU8A 3LJAB 1F1EA 3X1VC 1P3BD 2FJ7B 4H9RA 4KUDC 4NE5A 5CPJD 3MGQA 4J8VC 3AFAB 5BNXA 1S32C 1KX3D 1M19A 2YFVA 4YS3D 5B32D 1F66D 5GXQB 5B1MB 5B24B 5B0YC 3AYWD 4H9OA 3AV1B 5JA4A 4NE3A 3AZLD 4QLCC 1JFIB 3TU4B 4XZQD 5F99A 1P3IB 3O62A 2LY8A 2RVQC 3REJA 4XUJA 4ZUXA 2BYKA 5CPJB 5JRGD 5DNMA 1KX3B 1HQ3A 2AROA 5BS7A 3MNNC 3W99A 4YS3B 1KX4D 5B0ZD 5GT3A 5B32B 1F66B 3KUYA 4CAYA 4EO5B 2NZDB
chains in the Genus database with same CATH superfamily
3W98C 3MGPD 3REHC 3AZLB 3W97C 3WKJC 3EPKA 4XZQB 3B6GD 3MGRC 1M18A 1AOIA 5B2IA 3REIA 2Y2IA 3V9RA 5B2JA 2PYOD 4G91C 3AN2D 1KX4B 1ZLAD 5B0ZB 3C1BC 4H9QB 4J8XA 4Z66C 4WZSB 5AV6D 4X23D 3B6FC 1P3MD 3X1SC 3MGPB 1TZYA 1ULYA 3B0BA 3X1UA 2Y2PA 2ZM5A 3B6GB 4CSRA 5AV8C 3P5JB 5KDMA 2BG1A 1T3UA 2NQBC 4LD9C 4AWLB 2Y2OA 3LJAC 4JJND 3AN2B 1ZLAB 2FJ7C 4J8UA 3UTAB 1KX5D 2DQNC 3EPHA 1H3OA 5AVBD 3AFAC 5AV6B 4X23B 2YFWB 1P3MB 5AV5D 4J8WD 5GXQC 5B1MC 5B24C 3WTPA 3AV1C 1A7WA 5BO0B 1HTAA 3RELD 2G5IC 3MVDA 3TU4C 2J8PA 3LZ0A 3W96A 5DNNA 1P3IC 2L5AA 3REKA 4JJNB 4KGCA 4Z5TA 3REHD 3VH6W 5E5AA 1P3LD 1P3BA 3H0MC 1KX5B 5AVBB 5CPJC 1P3AA 1KX3C 5CPIA 4YS3C 4WU8B 4WNNA 5AV5B 4YM6D 5B32C 4J8WB 1F66C 3WTPE 4EO5C 2NZDC 1P3KA 3KWQA 3AYWA 3RELB 3AZLC 3AZMD 5CPKA 1U35D 4XZQC 2Y2NA 1P3LB 4KHAB 2HIOD 5AV9A 5G49A 5JRGA 1P3OA 1KX4C 4YM6B 5B0ZC 4UPKA 5GT0A 3AZJA 4LD9D 5GSUD 5DNMB 1P3GA 5B33A 3MGPC 3AZMB 1M1AA 1U35B 3UTBA 2ZY4A 4H9PA 5AVCD 3KUYB 1EQZD 3B6GC 3AZKD 3AV2A 4ZBJB 5CP6A 4DRAA 3C1CA 2HIOB 3LELA 3AV1D 1P3FD 4AWLC 4H9NA 1BH8B 3AN2C 1ZLAC 3AZFA 3UTAC 3B0DB 5AV6C 1ID3A 1N1JA 5GSUB 4X23C 1P3MC 3X1VA 4KUDA 4HGAB 5AVCB 4J8VA 3WAAD 3VH5A 1S32A 1EQZB 3AZKB 3X1TD 4UUZB 5B0YA 2NZDD 2HUEB 1P3FB 2Y2LA 5CHLB 4JJNC 1KX5C 1TAFB 4QLCA 4R8PD 5AVBC 3A6NB 5AY8D 5KDMB 2Y2GA 3AZHD 3AZND 4WU8C 5AV5C 4J8WC 3AZID 3WAAB 1P34D 5BNVB 2FFFB 3MNNA 3X1TB 3RELC 1WWIA 2CV5D 5B31D 2RIQA 3AL0C 1P3LC 3W98A 3W97A 3REHA 3MGSD 4WU9B 3R45A 4R8PB 3WKJA 3LZ1D 2F8ND 5AY8B 3UT9B 3AZHB 3AZNB 4YM6C 3MGRA 3WA9D 3EPJA 3AZIB 3AZGD 1P34B 2VQRA 5DNMC 5FUGB 5B40D 3UTAD 3AZMC 1U35C 2CV5B 2Y2HA 4E45A 3C1BA 5B31B 3AZED 1BH9B 3KUYC 3KXBB 4Z66A 5B1LD 4Z2MH 3B6FA 3X1SA 4ZBJC 2HIOC 3MGSB 1P3PD 3LZ1B 2F8NB 5AV8A 3NQJA 3B0DC 3WA9B 3AZGB 1WWSA 2NQBA 4LD9A 5GSUC 3LJAA 5B40B 2FJ7A 2BYMB 4HGAC 5AVCC 3AZEB 3AFAA 1EQZC 5B1LB 3AZKC 4WU8D 3NQUB 1B67A 1P3PB 4E44A 5GXQA 5B1MA 5B24A 3MGQD 3UTBB 2HUEC 3B0CT 1P3FC 2F8NK 1JFIA 3TU4A 3A6NC 1P3IA 1W2EA 2Y2MA 4DQYB 5CPJA 3WAAC 5F99D 2UWXA 1KX3A 3O62D 3X1TC 4YS3A 3REJD 4H9RB 5B32A 4XUJD 4ZUXD 1F66A 3MGQB 5BNXB 5DNMD 2NZDA 1HQ3D 2AROD 3W99D 2YFVB 1M19B 3AZLA 4WU9C 5GT3D 4R8PC 3KUYD 1KU5A 4XZQA 5AY8C 3UT9C 3AZHC 4H9OB 2W8SA 5JA4B 3AZNC 3AZIC 2Y2KA 1P34C 5F99B 3O62B 1KX4A 3REJB 5B0ZA 2CV5C 4XUJB 4ZUXB 1AOID 2BYKB 4H9QA 3VH5T 2ZY2A 5B31C 5B2ID 3KXBC 3REID 5B2JD 3KSYA 2IO5B 2JCHA 1HQ3B 2AROB 3W99B 2ZY5A 3MGPA 3MGSC 5GT3B 3A1KA 3LZ1C 2Y2QA 4J8XD 4CAYB 3B6GA 3IP4C 5BT1D 4H9SC 1TZYD 3WA9C 3H0LC 3AZGC 3X1UD 2PYOA 5B40C 3AN2A 1ZLAA 3UTAA 1R4VA 1M18B 1AOIB 3AZEC 5B2IB 3A6ND 3REIB 3V9RB 5B2JB 5B1LC 5AV6A 4X23A 2YFWA 1P3MA 4J8UD 1P3PC 3UTBC 4J8XB 5BO0A 1PZRA 1TZYB 5C3IB 3WTPD 3X1UB 4JJNA 4CSRB 4WU9D 1KX5A 3MVDD 5AVBA 3LZ0D 4G92B 3W96D 5DNND 3UT9D 3REKD 4KGCD 4Z5TD 5AV5A 5E5AD 4J8UB 4J8WA 1H3OB 3MGQC 4NFTA 4DRBA 1P3AD 5CPID 1M19C 2F2AC 1Z2CB 4NE6A 3RELA 3KXBD 3WTPB 3B0CW 3KWQD 1P3KD 1P3LA 4KHAA 5CPKD 3MVDB 3F6TA 3LZ0B 3W96B 5DNNB 5F99C 3O62C 2DF4C 3REKB 4KGCB 4Z5TB 4YM6A 3VH6A 5E5AB 3REJC 1P3BB 4XUJC 4ZUXC 5AV9D 1P3AB 2IO5C 1HQ3C 2AROC 3W99C 5BS7C 5CPIB 1P3OD 3AZMA 4WNNB 1U35A 5GT3C 5GT0D 3AZJD 1P3KB 3KWQB 3AYWB 1P3GD 5B33D 1M1AD 2HIOA 5CPKB 3UTBD 5B32G 1BH8A 3AV2D 4WJ3C 5CP6D 3C1CD 5AV9B 1M18C 1AOIC 2F8NH 5B2IC 3REIC 3LELD 5G49B 5B2JC 5JRGB 1B6WA 5GSUA 1P3OB 3AZFD 5AVCA 4J8XC 5GT0B 3VH5W 3AZJB 1ID3D 1EQZA 5BT1C 3AZKA 1P3GB 2JE5A 5B33B 4UUZA 3X1VD 1M1AB 4KUDD 1TZYC 4Z2MG 5C3IC 3X1UC 4H9PB 4J8VD 3AV1A 1P3FA 1S32D 5B31G 1M19D 3AV2B 5CP6B 3C1CB 1TAFA 4G92C 3A1IA 3A6NA 5B0YD 3LELB 4H9NB 2PYOB 2F8NG 3AZFB 4J8UC 4QLCD 3WAAA 5BNVA 1ID3B 1N1JB 2RVQD 2XD1A 3FDDA 3X1VB 3X1TA 4KUDB 3H0RC 3WTPC 4J8VB 1S32B 1Q9CA 3MNND 4WU9A 3MVDC 4R8PA 3LZ0C 3W96C 5DNNC 5B0YB 5AY8A 3UT9A 3REKC 3AZHA 3AZNA 4Z5TC 4KGCC 3W98D 5E5AC 3W97D 1P3BC 4QLCB 3WKJD 3AZIA 2JSSA 1P34A 1P3AC 5CPIC 5FUGA 3MGRD 4M6BA 1M18D 2CV5A 5B31A 1BH9A 3KXBA 1P3KC 3KWQC 3AYWC 3MNNB 3MGSA 5CPKC 3C1BD 3LZ1A 2F8NA 4Z66D 4H9SA 3B6FD 3X1SD 3W98B 3W97B 3REHB 2CWEA 5AV9C 3WA9A 3R45B 3WKJB 3AZGA 5JRGC 2G5HC 1P3OC 5B40A 5AV8D 3MGRB 2BYMA 3AZEA 5GT0C 3AZJC 5B1LA 2NQBD 1P3GC 3LJAD 4G91B 3NQUA 5B33C 1M1AC 2FJ7D 1P3PA 3EG5B 3C1BB 2Y2JA 3AFAD 4Z66B 3B6FB 3AV2C 1BFMA 3X1SB 5CP6C 3C1CC 5GXQD 5B1MD 5B24D 3LELC 4WV4B 2PYOC 3VH6T 5AV8B 3AZFC 3NQJB 3TU4D 1P3ID 1ID3C 2NQBB 4LD9B 4WU8A 3LJAB 1F1EA 2XD5A 3X1VC 1P3BD 4H9RA 2FJ7B 4KUDC 4NE5A 5CPJD 3MGQA 4J8VC 3AFAB 5BNXA 1S32C 1KX3D 1M19A 2YFVA 4YS3D 5B32D 1F66D 5GXQB 5B1MB 5B24B 5B0YC 3AYWD 4H9OA 3AV1B 5JA4A 4NE3A 3AZLD 4QLCC 1JFIB 3TU4B 4XZQD 5F99A 1P3IB 3O62A 2LY8A 2RVQC 3REJA 4XUJA 4ZUXA 2BYKA 5CPJB 5JRGD 5DNMA 1KX3B 1HQ3A 2AROA 5BS7A 3MNNC 3W99A 4YS3B 1KX4D 5B0ZD 5GT3A 5B32B 1F66B 2ZY3A 3KUYA 3EPLA 3KFUG 4CAYA 4EO5B 2NZDB
chains in the Genus database with same CATH topology
3W98C 3MGPD 3REHC 3AZLB 3W97C 3WKJC 3EPKA 4XZQB 3B6GD 3MGRC 1M18A 1AOIA 5B2IA 3REIA 2Y2IA 3V9RA 5B2JA 2PYOD 4G91C 3AN2D 1KX4B 1ZLAD 5B0ZB 3C1BC 4H9QB 4J8XA 4Z66C 4WZSB 5AV6D 4X23D 3B6FC 1P3MD 3X1SC 3MGPB 1TZYA 1ULYA 3B0BA 3X1UA 2Y2PA 2ZM5A 3B6GB 4CSRA 5AV8C 3P5JB 5KDMA 2BG1A 1T3UA 2NQBC 4LD9C 4AWLB 2Y2OA 3LJAC 4JJND 3AN2B 1ZLAB 2FJ7C 4J8UA 3UTAB 1KX5D 2DQNC 3EPHA 1H3OA 5AVBD 3AFAC 5AV6B 4X23B 2YFWB 1P3MB 5AV5D 4J8WD 5GXQC 5B1MC 5B24C 3WTPA 3AV1C 1A7WA 5BO0B 1HTAA 3RELD 2G5IC 3MVDA 3TU4C 2J8PA 3LZ0A 3W96A 5DNNA 1P3IC 2L5AA 3REKA 4JJNB 4KGCA 4Z5TA 3REHD 3VH6W 5E5AA 1P3LD 1P3BA 3H0MC 1KX5B 5AVBB 5CPJC 1P3AA 1KX3C 5CPIA 4YS3C 4WU8B 4WNNA 5AV5B 4YM6D 5B32C 4J8WB 1F66C 3WTPE 4EO5C 2NZDC 1P3KA 3KWQA 3AYWA 3RELB 3AZLC 3AZMD 5CPKA 1U35D 4XZQC 2Y2NA 1P3LB 4KHAB 2HIOD 5AV9A 5G49A 5JRGA 1P3OA 1KX4C 4YM6B 5B0ZC 4UPKA 5GT0A 3AZJA 4LD9D 5GSUD 5DNMB 1P3GA 5B33A 3MGPC 3AZMB 1M1AA 1U35B 3UTBA 2ZY4A 4H9PA 5AVCD 3KUYB 1EQZD 3B6GC 3AZKD 3AV2A 4ZBJB 5CP6A 4DRAA 3C1CA 2HIOB 3LELA 3AV1D 1P3FD 4AWLC 4H9NA 1BH8B 3AN2C 1ZLAC 3AZFA 3UTAC 3B0DB 5AV6C 1ID3A 1N1JA 5GSUB 4X23C 1P3MC 3X1VA 4KUDA 4HGAB 5AVCB 4J8VA 3WAAD 3VH5A 1S32A 1EQZB 3AZKB 3X1TD 4UUZB 5B0YA 2NZDD 2HUEB 1P3FB 2Y2LA 5CHLB 4JJNC 1KX5C 1TAFB 4QLCA 4R8PD 5AVBC 3A6NB 5AY8D 5KDMB 2Y2GA 3AZHD 3AZND 4WU8C 5AV5C 4J8WC 3AZID 3WAAB 1P34D 5BNVB 2FFFB 3MNNA 3X1TB 3RELC 1WWIA 2CV5D 5B31D 2RIQA 3AL0C 1P3LC 3W98A 3W97A 3REHA 3MGSD 4WU9B 3R45A 4R8PB 3WKJA 3LZ1D 2F8ND 5AY8B 3UT9B 3AZHB 3AZNB 4YM6C 3MGRA 3WA9D 3EPJA 3AZIB 3AZGD 1P34B 2VQRA 5DNMC 5FUGB 5B40D 3UTAD 3AZMC 1U35C 2CV5B 2Y2HA 4E45A 3C1BA 5B31B 3AZED 1BH9B 3KUYC 3KXBB 4Z66A 5B1LD 4Z2MH 3B6FA 3X1SA 4ZBJC 2HIOC 3MGSB 1P3PD 3LZ1B 2F8NB 5AV8A 3NQJA 3B0DC 3WA9B 3AZGB 1WWSA 2NQBA 4LD9A 5GSUC 3LJAA 5B40B 2FJ7A 2BYMB 4HGAC 5AVCC 3AZEB 3AFAA 1EQZC 5B1LB 3AZKC 4WU8D 3NQUB 1B67A 1P3PB 4E44A 5GXQA 5B1MA 5B24A 3MGQD 3UTBB 2HUEC 3B0CT 1P3FC 2F8NK 1JFIA 3TU4A 3A6NC 1P3IA 1W2EA 2Y2MA 4DQYB 5CPJA 3WAAC 5F99D 2UWXA 1KX3A 3O62D 3X1TC 4YS3A 3REJD 4H9RB 5B32A 4XUJD 4ZUXD 1F66A 3MGQB 5BNXB 5DNMD 2NZDA 1HQ3D 2AROD 3W99D 2YFVB 1M19B 3AZLA 4WU9C 5GT3D 4R8PC 3KUYD 1KU5A 4XZQA 5AY8C 3UT9C 3AZHC 4H9OB 2W8SA 5JA4B 3AZNC 3AZIC 2Y2KA 1P34C 5F99B 3O62B 1KX4A 3REJB 5B0ZA 2CV5C 4XUJB 4ZUXB 1AOID 2BYKB 4H9QA 3VH5T 2ZY2A 5B31C 5B2ID 3KXBC 3REID 5B2JD 3KSYA 2IO5B 2JCHA 1HQ3B 2AROB 3W99B 2ZY5A 3MGPA 3MGSC 5GT3B 3A1KA 3LZ1C 2Y2QA 4J8XD 4CAYB 3B6GA 3IP4C 5BT1D 4H9SC 1TZYD 3WA9C 3H0LC 3AZGC 3X1UD 2PYOA 5B40C 3AN2A 1ZLAA 3UTAA 1R4VA 1M18B 1AOIB 3AZEC 5B2IB 3A6ND 3REIB 3V9RB 5B2JB 5B1LC 5AV6A 4X23A 2YFWA 1P3MA 4J8UD 1P3PC 3UTBC 4J8XB 5BO0A 1PZRA 1TZYB 5C3IB 3WTPD 3X1UB 4JJNA 4CSRB 4WU9D 1KX5A 3MVDD 5AVBA 3LZ0D 4G92B 3W96D 5DNND 3UT9D 3REKD 4KGCD 4Z5TD 5AV5A 5E5AD 4J8UB 4J8WA 1H3OB 3MGQC 4NFTA 4DRBA 1P3AD 5CPID 1M19C 2F2AC 1Z2CB 4NE6A 3RELA 3KXBD 3WTPB 3B0CW 3KWQD 1P3KD 1P3LA 4KHAA 5CPKD 3MVDB 3F6TA 3LZ0B 3W96B 5DNNB 5F99C 3O62C 2DF4C 3REKB 4KGCB 4Z5TB 4YM6A 3VH6A 5E5AB 3REJC 1P3BB 4XUJC 4ZUXC 5AV9D 1P3AB 2IO5C 1HQ3C 2AROC 3W99C 5BS7C 5CPIB 1P3OD 3AZMA 4WNNB 1U35A 5GT3C 5GT0D 3AZJD 1P3KB 3KWQB 3AYWB 1P3GD 5B33D 1M1AD 2HIOA 5CPKB 3UTBD 5B32G 1BH8A 3AV2D 4WJ3C 5CP6D 3C1CD 5AV9B 1M18C 1AOIC 2F8NH 5B2IC 3REIC 3LELD 5G49B 5B2JC 5JRGB 1B6WA 5GSUA 1P3OB 3AZFD 5AVCA 4J8XC 5GT0B 3VH5W 3AZJB 1ID3D 1EQZA 5BT1C 3AZKA 1P3GB 2JE5A 5B33B 4UUZA 3X1VD 1M1AB 4KUDD 1TZYC 4Z2MG 5C3IC 3X1UC 4H9PB 4J8VD 3AV1A 1P3FA 1S32D 5B31G 1M19D 3AV2B 5CP6B 3C1CB 1TAFA 4G92C 3A1IA 3A6NA 5B0YD 3LELB 4H9NB 2PYOB 2F8NG 3AZFB 4J8UC 4QLCD 3WAAA 5BNVA 1ID3B 1N1JB 2RVQD 2XD1A 3FDDA 3X1VB 3X1TA 4KUDB 3H0RC 3WTPC 4J8VB 1S32B 1Q9CA 3MNND 4WU9A 3MVDC 4R8PA 3LZ0C 3W96C 5DNNC 5B0YB 5AY8A 3UT9A 3REKC 3AZHA 3AZNA 4Z5TC 4KGCC 3W98D 5E5AC 3W97D 1P3BC 4QLCB 3WKJD 3AZIA 2JSSA 1P34A 1P3AC 5CPIC 5FUGA 3MGRD 4M6BA 1M18D 2CV5A 5B31A 1BH9A 3KXBA 1P3KC 3KWQC 3AYWC 3MNNB 3MGSA 5CPKC 3C1BD 3LZ1A 2F8NA 4Z66D 4H9SA 3B6FD 3X1SD 3W98B 3W97B 3REHB 2CWEA 5AV9C 3WA9A 3R45B 3WKJB 3AZGA 5JRGC 2G5HC 1P3OC 5B40A 5AV8D 3MGRB 2BYMA 3AZEA 5GT0C 3AZJC 5B1LA 2NQBD 1P3GC 3LJAD 4G91B 3NQUA 5B33C 1M1AC 2FJ7D 1P3PA 3EG5B 3C1BB 2Y2JA 3AFAD 4Z66B 3B6FB 3AV2C 1BFMA 3X1SB 5CP6C 3C1CC 5GXQD 5B1MD 5B24D 3LELC 4WV4B 2PYOC 3VH6T 5AV8B 3AZFC 3NQJB 3TU4D 1P3ID 1ID3C 2NQBB 4LD9B 4WU8A 3LJAB 1F1EA 2XD5A 3X1VC 1P3BD 4H9RA 2FJ7B 4KUDC 4NE5A 5CPJD 3MGQA 4J8VC 3AFAB 5BNXA 1S32C 1KX3D 1M19A 2YFVA 4YS3D 5B32D 1F66D 5GXQB 5B1MB 5B24B 5B0YC 3AYWD 4H9OA 3AV1B 5JA4A 4NE3A 3AZLD 4QLCC 1JFIB 3TU4B 4XZQD 5F99A 1P3IB 3O62A 2LY8A 2RVQC 3REJA 4XUJA 4ZUXA 2BYKA 5CPJB 5JRGD 5DNMA 1KX3B 1HQ3A 2AROA 5BS7A 3MNNC 3W99A 4YS3B 1KX4D 5B0ZD 5GT3A 5B32B 1F66B 2ZY3A 3KUYA 3EPLA 3KFUG 4CAYA 4EO5B 2NZDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W98 C;  3MGP D;  3REH C;  3AZL B;  3W97 C;  3WKJ C;  4XZQ B;  3B6G D;  3MGR C;  1M18 A;  1AOI A;  5B2I A;  3REI A;  3V9R A;  5B2J A;  2PYO D;  4G91 C;  3AN2 D;  1KX4 B;  1ZLA D;  5B0Z B;  3C1B C;  4H9Q B;  4J8X A;  4Z66 C;  4WZS B;  5AV6 D;  4X23 D;  3B6F C;  1P3M D;  3X1S C;  3MGP B;  1TZY A;  1ULY A;  3B0B A;  3X1U A;  3B6G B;  4CSR A;  5AV8 C;  5KDM A;  2NQB C;  4LD9 C;  4AWL B;  3LJA C;  4JJN D;  3AN2 B;  1ZLA B;  2FJ7 C;  4J8U A;  3UTA B;  1KX5 D;  1H3O A;  5AVB D;  3AFA C;  5AV6 B;  4X23 B;  2YFW B;  1P3M B;  5AV5 D;  4J8W D;  5GXQ C;  5B1M C;  5B24 C;  3WTP A;  3AV1 C;  1A7W A;  5BO0 B;  1HTA A;  3REL D;  3MVD A;  3TU4 C;  3LZ0 A;  3W96 A;  5DNN A;  1P3I C;  2L5A A;  3REK A;  4JJN B;  4KGC A;  4Z5T A;  3REH D;  3VH6 W;  5E5A A;  1P3L D;  1P3B A;  1KX5 B;  5AVB B;  5CPJ C;  1P3A A;  1KX3 C;  5CPI A;  4YS3 C;  4WU8 B;  4WNN A;  5AV5 B;  4YM6 D;  5B32 C;  4J8W B;  1F66 C;  3WTP E;  4EO5 C;  2NZD C;  1P3K A;  3KWQ A;  3AYW A;  3REL B;  3AZL C;  3AZM D;  5CPK A;  1U35 D;  4XZQ C;  1P3L B;  4KHA B;  2HIO D;  5AV9 A;  5G49 A;  5JRG A;  1P3O A;  1KX4 C;  4YM6 B;  5B0Z C;  5GT0 A;  3AZJ A;  4LD9 D;  5GSU D;  5DNM B;  1P3G A;  5B33 A;  3MGP C;  3AZM B;  1M1A A;  1U35 B;  3UTB A;  4H9P A;  5AVC D;  3KUY B;  1EQZ D;  3B6G C;  3AZK D;  3AV2 A;  4ZBJ B;  5CP6 A;  4DRA A;  3C1C A;  2HIO B;  3LEL A;  3AV1 D;  1P3F D;  4AWL C;  4H9N A;  1BH8 B;  3AN2 C;  1ZLA C;  3AZF A;  3UTA C;  3B0D B;  5AV6 C;  1ID3 A;  1N1J A;  5GSU B;  4X23 C;  1P3M C;  3X1V A;  4KUD A;  4HGA B;  5AVC B;  4J8V A;  3WAA D;  3VH5 A;  1S32 A;  1EQZ B;  3AZK B;  3X1T D;  4UUZ B;  5B0Y A;  2NZD D;  2HUE B;  1P3F B;  5CHL B;  4JJN C;  1KX5 C;  1TAF B;  4QLC A;  4R8P D;  5AVB C;  3A6N B;  5AY8 D;  5KDM B;  3AZH D;  3AZN D;  4WU8 C;  5AV5 C;  4J8W C;  3AZI D;  3WAA B;  1P34 D;  5BNV B;  3MNN A;  3X1T B;  3REL C;  1WWI A;  2CV5 D;  5B31 D;  1P3L C;  3W98 A;  3W97 A;  3REH A;  3MGS D;  4WU9 B;  3R45 A;  4R8P B;  3WKJ A;  3LZ1 D;  2F8N D;  5AY8 B;  3UT9 B;  3AZH B;  3AZN B;  4YM6 C;  3MGR A;  3WA9 D;  3AZI B;  3AZG D;  1P34 B;  5DNM C;  5FUG B;  5B40 D;  3UTA D;  3AZM C;  1U35 C;  2CV5 B;  4E45 A;  3C1B A;  5B31 B;  3AZE D;  1BH9 B;  3KUY C;  3KXB B;  4Z66 A;  5B1L D;  4Z2M H;  3B6F A;  3X1S A;  4ZBJ C;  2HIO C;  3MGS B;  1P3P D;  3LZ1 B;  2F8N B;  5AV8 A;  3NQJ A;  3B0D C;  3WA9 B;  3AZG B;  1WWS A;  2NQB A;  4LD9 A;  5GSU C;  3LJA A;  5B40 B;  2FJ7 A;  2BYM B;  4HGA C;  5AVC C;  3AZE B;  3AFA A;  1EQZ C;  5B1L B;  3AZK C;  4WU8 D;  3NQU B;  1B67 A;  1P3P B;  4E44 A;  5GXQ A;  5B1M A;  5B24 A;  3MGQ D;  3UTB B;  2HUE C;  3B0C T;  1P3F C;  2F8N K;  1JFI A;  3TU4 A;  3A6N C;  1P3I A;  5CPJ A;  3WAA C;  5F99 D;  1KX3 A;  3O62 D;  3X1T C;  4YS3 A;  3REJ D;  4H9R B;  5B32 A;  4XUJ D;  4ZUX D;  1F66 A;  3MGQ B;  5BNX B;  5DNM D;  2NZD A;  1HQ3 D;  2ARO D;  3W99 D;  2YFV B;  1M19 B;  3AZL A;  4WU9 C;  5GT3 D;  4R8P C;  3KUY D;  1KU5 A;  4XZQ A;  5AY8 C;  3UT9 C;  3AZH C;  4H9O B;  5JA4 B;  3AZN C;  3AZI C;  1P34 C;  5F99 B;  3O62 B;  1KX4 A;  3REJ B;  5B0Z A;  2CV5 C;  4XUJ B;  4ZUX B;  1AOI D;  2BYK B;  4H9Q A;  3VH5 T;  5B31 C;  5B2I D;  3KXB C;  3REI D;  5B2J D;  3KSY A;  2IO5 B;  1HQ3 B;  2ARO B;  3W99 B;  3MGP A;  3MGS C;  5GT3 B;  3LZ1 C;  4J8X D;  4CAY B;  3B6G A;  5BT1 D;  4H9S C;  1TZY D;  3WA9 C;  3AZG C;  3X1U D;  2PYO A;  5B40 C;  3AN2 A;  1ZLA A;  3UTA A;  1R4V A;  1M18 B;  1AOI B;  3AZE C;  5B2I B;  3A6N D;  3REI B;  3V9R B;  5B2J B;  5B1L C;  5AV6 A;  4X23 A;  2YFW A;  1P3M A;  4J8U D;  1P3P C;  3UTB C;  4J8X B;  5BO0 A;  1TZY B;  5C3I B;  3WTP D;  3X1U B;  4JJN A;  4CSR B;  4WU9 D;  1KX5 A;  3MVD D;  5AVB A;  3LZ0 D;  4G92 B;  3W96 D;  5DNN D;  3UT9 D;  3REK D;  4KGC D;  4Z5T D;  5AV5 A;  5E5A D;  4J8U B;  4J8W A;  1H3O B;  3MGQ C;  4NFT A;  4DRB A;  1P3A D;  5CPI D;  1M19 C;  4NE6 A;  3REL A;  3KXB D;  3WTP B;  3B0C W;  3KWQ D;  1P3K D;  1P3L A;  4KHA A;  5CPK D;  3MVD B;  3LZ0 B;  3W96 B;  5DNN B;  5F99 C;  3O62 C;  3REK B;  4KGC B;  4Z5T B;  4YM6 A;  3VH6 A;  5E5A B;  3REJ C;  1P3B B;  4XUJ C;  4ZUX C;  5AV9 D;  1P3A B;  2IO5 C;  1HQ3 C;  2ARO C;  3W99 C;  5BS7 C;  5CPI B;  1P3O D;  3AZM A;  4WNN B;  1U35 A;  5GT3 C;  5GT0 D;  3AZJ D;  1P3K B;  3KWQ B;  3AYW B;  1P3G D;  5B33 D;  1M1A D;  2HIO A;  5CPK B;  3UTB D;  5B32 G;  1BH8 A;  3AV2 D;  5CP6 D;  3C1C D;  5AV9 B;  1M18 C;  1AOI C;  2F8N H;  5B2I C;  3REI C;  3LEL D;  5G49 B;  5B2J C;  5JRG B;  1B6W A;  5GSU A;  1P3O B;  3AZF D;  5AVC A;  4J8X C;  5GT0 B;  3VH5 W;  3AZJ B;  1ID3 D;  1EQZ A;  5BT1 C;  3AZK A;  1P3G B;  5B33 B;  4UUZ A;  3X1V D;  1M1A B;  4KUD D;  1TZY C;  4Z2M G;  5C3I C;  3X1U C;  4H9P B;  4J8V D;  3AV1 A;  1P3F A;  1S32 D;  5B31 G;  1M19 D;  3AV2 B;  5CP6 B;  3C1C B;  1TAF A;  4G92 C;  3A6N A;  5B0Y D;  3LEL B;  4H9N B;  2PYO B;  2F8N G;  3AZF B;  4J8U C;  4QLC D;  3WAA A;  5BNV A;  1ID3 B;  1N1J B;  2RVQ D;  3X1T A;  3X1V B;  4KUD B;  3WTP C;  4J8V B;  1S32 B;  1Q9C A;  3MNN D;  4WU9 A;  3MVD C;  4R8P A;  3LZ0 C;  3W96 C;  5DNN C;  5B0Y B;  5AY8 A;  3UT9 A;  3REK C;  3AZH A;  3AZN A;  4Z5T C;  4KGC C;  3W98 D;  5E5A C;  3W97 D;  1P3B C;  4QLC B;  3WKJ D;  3AZI A;  2JSS A;  1P34 A;  1P3A C;  5CPI C;  5FUG A;  3MGR D;  4M6B A;  1M18 D;  2CV5 A;  5B31 A;  1BH9 A;  3KXB A;  1P3K C;  3KWQ C;  3AYW C;  3MNN B;  3MGS A;  5CPK C;  3C1B D;  3LZ1 A;  2F8N A;  4Z66 D;  4H9S A;  3B6F D;  3X1S D;  3W98 B;  3W97 B;  3REH B;  2CWE A;  5AV9 C;  3WA9 A;  3R45 B;  3WKJ B;  3AZG A;  5JRG C;  1P3O C;  5B40 A;  5AV8 D;  3MGR B;  2BYM A;  3AZE A;  5GT0 C;  3AZJ C;  5B1L A;  2NQB D;  1P3G C;  3LJA D;  4G91 B;  3NQU A;  5B33 C;  1M1A C;  2FJ7 D;  1P3P A;  3C1B B;  3AFA D;  4Z66 B;  3B6F B;  3AV2 C;  1BFM A;  3X1S B;  5CP6 C;  3C1C C;  5GXQ D;  5B1M D;  5B24 D;  3LEL C;  4WV4 B;  2PYO C;  3VH6 T;  5AV8 B;  3AZF C;  3NQJ B;  3TU4 D;  1P3I D;  1ID3 C;  2NQB B;  4LD9 B;  4WU8 A;  3LJA B;  1F1E A;  3X1V C;  1P3B D;  2FJ7 B;  4H9R A;  4KUD C;  4NE5 A;  5CPJ D;  3MGQ A;  4J8V C;  3AFA B;  5BNX A;  1S32 C;  1KX3 D;  1M19 A;  2YFV A;  4YS3 D;  5B32 D;  1F66 D;  5GXQ B;  5B1M B;  5B24 B;  5B0Y C;  3AYW D;  4H9O A;  3AV1 B;  5JA4 A;  4NE3 A;  3AZL D;  4QLC C;  1JFI B;  3TU4 B;  4XZQ D;  5F99 A;  1P3I B;  3O62 A;  2LY8 A;  2RVQ C;  3REJ A;  4XUJ A;  4ZUX A;  2BYK A;  5CPJ B;  5JRG D;  5DNM A;  1KX3 B;  1HQ3 A;  2ARO A;  5BS7 A;  3MNN C;  3W99 A;  4YS3 B;  1KX4 D;  5B0Z D;  5GT3 A;  5B32 B;  1F66 B;  3KUY A;  4CAY A;  4EO5 B;  2NZD B; 
#chains in the Genus database with same CATH topology
 3W98 C;  3MGP D;  3REH C;  3AZL B;  3W97 C;  3WKJ C;  3EPK A;  4XZQ B;  3B6G D;  3MGR C;  1M18 A;  1AOI A;  5B2I A;  3REI A;  2Y2I A;  3V9R A;  5B2J A;  2PYO D;  4G91 C;  3AN2 D;  1KX4 B;  1ZLA D;  5B0Z B;  3C1B C;  4H9Q B;  4J8X A;  4Z66 C;  4WZS B;  5AV6 D;  4X23 D;  3B6F C;  1P3M D;  3X1S C;  3MGP B;  1TZY A;  1ULY A;  3B0B A;  3X1U A;  2Y2P A;  2ZM5 A;  3B6G B;  4CSR A;  5AV8 C;  3P5J B;  5KDM A;  2BG1 A;  1T3U A;  2NQB C;  4LD9 C;  4AWL B;  2Y2O A;  3LJA C;  4JJN D;  3AN2 B;  1ZLA B;  2FJ7 C;  4J8U A;  3UTA B;  1KX5 D;  2DQN C;  3EPH A;  1H3O A;  5AVB D;  3AFA C;  5AV6 B;  4X23 B;  2YFW B;  1P3M B;  5AV5 D;  4J8W D;  5GXQ C;  5B1M C;  5B24 C;  3WTP A;  3AV1 C;  1A7W A;  5BO0 B;  1HTA A;  3REL D;  2G5I C;  3MVD A;  3TU4 C;  2J8P A;  3LZ0 A;  3W96 A;  5DNN A;  1P3I C;  2L5A A;  3REK A;  4JJN B;  4KGC A;  4Z5T A;  3REH D;  3VH6 W;  5E5A A;  1P3L D;  1P3B A;  3H0M C;  1KX5 B;  5AVB B;  5CPJ C;  1P3A A;  1KX3 C;  5CPI A;  4YS3 C;  4WU8 B;  4WNN A;  5AV5 B;  4YM6 D;  5B32 C;  4J8W B;  1F66 C;  3WTP E;  4EO5 C;  2NZD C;  1P3K A;  3KWQ A;  3AYW A;  3REL B;  3AZL C;  3AZM D;  5CPK A;  1U35 D;  4XZQ C;  2Y2N A;  1P3L B;  4KHA B;  2HIO D;  5AV9 A;  5G49 A;  5JRG A;  1P3O A;  1KX4 C;  4YM6 B;  5B0Z C;  4UPK A;  5GT0 A;  3AZJ A;  4LD9 D;  5GSU D;  5DNM B;  1P3G A;  5B33 A;  3MGP C;  3AZM B;  1M1A A;  1U35 B;  3UTB A;  2ZY4 A;  4H9P A;  5AVC D;  3KUY B;  1EQZ D;  3B6G C;  3AZK D;  3AV2 A;  4ZBJ B;  5CP6 A;  4DRA A;  3C1C A;  2HIO B;  3LEL A;  3AV1 D;  1P3F D;  4AWL C;  4H9N A;  1BH8 B;  3AN2 C;  1ZLA C;  3AZF A;  3UTA C;  3B0D B;  5AV6 C;  1ID3 A;  1N1J A;  5GSU B;  4X23 C;  1P3M C;  3X1V A;  4KUD A;  4HGA B;  5AVC B;  4J8V A;  3WAA D;  3VH5 A;  1S32 A;  1EQZ B;  3AZK B;  3X1T D;  4UUZ B;  5B0Y A;  2NZD D;  2HUE B;  1P3F B;  2Y2L A;  5CHL B;  4JJN C;  1KX5 C;  1TAF B;  4QLC A;  4R8P D;  5AVB C;  3A6N B;  5AY8 D;  5KDM B;  2Y2G A;  3AZH D;  3AZN D;  4WU8 C;  5AV5 C;  4J8W C;  3AZI D;  3WAA B;  1P34 D;  5BNV B;  2FFF B;  3MNN A;  3X1T B;  3REL C;  1WWI A;  2CV5 D;  5B31 D;  2RIQ A;  3AL0 C;  1P3L C;  3W98 A;  3W97 A;  3REH A;  3MGS D;  4WU9 B;  3R45 A;  4R8P B;  3WKJ A;  3LZ1 D;  2F8N D;  5AY8 B;  3UT9 B;  3AZH B;  3AZN B;  4YM6 C;  3MGR A;  3WA9 D;  3EPJ A;  3AZI B;  3AZG D;  1P34 B;  2VQR A;  5DNM C;  5FUG B;  5B40 D;  3UTA D;  3AZM C;  1U35 C;  2CV5 B;  2Y2H A;  4E45 A;  3C1B A;  5B31 B;  3AZE D;  1BH9 B;  3KUY C;  3KXB B;  4Z66 A;  5B1L D;  4Z2M H;  3B6F A;  3X1S A;  4ZBJ C;  2HIO C;  3MGS B;  1P3P D;  3LZ1 B;  2F8N B;  5AV8 A;  3NQJ A;  3B0D C;  3WA9 B;  3AZG B;  1WWS A;  2NQB A;  4LD9 A;  5GSU C;  3LJA A;  5B40 B;  2FJ7 A;  2BYM B;  4HGA C;  5AVC C;  3AZE B;  3AFA A;  1EQZ C;  5B1L B;  3AZK C;  4WU8 D;  3NQU B;  1B67 A;  1P3P B;  4E44 A;  5GXQ A;  5B1M A;  5B24 A;  3MGQ D;  3UTB B;  2HUE C;  3B0C T;  1P3F C;  2F8N K;  1JFI A;  3TU4 A;  3A6N C;  1P3I A;  1W2E A;  2Y2M A;  4DQY B;  5CPJ A;  3WAA C;  5F99 D;  2UWX A;  1KX3 A;  3O62 D;  3X1T C;  4YS3 A;  3REJ D;  4H9R B;  5B32 A;  4XUJ D;  4ZUX D;  1F66 A;  3MGQ B;  5BNX B;  5DNM D;  2NZD A;  1HQ3 D;  2ARO D;  3W99 D;  2YFV B;  1M19 B;  3AZL A;  4WU9 C;  5GT3 D;  4R8P C;  3KUY D;  1KU5 A;  4XZQ A;  5AY8 C;  3UT9 C;  3AZH C;  4H9O B;  2W8S A;  5JA4 B;  3AZN C;  3AZI C;  2Y2K A;  1P34 C;  5F99 B;  3O62 B;  1KX4 A;  3REJ B;  5B0Z A;  2CV5 C;  4XUJ B;  4ZUX B;  1AOI D;  2BYK B;  4H9Q A;  3VH5 T;  2ZY2 A;  5B31 C;  5B2I D;  3KXB C;  3REI D;  5B2J D;  3KSY A;  2IO5 B;  2JCH A;  1HQ3 B;  2ARO B;  3W99 B;  2ZY5 A;  3MGP A;  3MGS C;  5GT3 B;  3A1K A;  3LZ1 C;  2Y2Q A;  4J8X D;  4CAY B;  3B6G A;  3IP4 C;  5BT1 D;  4H9S C;  1TZY D;  3WA9 C;  3H0L C;  3AZG C;  3X1U D;  2PYO A;  5B40 C;  3AN2 A;  1ZLA A;  3UTA A;  1R4V A;  1M18 B;  1AOI B;  3AZE C;  5B2I B;  3A6N D;  3REI B;  3V9R B;  5B2J B;  5B1L C;  5AV6 A;  4X23 A;  2YFW A;  1P3M A;  4J8U D;  1P3P C;  3UTB C;  4J8X B;  5BO0 A;  1PZR A;  1TZY B;  5C3I B;  3WTP D;  3X1U B;  4JJN A;  4CSR B;  4WU9 D;  1KX5 A;  3MVD D;  5AVB A;  3LZ0 D;  4G92 B;  3W96 D;  5DNN D;  3UT9 D;  3REK D;  4KGC D;  4Z5T D;  5AV5 A;  5E5A D;  4J8U B;  4J8W A;  1H3O B;  3MGQ C;  4NFT A;  4DRB A;  1P3A D;  5CPI D;  1M19 C;  2F2A C;  1Z2C B;  4NE6 A;  3REL A;  3KXB D;  3WTP B;  3B0C W;  3KWQ D;  1P3K D;  1P3L A;  4KHA A;  5CPK D;  3MVD B;  3F6T A;  3LZ0 B;  3W96 B;  5DNN B;  5F99 C;  3O62 C;  2DF4 C;  3REK B;  4KGC B;  4Z5T B;  4YM6 A;  3VH6 A;  5E5A B;  3REJ C;  1P3B B;  4XUJ C;  4ZUX C;  5AV9 D;  1P3A B;  2IO5 C;  1HQ3 C;  2ARO C;  3W99 C;  5BS7 C;  5CPI B;  1P3O D;  3AZM A;  4WNN B;  1U35 A;  5GT3 C;  5GT0 D;  3AZJ D;  1P3K B;  3KWQ B;  3AYW B;  1P3G D;  5B33 D;  1M1A D;  2HIO A;  5CPK B;  3UTB D;  5B32 G;  1BH8 A;  3AV2 D;  4WJ3 C;  5CP6 D;  3C1C D;  5AV9 B;  1M18 C;  1AOI C;  2F8N H;  5B2I C;  3REI C;  3LEL D;  5G49 B;  5B2J C;  5JRG B;  1B6W A;  5GSU A;  1P3O B;  3AZF D;  5AVC A;  4J8X C;  5GT0 B;  3VH5 W;  3AZJ B;  1ID3 D;  1EQZ A;  5BT1 C;  3AZK A;  1P3G B;  2JE5 A;  5B33 B;  4UUZ A;  3X1V D;  1M1A B;  4KUD D;  1TZY C;  4Z2M G;  5C3I C;  3X1U C;  4H9P B;  4J8V D;  3AV1 A;  1P3F A;  1S32 D;  5B31 G;  1M19 D;  3AV2 B;  5CP6 B;  3C1C B;  1TAF A;  4G92 C;  3A1I A;  3A6N A;  5B0Y D;  3LEL B;  4H9N B;  2PYO B;  2F8N G;  3AZF B;  4J8U C;  4QLC D;  3WAA A;  5BNV A;  1ID3 B;  1N1J B;  2RVQ D;  2XD1 A;  3FDD A;  3X1V B;  3X1T A;  4KUD B;  3H0R C;  3WTP C;  4J8V B;  1S32 B;  1Q9C A;  3MNN D;  4WU9 A;  3MVD C;  4R8P A;  3LZ0 C;  3W96 C;  5DNN C;  5B0Y B;  5AY8 A;  3UT9 A;  3REK C;  3AZH A;  3AZN A;  4Z5T C;  4KGC C;  3W98 D;  5E5A C;  3W97 D;  1P3B C;  4QLC B;  3WKJ D;  3AZI A;  2JSS A;  1P34 A;  1P3A C;  5CPI C;  5FUG A;  3MGR D;  4M6B A;  1M18 D;  2CV5 A;  5B31 A;  1BH9 A;  3KXB A;  1P3K C;  3KWQ C;  3AYW C;  3MNN B;  3MGS A;  5CPK C;  3C1B D;  3LZ1 A;  2F8N A;  4Z66 D;  4H9S A;  3B6F D;  3X1S D;  3W98 B;  3W97 B;  3REH B;  2CWE A;  5AV9 C;  3WA9 A;  3R45 B;  3WKJ B;  3AZG A;  5JRG C;  2G5H C;  1P3O C;  5B40 A;  5AV8 D;  3MGR B;  2BYM A;  3AZE A;  5GT0 C;  3AZJ C;  5B1L A;  2NQB D;  1P3G C;  3LJA D;  4G91 B;  3NQU A;  5B33 C;  1M1A C;  2FJ7 D;  1P3P A;  3EG5 B;  3C1B B;  2Y2J A;  3AFA D;  4Z66 B;  3B6F B;  3AV2 C;  1BFM A;  3X1S B;  5CP6 C;  3C1C C;  5GXQ D;  5B1M D;  5B24 D;  3LEL C;  4WV4 B;  2PYO C;  3VH6 T;  5AV8 B;  3AZF C;  3NQJ B;  3TU4 D;  1P3I D;  1ID3 C;  2NQB B;  4LD9 B;  4WU8 A;  3LJA B;  1F1E A;  2XD5 A;  3X1V C;  1P3B D;  4H9R A;  2FJ7 B;  4KUD C;  4NE5 A;  5CPJ D;  3MGQ A;  4J8V C;  3AFA B;  5BNX A;  1S32 C;  1KX3 D;  1M19 A;  2YFV A;  4YS3 D;  5B32 D;  1F66 D;  5GXQ B;  5B1M B;  5B24 B;  5B0Y C;  3AYW D;  4H9O A;  3AV1 B;  5JA4 A;  4NE3 A;  3AZL D;  4QLC C;  1JFI B;  3TU4 B;  4XZQ D;  5F99 A;  1P3I B;  3O62 A;  2LY8 A;  2RVQ C;  3REJ A;  4XUJ A;  4ZUX A;  2BYK A;  5CPJ B;  5JRG D;  5DNM A;  1KX3 B;  1HQ3 A;  2ARO A;  5BS7 A;  3MNN C;  3W99 A;  4YS3 B;  1KX4 D;  5B0Z D;  5GT3 A;  5B32 B;  1F66 B;  2ZY3 A;  3KUY A;  3EPL A;  3KFU G;  4CAY A;  4EO5 B;  2NZD B; 
#chains in the Genus database with same CATH homology
 3W98 C;  3MGP D;  3REH C;  3AZL B;  3W97 C;  3WKJ C;  3EPK A;  4XZQ B;  3B6G D;  3MGR C;  1M18 A;  1AOI A;  5B2I A;  3REI A;  2Y2I A;  3V9R A;  5B2J A;  2PYO D;  4G91 C;  3AN2 D;  1KX4 B;  1ZLA D;  5B0Z B;  3C1B C;  4H9Q B;  4J8X A;  4Z66 C;  4WZS B;  5AV6 D;  4X23 D;  3B6F C;  1P3M D;  3X1S C;  3MGP B;  1TZY A;  1ULY A;  3B0B A;  3X1U A;  2Y2P A;  2ZM5 A;  3B6G B;  4CSR A;  5AV8 C;  3P5J B;  5KDM A;  2BG1 A;  1T3U A;  2NQB C;  4LD9 C;  4AWL B;  2Y2O A;  3LJA C;  4JJN D;  3AN2 B;  1ZLA B;  2FJ7 C;  4J8U A;  3UTA B;  1KX5 D;  2DQN C;  3EPH A;  1H3O A;  5AVB D;  3AFA C;  5AV6 B;  4X23 B;  2YFW B;  1P3M B;  5AV5 D;  4J8W D;  5GXQ C;  5B1M C;  5B24 C;  3WTP A;  3AV1 C;  1A7W A;  5BO0 B;  1HTA A;  3REL D;  2G5I C;  3MVD A;  3TU4 C;  2J8P A;  3LZ0 A;  3W96 A;  5DNN A;  1P3I C;  2L5A A;  3REK A;  4JJN B;  4KGC A;  4Z5T A;  3REH D;  3VH6 W;  5E5A A;  1P3L D;  1P3B A;  3H0M C;  1KX5 B;  5AVB B;  5CPJ C;  1P3A A;  1KX3 C;  5CPI A;  4YS3 C;  4WU8 B;  4WNN A;  5AV5 B;  4YM6 D;  5B32 C;  4J8W B;  1F66 C;  3WTP E;  4EO5 C;  2NZD C;  1P3K A;  3KWQ A;  3AYW A;  3REL B;  3AZL C;  3AZM D;  5CPK A;  1U35 D;  4XZQ C;  2Y2N A;  1P3L B;  4KHA B;  2HIO D;  5AV9 A;  5G49 A;  5JRG A;  1P3O A;  1KX4 C;  4YM6 B;  5B0Z C;  4UPK A;  5GT0 A;  3AZJ A;  4LD9 D;  5GSU D;  5DNM B;  1P3G A;  5B33 A;  3MGP C;  3AZM B;  1M1A A;  1U35 B;  3UTB A;  2ZY4 A;  4H9P A;  5AVC D;  3KUY B;  1EQZ D;  3B6G C;  3AZK D;  3AV2 A;  4ZBJ B;  5CP6 A;  4DRA A;  3C1C A;  2HIO B;  3LEL A;  3AV1 D;  1P3F D;  4AWL C;  4H9N A;  1BH8 B;  3AN2 C;  1ZLA C;  3AZF A;  3UTA C;  3B0D B;  5AV6 C;  1ID3 A;  1N1J A;  5GSU B;  4X23 C;  1P3M C;  3X1V A;  4KUD A;  4HGA B;  5AVC B;  4J8V A;  3WAA D;  3VH5 A;  1S32 A;  1EQZ B;  3AZK B;  3X1T D;  4UUZ B;  5B0Y A;  2NZD D;  2HUE B;  1P3F B;  2Y2L A;  5CHL B;  4JJN C;  1KX5 C;  1TAF B;  4QLC A;  4R8P D;  5AVB C;  3A6N B;  5AY8 D;  5KDM B;  2Y2G A;  3AZH D;  3AZN D;  4WU8 C;  5AV5 C;  4J8W C;  3AZI D;  3WAA B;  1P34 D;  5BNV B;  2FFF B;  3MNN A;  3X1T B;  3REL C;  1WWI A;  2CV5 D;  5B31 D;  2RIQ A;  3AL0 C;  1P3L C;  3W98 A;  3W97 A;  3REH A;  3MGS D;  4WU9 B;  3R45 A;  4R8P B;  3WKJ A;  3LZ1 D;  2F8N D;  5AY8 B;  3UT9 B;  3AZH B;  3AZN B;  4YM6 C;  3MGR A;  3WA9 D;  3EPJ A;  3AZI B;  3AZG D;  1P34 B;  2VQR A;  5DNM C;  5FUG B;  5B40 D;  3UTA D;  3AZM C;  1U35 C;  2CV5 B;  2Y2H A;  4E45 A;  3C1B A;  5B31 B;  3AZE D;  1BH9 B;  3KUY C;  3KXB B;  4Z66 A;  5B1L D;  4Z2M H;  3B6F A;  3X1S A;  4ZBJ C;  2HIO C;  3MGS B;  1P3P D;  3LZ1 B;  2F8N B;  5AV8 A;  3NQJ A;  3B0D C;  3WA9 B;  3AZG B;  1WWS A;  2NQB A;  4LD9 A;  5GSU C;  3LJA A;  5B40 B;  2FJ7 A;  2BYM B;  4HGA C;  5AVC C;  3AZE B;  3AFA A;  1EQZ C;  5B1L B;  3AZK C;  4WU8 D;  3NQU B;  1B67 A;  1P3P B;  4E44 A;  5GXQ A;  5B1M A;  5B24 A;  3MGQ D;  3UTB B;  2HUE C;  3B0C T;  1P3F C;  2F8N K;  1JFI A;  3TU4 A;  3A6N C;  1P3I A;  1W2E A;  2Y2M A;  4DQY B;  5CPJ A;  3WAA C;  5F99 D;  2UWX A;  1KX3 A;  3O62 D;  3X1T C;  4YS3 A;  3REJ D;  4H9R B;  5B32 A;  4XUJ D;  4ZUX D;  1F66 A;  3MGQ B;  5BNX B;  5DNM D;  2NZD A;  1HQ3 D;  2ARO D;  3W99 D;  2YFV B;  1M19 B;  3AZL A;  4WU9 C;  5GT3 D;  4R8P C;  3KUY D;  1KU5 A;  4XZQ A;  5AY8 C;  3UT9 C;  3AZH C;  4H9O B;  2W8S A;  5JA4 B;  3AZN C;  3AZI C;  2Y2K A;  1P34 C;  5F99 B;  3O62 B;  1KX4 A;  3REJ B;  5B0Z A;  2CV5 C;  4XUJ B;  4ZUX B;  1AOI D;  2BYK B;  4H9Q A;  3VH5 T;  2ZY2 A;  5B31 C;  5B2I D;  3KXB C;  3REI D;  5B2J D;  3KSY A;  2IO5 B;  2JCH A;  1HQ3 B;  2ARO B;  3W99 B;  2ZY5 A;  3MGP A;  3MGS C;  5GT3 B;  3A1K A;  3LZ1 C;  2Y2Q A;  4J8X D;  4CAY B;  3B6G A;  3IP4 C;  5BT1 D;  4H9S C;  1TZY D;  3WA9 C;  3H0L C;  3AZG C;  3X1U D;  2PYO A;  5B40 C;  3AN2 A;  1ZLA A;  3UTA A;  1R4V A;  1M18 B;  1AOI B;  3AZE C;  5B2I B;  3A6N D;  3REI B;  3V9R B;  5B2J B;  5B1L C;  5AV6 A;  4X23 A;  2YFW A;  1P3M A;  4J8U D;  1P3P C;  3UTB C;  4J8X B;  5BO0 A;  1PZR A;  1TZY B;  5C3I B;  3WTP D;  3X1U B;  4JJN A;  4CSR B;  4WU9 D;  1KX5 A;  3MVD D;  5AVB A;  3LZ0 D;  4G92 B;  3W96 D;  5DNN D;  3UT9 D;  3REK D;  4KGC D;  4Z5T D;  5AV5 A;  5E5A D;  4J8U B;  4J8W A;  1H3O B;  3MGQ C;  4NFT A;  4DRB A;  1P3A D;  5CPI D;  1M19 C;  2F2A C;  1Z2C B;  4NE6 A;  3REL A;  3KXB D;  3WTP B;  3B0C W;  3KWQ D;  1P3K D;  1P3L A;  4KHA A;  5CPK D;  3MVD B;  3F6T A;  3LZ0 B;  3W96 B;  5DNN B;  5F99 C;  3O62 C;  2DF4 C;  3REK B;  4KGC B;  4Z5T B;  4YM6 A;  3VH6 A;  5E5A B;  3REJ C;  1P3B B;  4XUJ C;  4ZUX C;  5AV9 D;  1P3A B;  2IO5 C;  1HQ3 C;  2ARO C;  3W99 C;  5BS7 C;  5CPI B;  1P3O D;  3AZM A;  4WNN B;  1U35 A;  5GT3 C;  5GT0 D;  3AZJ D;  1P3K B;  3KWQ B;  3AYW B;  1P3G D;  5B33 D;  1M1A D;  2HIO A;  5CPK B;  3UTB D;  5B32 G;  1BH8 A;  3AV2 D;  4WJ3 C;  5CP6 D;  3C1C D;  5AV9 B;  1M18 C;  1AOI C;  2F8N H;  5B2I C;  3REI C;  3LEL D;  5G49 B;  5B2J C;  5JRG B;  1B6W A;  5GSU A;  1P3O B;  3AZF D;  5AVC A;  4J8X C;  5GT0 B;  3VH5 W;  3AZJ B;  1ID3 D;  1EQZ A;  5BT1 C;  3AZK A;  1P3G B;  2JE5 A;  5B33 B;  4UUZ A;  3X1V D;  1M1A B;  4KUD D;  1TZY C;  4Z2M G;  5C3I C;  3X1U C;  4H9P B;  4J8V D;  3AV1 A;  1P3F A;  1S32 D;  5B31 G;  1M19 D;  3AV2 B;  5CP6 B;  3C1C B;  1TAF A;  4G92 C;  3A1I A;  3A6N A;  5B0Y D;  3LEL B;  4H9N B;  2PYO B;  2F8N G;  3AZF B;  4J8U C;  4QLC D;  3WAA A;  5BNV A;  1ID3 B;  1N1J B;  2RVQ D;  2XD1 A;  3FDD A;  3X1V B;  3X1T A;  4KUD B;  3H0R C;  3WTP C;  4J8V B;  1S32 B;  1Q9C A;  3MNN D;  4WU9 A;  3MVD C;  4R8P A;  3LZ0 C;  3W96 C;  5DNN C;  5B0Y B;  5AY8 A;  3UT9 A;  3REK C;  3AZH A;  3AZN A;  4Z5T C;  4KGC C;  3W98 D;  5E5A C;  3W97 D;  1P3B C;  4QLC B;  3WKJ D;  3AZI A;  2JSS A;  1P34 A;  1P3A C;  5CPI C;  5FUG A;  3MGR D;  4M6B A;  1M18 D;  2CV5 A;  5B31 A;  1BH9 A;  3KXB A;  1P3K C;  3KWQ C;  3AYW C;  3MNN B;  3MGS A;  5CPK C;  3C1B D;  3LZ1 A;  2F8N A;  4Z66 D;  4H9S A;  3B6F D;  3X1S D;  3W98 B;  3W97 B;  3REH B;  2CWE A;  5AV9 C;  3WA9 A;  3R45 B;  3WKJ B;  3AZG A;  5JRG C;  2G5H C;  1P3O C;  5B40 A;  5AV8 D;  3MGR B;  2BYM A;  3AZE A;  5GT0 C;  3AZJ C;  5B1L A;  2NQB D;  1P3G C;  3LJA D;  4G91 B;  3NQU A;  5B33 C;  1M1A C;  2FJ7 D;  1P3P A;  3EG5 B;  3C1B B;  2Y2J A;  3AFA D;  4Z66 B;  3B6F B;  3AV2 C;  1BFM A;  3X1S B;  5CP6 C;  3C1C C;  5GXQ D;  5B1M D;  5B24 D;  3LEL C;  4WV4 B;  2PYO C;  3VH6 T;  5AV8 B;  3AZF C;  3NQJ B;  3TU4 D;  1P3I D;  1ID3 C;  2NQB B;  4LD9 B;  4WU8 A;  3LJA B;  1F1E A;  2XD5 A;  3X1V C;  1P3B D;  4H9R A;  2FJ7 B;  4KUD C;  4NE5 A;  5CPJ D;  3MGQ A;  4J8V C;  3AFA B;  5BNX A;  1S32 C;  1KX3 D;  1M19 A;  2YFV A;  4YS3 D;  5B32 D;  1F66 D;  5GXQ B;  5B1M B;  5B24 B;  5B0Y C;  3AYW D;  4H9O A;  3AV1 B;  5JA4 A;  4NE3 A;  3AZL D;  4QLC C;  1JFI B;  3TU4 B;  4XZQ D;  5F99 A;  1P3I B;  3O62 A;  2LY8 A;  2RVQ C;  3REJ A;  4XUJ A;  4ZUX A;  2BYK A;  5CPJ B;  5JRG D;  5DNM A;  1KX3 B;  1HQ3 A;  2ARO A;  5BS7 A;  3MNN C;  3W99 A;  4YS3 B;  1KX4 D;  5B0Z D;  5GT3 A;  5B32 B;  1F66 B;  2ZY3 A;  3KUY A;  3EPL A;  3KFU G;  4CAY A;  4EO5 B;  2NZD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...