5AVBA

Human nucleosome core particle
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
99
structure length
99
Chain Sequence
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Intra- and inter-nucleosomal interactions of the histone H4 tail revealed with a human nucleosome core particle with genetically-incorporated H4 tetra-acetylation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 31
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5avbA00
5B24B 4Z66A 3UT9A 2JSSA 3C1CD 3KUYD 3AZIC 3O62A 5AY8A 3KUYB 3REIC 2BYKA 3LZ0D 3LZ1D 5AVCD 3X1VC 3LZ1B 1M1AB 5AVCB 5B2JC 3B6FA 1KX3C 4KUDC 3AZKA 3NQUA 3UTBA 4WZSB 4EO5B 4LD9A 3RELD 3AZJD 3MGRA 5GT0A 1P3LB 5GXQD 1TZYD 3RELB 5JA4A 1AOID 4H9OB 3MGSC 4KGCA 5E5AD 3MVDA 5AVBA 2IO5B 1WWIA 5B2IA 3REKA 4YS3D 3UTAB 4QLCD 3AZIA 5E5AB 2HIOD 1A7WA 2NQBC 3C1BC 5C3IB 4YS3B 2HIOB 1S32D 5DNNA 4H9NA 3VH5A 1S32B 3W98B 5B32D 4XZQD 3AZFA 1M1AA 5JRGC 3AZJC 1P34B 5B32B 1BH9A 3AZHA 5GSUB 5BS7C 5CPIC 5B31D 5CP6D 3MGQC 2CV5B 5DNMD 5CP6B 1P3OC 3MGSA 3NQJA 4J8WC 3TU4D 3AZMC 1BFMA 1P3LA 1WWSA 3AZLD 3AZEB 2BYMB 3WKJC 3REJA 3A6ND 3AFAD 1ZLAA 4J8XC 3W97A 5AV6C 3X1UB 4JJNC 3UTAA 5BO0B 1P3KD 5AV5B 5B1LD 3MNNA 3MGPB 1TAFB 4G91C 4H9PA 4J8VC 2F8NG 4Z66D 2AROA 4Z2MG 4G92B 4Z66B 3UT9B 1ID3B 3O62D 4R8PA 5CPKC 5B0YB 4Z5TC 3O62B 5AY8B 3AN2B 3W98A 1P3MC 4HGAB 1P3BC 5B1MC 1P3FC 2RVQD 1P3PA 3X1SC 1EQZB 1P3AA 3WTPA 3B6FD 5GSUA 2YFWA 4J8UA 3LELA 3AZKD 5F99B 3UTBD 3B6FB 3B0DC 3KXBA 1R4VA 4LD9D 3AZKB 1F1EA 1P3GC 3NQUB 3MGRD 4J8XA 3REHA 3UTBB 5CPJB 5GT0D 1F66A 1KX4B 2F8NA 4LD9B 1HQ3A 3MGRB 3AZGA 5GT0B 3AZND 1U35D 3X1UA 3MVDD 5AVBD 3AV2C 3WA9D 4KGCD 3LJAA 5JA4B 2LY8A 5B2ID 4ZUXA 3REKD 2PYOB 5G49B 3MGPA 3MVDB 5AVBB 1KX5C 5B24D 5AV9C 4YM6A 5B2IB 5AV8C 3REKB 3AZIB 3KWQC 1P3IC 4Z5TA 1ID3A 3W96C 5B0ZA 3REIB 5DNND 3AYWA 3AV1C 3X1TC 5B0YA 5BT1C 3WAAC 2NZDC 3AN2A 5DNNB 4H9NB 3W99C 1M19C 4DRBA 3AZFD 1M1AD 1EQZA 3B0CT 4E44A 4UUZA 5B40C 3AZHD 3AZFB 1JFIA 5F99A 2FJ7C 1BH9B 3WA9C 3AZHB 1M18C 3B6GC 4X23C 5B33C 5CPJA 2F8NK 5GT3C 1P3LD 1KX4A 3MGSB 3NQJB 4WU9A 3REJD 4WU8C 5AV9A 1ZLAD 3W97D 3C1CC 2PYOA 3UTAD 4XUJA 3KWQA 3KUYC 5G49A 4WV4B 3REJB 3MNND 1ZLAB 3W97B 3C1BB 3MNNB 3LZ0C 4H9PB 2AROB 3LZ1C 3REIA 1Q9CA 5AVCC 4R8PD 3W98D 3X1VA 4R8PB 1P3PD 5B2JA 1P3AD 3WTPD 1P34D 1KX3A 4KUDA 5GSUD 1P3PB 2L5AA 3RELC 3LELD 3MGQB 3WTPB 1P3AB 2CV5D 1BH8A 2YFWB 4J8UB 5GXQC 1TZYC 3KXBD 3LELB 2IO5C 4WU8A 1AOIC 1N1JB 3REHD 5E5AC 3KXBB 3AZED 2F8ND 4CAYA 1HQ3D 5C3IC 4YS3C 4QLCC 1F66B 3REHB 4J8XB 3VH6T 5AV6B 4JJNB 3AZGD 2HIOC 3X1UD 2F8NB 1HQ3B 5AV5D 4ZUXD 3R45A 3LZ0A 4G91B 3AZGB 3MGPD 2NQBA 3C1BA 1S32C 4NE6A 4H9SC 3LJAB 4ZUXB 4YM6D 3VH6W 3UT9D 1ID3D 4YM6B 5B0ZD 3AYWD 5B0YD 4Z5TB 5B32C 4XZQC 5AY8D 5BNVB 4ZBJC 5B0ZB 3AYWB 3AN2D 1P3BB 3X1SB 5JRGA 5B31C 1EQZD 5CP6C 3AZJA 2F8NH 5BS7A 5CPIA 4M6BA 2CWEA 5B31G 5DNMC 1AOIA 5KDMA 3TU4C 3MGQA 5F99D 1P3OA 4UUZB 4J8WA 3AZLC 1JFIB 3AZMA 1P3GB 5AV5C 1N1JA 5CPJD 3A6NC 3AFAC 1KX4D 3WKJA 1P3KC 4WU9D 4KHAA 4G92C 5B1LC 5AV6A 4JJNA 4H9SA 4Z66C 3UT9C 2PYOD 4WU9B 4XUJD 4J8VA 1KX5B 5AV9B 3O62C 5AY8C 3B0DB 4XUJB 3KWQB 3AZID 1P3IB 3V9RA 4HGAC 3W96B 3REID 5CPKA 3AV1B 5CHLB 4CSRA 3WAAB 2NZDB 2RVQC 1P3MA 5BNVA 1P3BA 5B1MA 5BNXB 1P3FA 3X1VD 1M19B 3VH5T 3X1SA 3B6FC 5FUGA 4H9QA 5B2JD 3AZKC 3X1VB 1KX3D 3UTBC 4KUDD 4LD9C 5B2JB 3VH5W 1KX3B 3MGRC 4KUDB 5GT0C 1M18B 1P3KA 4X23B 1P3GA 1U35C 3AZNC 4KGCC 1BH8B 3MVDC 3B0CW 5AVBC 2HUEC 3MGSD 1H3OB 5B2IC 4WU8B 3REKC 3AV2A 4AWLC 3C1CB 5B24C 4CAYB 1KX5A 2NQBD 3C1BD 5AV8A 5DNNC 1P3IA 3R45B 3LZ0B 2NQBB 3W96A 2AROD 3AV1A 3X1TA 3WAAA 2NZDA 3AZFC 5BNXA 1M1AC 1HTAA 3W99A 1M19A 5JRGD 3AZHC 2YFVA 5B40A 5CPID 5JRGB 4EO5C 3AZJB 3KSYA 2FJ7A 3MGQD 1U35A 3AZNA 3WA9A 5CPIB 1M18A 5GXQB 1TZYB 4J8UD 1P3LC 1P3OD 4X23A 3B6GA 4H9RA 4J8WD 5B33A 1AOIB 5KDMB 3AZMD 5GT3A 3REJC 5B24A 1P3OB 1ZLAC 4J8WB 3W97C 1H3OA 4QLCB 3UTAC 3AZMB 3WKJD 1F66D 4J8XD 5AV6D 4JJND 3MNNC 3C1CA 3KUYA 3WKJB 1B6WA 4NE5A 2AROC 4KHAB 4J8VD 3LJAD 4J8VB 4R8PC 3WTPE 3LZ1A 3B0BA 5AVCA 3W98C 5CPKD 3V9RB 4XZQB 4Z5TD 4ZBJB 1P3MD 1P3PC 5CPKB 1P3BD 5B1MD 4CSRB 1P3FD 1P3AC 3WTPC 1P34C 1KU5A 3X1SD 5GSUC 4WNNB 5B31B 4J8UC 1P3MB 4NFTA 5B1MB 3LELC 1P3FB 4WU8D 1B67A 5B32G 5DNMB 3RELA 2CV5C 5FUGB 3KXBC 3TU4B 4H9OA 4H9QB 4DRAA 4Z2MH 5GXQA 1TZYA 3REHC 3AZLB 1F66C 3AZEC 1P3GD 1HQ3C 5E5AA 3A6NB 3AFAB 3AZGC 3X1UC 1P3KB 4YS3A 4QLCA 5B1LB 3LJAC 4ZUXC 2HIOA 3AV2D 3MGPC 4NE3A 4YM6C 3AV2B 1KX5D 5AV9D 1ULYA 1S32A 5AV8D 1ID3C 4E45A 5B0ZC 3KWQD 3AYWC 2BYKB 1P3ID 5B0YC 3W96D 5AV8B 3AN2C 3X1TD 3AV1D 5BT1D 1P34A 3WAAD 2NZDD 5B32A 4XZQA 3X1TB 1EQZC 3W99D 1M19D 2CV5A 5B31A 4WNNA 5CP6A 3W99B 5F99C 5B40D 5DNMA 3AZEA 3TU4A 2BYMA 3VH6A 2FJ7D 2YFVB 5B40B 3AZLA 5CPJC 1M18D 1KX4C 3B6GD 5BO0A 4X23D 5AV5A 5B33D 3A6NA 3AFAA 4WU9C 2FJ7B 1U35B 5GT3D 1TAFA 3AZNB 3WA9B 4KGCB 2HUEB 3B6GB 4H9RB 5B33B 5B1LA 2PYOC 4AWLB 4XUJC 5GT3B
chains in the Genus database with same CATH superfamily
5B24B 4Z66A 3UT9A 2JSSA 3C1CD 3KUYD 1W2EA 3AZIC 3O62A 5AY8A 2Y2JA 3KUYB 3REIC 2BYKA 3LZ0D 3LZ1D 5AVCD 3KFUG 2G5HC 3X1VC 3LZ1B 1M1AB 5AVCB 5B2JC 3B6FA 1KX3C 4KUDC 2Y2QA 3AZKA 1T3UA 3NQUA 3UTBA 2G5IC 4WZSB 4EO5B 4LD9A 3RELD 3AZJD 3MGRA 5GT0A 1P3LB 5GXQD 1TZYD 3RELB 5JA4A 1AOID 4H9OB 3MGSC 2UWXA 4KGCA 5E5AD 3MVDA 5AVBA 2IO5B 1WWIA 2W8SA 5B2IA 4YS3D 3REKA 4QLCD 3UTAB 3AZIA 5E5AB 2HIOD 1A7WA 2NQBC 3C1BC 5C3IB 4YS3B 2HIOB 1S32D 5DNNA 4H9NA 3VH5A 1S32B 3W98B 2JE5A 5B32D 4XZQD 3AZFA 1M1AA 5JRGC 3AZJC 1P34B 5B32B 1BH9A 3AZHA 5GSUB 5BS7C 5CPIC 5B31D 5CP6D 3MGQC 2CV5B 5DNMD 5CP6B 1P3OC 3MGSA 3NQJA 4J8WC 3TU4D 3AZMC 1BFMA 1P3LA 1WWSA 3AZLD 3AZEB 2BYMB 3WKJC 3REJA 3A6ND 2ZY4A 3AFAD 1ZLAA 4J8XC 3W97A 5AV6C 3X1UB 4JJNC 3UTAA 5BO0B 1P3KD 5AV5B 2FFFB 2J8PA 5B1LD 3MNNA 3MGPB 1TAFB 4G91C 4H9PA 4J8VC 2F8NG 4Z66D 3EPKA 2AROA 4Z2MG 4G92B 2Y2MA 2ZY3A 4Z66B 3UT9B 1ID3B 3O62D 4R8PA 5CPKC 5B0YB 4Z5TC 3O62B 5AY8B 3AN2B 3W98A 1P3MC 4HGAB 1P3BC 5B1MC 1P3FC 2RVQD 1P3PA 3X1SC 1EQZB 1P3AA 3WTPA 3B6FD 5GSUA 2YFWA 4J8UA 3LELA 3AZKD 5F99B 2ZM5A 3UTBD 3B6FB 3B0DC 3KXBA 1R4VA 4WJ3C 2RIQA 4LD9D 3AZKB 1F1EA 1P3GC 3NQUB 3MGRD 4J8XA 3REHA 3UTBB 5CPJB 5GT0D 1F66A 1KX4B 2F8NA 4LD9B 1HQ3A 3MGRB 3AZGA 5GT0B 3AZND 1U35D 3X1UA 3MVDD 5AVBD 3AV2C 3WA9D 4KGCD 3LJAA 5JA4B 2LY8A 5B2ID 4ZUXA 3REKD 2VQRA 2PYOB 3AL0C 5G49B 3MGPA 3MVDB 5AVBB 1KX5C 5B24D 5AV9C 4YM6A 5B2IB 5AV8C 3REKB 3AZIB 3KWQC 1P3IC 4Z5TA 1ID3A 3W96C 5B0ZA 3REIB 5DNND 3AYWA 3AV1C 3X1TC 5B0YA 5BT1C 3WAAC 2NZDC 3AN2A 2Y2PA 5DNNB 4H9NB 3W99C 1M19C 4DRBA 3AZFD 1M1AD 1EQZA 3B0CT 4E44A 4UUZA 5B40C 3AZHD 3AZFB 1JFIA 5F99A 2FJ7C 1BH9B 3WA9C 3AZHB 1M18C 3B6GC 4X23C 5B33C 5CPJA 2F8NK 5GT3C 1P3LD 1KX4A 3MGSB 3NQJB 4WU9A 3REJD 4WU8C 5AV9A 1ZLAD 3W97D 3C1CC 2PYOA 3UTAD 4XUJA 3KWQA 3KUYC 5G49A 4WV4B 1Z2CB 3REJB 3MNND 1ZLAB 3W97B 3C1BB 3A1KA 3MNNB 3LZ0C 4H9PB 2XD1A 2AROB 3LZ1C 3REIA 1Q9CA 5AVCC 4R8PD 3W98D 3X1VA 4R8PB 1P3PD 2JCHA 5B2JA 1P3AD 3WTPD 1P34D 1KX3A 4KUDA 3F6TA 5GSUD 2L5AA 1P3PB 3RELC 2Y2IA 2DF4C 1PZRA 3LELD 3MGQB 3WTPB 2ZY2A 1P3AB 2CV5D 1BH8A 2YFWB 4J8UB 5GXQC 1TZYC 3KXBD 3LELB 2IO5C 4WU8A 1AOIC 1N1JB 2XD5A 3REHD 5E5AC 3KXBB 3AZED 2F8ND 4CAYA 1HQ3D 5C3IC 4YS3C 4QLCC 1F66B 3REHB 4J8XB 3VH6T 5AV6B 4JJNB 3AZGD 2HIOC 3X1UD 2F8NB 3H0MC 1HQ3B 5AV5D 4ZUXD 3R45A 3LZ0A 4G91B 3AZGB 3MGPD 2NQBA 3C1BA 1S32C 4NE6A 4H9SC 3LJAB 4ZUXB 4YM6D 3VH6W 3UT9D 1ID3D 4YM6B 5B0ZD 3AYWD 5B0YD 4Z5TB 5B32C 4XZQC 5AY8D 5BNVB 4ZBJC 5B0ZB 3AYWB 3AN2D 1P3BB 3EPLA 3X1SB 5JRGA 5B31C 1EQZD 5CP6C 3AZJA 2F8NH 5BS7A 5CPIA 4M6BA 2BG1A 2CWEA 5B31G 5DNMC 3EG5B 1AOIA 5KDMA 3TU4C 3MGQA 5F99D 1P3OA 4UUZB 4J8WA 3AZLC 1JFIB 3AZMA 1P3GB 2Y2HA 5AV5C 1N1JA 3H0LC 5CPJD 3A6NC 3AFAC 1KX4D 3EPJA 3A1IA 3WKJA 1P3KC 3P5JB 4WU9D 4KHAA 4G92C 5B1LC 5AV6A 4JJNA 4H9SA 4Z66C 3UT9C 2Y2NA 4WU9B 2PYOD 2ZY5A 4XUJD 4J8VA 1KX5B 5AV9B 3O62C 5AY8C 3B0DB 4XUJB 3KWQB 3AZID 1P3IB 3V9RA 4HGAC 3W96B 3REID 5CPKA 3AV1B 5CHLB 4CSRA 3WAAB 2NZDB 2RVQC 1P3MA 2Y2KA 5BNVA 2Y2GA 1P3BA 5B1MA 5BNXB 1P3FA 3X1VD 1M19B 3VH5T 3X1SA 3B6FC 5FUGA 4H9QA 5B2JD 3AZKC 3X1VB 1KX3D 3UTBC 4KUDD 4LD9C 5B2JB 3H0RC 3VH5W 1KX3B 3MGRC 4KUDB 5GT0C 1M18B 1P3KA 4X23B 1P3GA 1U35C 3AZNC 4KGCC 1BH8B 3MVDC 3B0CW 5AVBC 2HUEC 3MGSD 1H3OB 5B2IC 4WU8B 3REKC 3AV2A 4AWLC 3C1CB 5B24C 4CAYB 1KX5A 2NQBD 3C1BD 5AV8A 5DNNC 1P3IA 3R45B 3LZ0B 2NQBB 3W96A 2Y2LA 2AROD 3AV1A 3X1TA 3WAAA 2NZDA 3AZFC 5BNXA 1M1AC 1HTAA 3W99A 1M19A 5JRGD 3AZHC 3FDDA 2YFVA 5B40A 5CPID 5JRGB 4EO5C 3AZJB 3KSYA 2FJ7A 3MGQD 1U35A 3AZNA 3WA9A 2F2AC 5CPIB 5GXQB 1TZYB 4J8UD 1P3LC 1P3OD 4X23A 1M18A 3B6GA 4H9RA 4J8WD 5B33A 1AOIB 5KDMB 3AZMD 5GT3A 3REJC 5B24A 1P3OB 1ZLAC 4J8WB 3W97C 1H3OA 4QLCB 3UTAC 3AZMB 3WKJD 1F66D 4J8XD 5AV6D 4JJND 3MNNC 3C1CA 3KUYA 3WKJB 1B6WA 4NE5A 2AROC 4KHAB 4J8VD 3LJAD 4J8VB 2Y2OA 4R8PC 3WTPE 3LZ1A 3B0BA 5AVCA 3W98C 5CPKD 3V9RB 3EPHA 4XZQB 4Z5TD 4ZBJB 1P3MD 1P3PC 5CPKB 1P3BD 5B1MD 4CSRB 1P3FD 1P3AC 3WTPC 1P34C 1KU5A 3X1SD 5GSUC 4WNNB 5B31B 4J8UC 1P3MB 4NFTA 5B1MB 3LELC 1P3FB 4WU8D 1B67A 5B32G 5DNMB 3RELA 2CV5C 5FUGB 3KXBC 3TU4B 4H9OA 4H9QB 4DRAA 4Z2MH 5GXQA 1TZYA 3REHC 3AZLB 1F66C 3AZEC 1P3GD 1HQ3C 5E5AA 3A6NB 3AFAB 4UPKA 3AZGC 3X1UC 1P3KB 4YS3A 4QLCA 5B1LB 3LJAC 4DQYB 4ZUXC 2HIOA 3AV2D 3MGPC 4NE3A 4YM6C 3AV2B 1KX5D 5AV9D 1ULYA 1S32A 5AV8D 2PYOC 1ID3C 4E45A 5B0ZC 3KWQD 3AYWC 2BYKB 1P3ID 5B0YC 3W96D 5AV8B 3AN2C 3X1TD 3AV1D 5BT1D 1P34A 3WAAD 2NZDD 5B32A 4XZQA 3X1TB 1EQZC 3W99D 1M19D 2CV5A 5B31A 4WNNA 5CP6A 3W99B 5F99C 5B40D 5DNMA 3AZEA 3TU4A 2BYMA 3VH6A 2FJ7D 2YFVB 5B40B 3AZLA 5CPJC 1M18D 1KX4C 3B6GD 3IP4C 5BO0A 5AV5A 4X23D 5B33D 3A6NA 3AFAA 4WU9C 2FJ7B 1U35B 5GT3D 1TAFA 3AZNB 3WA9B 4KGCB 2HUEB 3B6GB 4H9RB 5B33B 5B1LA 2DQNC 4AWLB 4XUJC 5GT3B
chains in the Genus database with same CATH topology
5B24B 4Z66A 3UT9A 2JSSA 3C1CD 3KUYD 1W2EA 3AZIC 3O62A 5AY8A 2Y2JA 3KUYB 3REIC 2BYKA 3LZ0D 3LZ1D 5AVCD 3KFUG 2G5HC 3X1VC 3LZ1B 1M1AB 5AVCB 5B2JC 3B6FA 1KX3C 4KUDC 2Y2QA 3AZKA 1T3UA 3NQUA 3UTBA 2G5IC 4WZSB 4EO5B 4LD9A 3RELD 3AZJD 3MGRA 5GT0A 1P3LB 5GXQD 1TZYD 3RELB 5JA4A 1AOID 4H9OB 3MGSC 2UWXA 4KGCA 5E5AD 3MVDA 5AVBA 2IO5B 1WWIA 2W8SA 5B2IA 4YS3D 3REKA 4QLCD 3UTAB 3AZIA 5E5AB 2HIOD 1A7WA 2NQBC 3C1BC 5C3IB 4YS3B 2HIOB 1S32D 5DNNA 4H9NA 3VH5A 1S32B 3W98B 2JE5A 5B32D 4XZQD 3AZFA 1M1AA 5JRGC 3AZJC 1P34B 5B32B 1BH9A 3AZHA 5GSUB 5BS7C 5CPIC 5B31D 5CP6D 3MGQC 2CV5B 5DNMD 5CP6B 1P3OC 3MGSA 3NQJA 4J8WC 3TU4D 3AZMC 1BFMA 1P3LA 1WWSA 3AZLD 3AZEB 2BYMB 3WKJC 3REJA 3A6ND 2ZY4A 3AFAD 1ZLAA 4J8XC 3W97A 5AV6C 3X1UB 4JJNC 3UTAA 5BO0B 1P3KD 5AV5B 2FFFB 2J8PA 5B1LD 3MNNA 3MGPB 1TAFB 4G91C 4H9PA 4J8VC 2F8NG 4Z66D 3EPKA 2AROA 4Z2MG 4G92B 2Y2MA 2ZY3A 4Z66B 3UT9B 1ID3B 3O62D 4R8PA 5CPKC 5B0YB 4Z5TC 3O62B 5AY8B 3AN2B 3W98A 1P3MC 4HGAB 1P3BC 5B1MC 1P3FC 2RVQD 1P3PA 3X1SC 1EQZB 1P3AA 3WTPA 3B6FD 5GSUA 2YFWA 4J8UA 3LELA 3AZKD 5F99B 2ZM5A 3UTBD 3B6FB 3B0DC 3KXBA 1R4VA 4WJ3C 2RIQA 4LD9D 3AZKB 1F1EA 1P3GC 3NQUB 3MGRD 4J8XA 3REHA 3UTBB 5CPJB 5GT0D 1F66A 1KX4B 2F8NA 4LD9B 1HQ3A 3MGRB 3AZGA 5GT0B 3AZND 1U35D 3X1UA 3MVDD 5AVBD 3AV2C 3WA9D 4KGCD 3LJAA 5JA4B 2LY8A 5B2ID 4ZUXA 3REKD 2VQRA 2PYOB 3AL0C 5G49B 3MGPA 3MVDB 5AVBB 1KX5C 5B24D 5AV9C 4YM6A 5B2IB 5AV8C 3REKB 3AZIB 3KWQC 1P3IC 4Z5TA 1ID3A 3W96C 5B0ZA 3REIB 5DNND 3AYWA 3AV1C 3X1TC 5B0YA 5BT1C 3WAAC 2NZDC 3AN2A 2Y2PA 5DNNB 4H9NB 3W99C 1M19C 4DRBA 3AZFD 1M1AD 1EQZA 3B0CT 4E44A 4UUZA 5B40C 3AZHD 3AZFB 1JFIA 5F99A 2FJ7C 1BH9B 3WA9C 3AZHB 1M18C 3B6GC 4X23C 5B33C 5CPJA 2F8NK 5GT3C 1P3LD 1KX4A 3MGSB 3NQJB 4WU9A 3REJD 4WU8C 5AV9A 1ZLAD 3W97D 3C1CC 2PYOA 3UTAD 4XUJA 3KWQA 3KUYC 5G49A 4WV4B 1Z2CB 3REJB 3MNND 1ZLAB 3W97B 3C1BB 3A1KA 3MNNB 3LZ0C 4H9PB 2XD1A 2AROB 3LZ1C 3REIA 1Q9CA 5AVCC 4R8PD 3W98D 3X1VA 4R8PB 1P3PD 2JCHA 5B2JA 1P3AD 3WTPD 1P34D 1KX3A 4KUDA 3F6TA 5GSUD 2L5AA 1P3PB 3RELC 2Y2IA 2DF4C 1PZRA 3LELD 3MGQB 3WTPB 2ZY2A 1P3AB 2CV5D 1BH8A 2YFWB 4J8UB 5GXQC 1TZYC 3KXBD 3LELB 2IO5C 4WU8A 1AOIC 1N1JB 2XD5A 3REHD 5E5AC 3KXBB 3AZED 2F8ND 4CAYA 1HQ3D 5C3IC 4YS3C 4QLCC 1F66B 3REHB 4J8XB 3VH6T 5AV6B 4JJNB 3AZGD 2HIOC 3X1UD 2F8NB 3H0MC 1HQ3B 5AV5D 4ZUXD 3R45A 3LZ0A 4G91B 3AZGB 3MGPD 2NQBA 3C1BA 1S32C 4NE6A 4H9SC 3LJAB 4ZUXB 4YM6D 3VH6W 3UT9D 1ID3D 4YM6B 5B0ZD 3AYWD 5B0YD 4Z5TB 5B32C 4XZQC 5AY8D 5BNVB 4ZBJC 5B0ZB 3AYWB 3AN2D 1P3BB 3EPLA 3X1SB 5JRGA 5B31C 1EQZD 5CP6C 3AZJA 2F8NH 5BS7A 5CPIA 4M6BA 2BG1A 2CWEA 5B31G 5DNMC 3EG5B 1AOIA 5KDMA 3TU4C 3MGQA 5F99D 1P3OA 4UUZB 4J8WA 3AZLC 1JFIB 3AZMA 1P3GB 2Y2HA 5AV5C 1N1JA 3H0LC 5CPJD 3A6NC 3AFAC 1KX4D 3EPJA 3A1IA 3WKJA 1P3KC 3P5JB 4WU9D 4KHAA 4G92C 5B1LC 5AV6A 4JJNA 4H9SA 4Z66C 3UT9C 2Y2NA 4WU9B 2PYOD 2ZY5A 4XUJD 4J8VA 1KX5B 5AV9B 3O62C 5AY8C 3B0DB 4XUJB 3KWQB 3AZID 1P3IB 3V9RA 4HGAC 3W96B 3REID 5CPKA 3AV1B 5CHLB 4CSRA 3WAAB 2NZDB 2RVQC 1P3MA 2Y2KA 5BNVA 2Y2GA 1P3BA 5B1MA 5BNXB 1P3FA 3X1VD 1M19B 3VH5T 3X1SA 3B6FC 5FUGA 4H9QA 5B2JD 3AZKC 3X1VB 1KX3D 3UTBC 4KUDD 4LD9C 5B2JB 3H0RC 3VH5W 1KX3B 3MGRC 4KUDB 5GT0C 1M18B 1P3KA 4X23B 1P3GA 1U35C 3AZNC 4KGCC 1BH8B 3MVDC 3B0CW 5AVBC 2HUEC 3MGSD 1H3OB 5B2IC 4WU8B 3REKC 3AV2A 4AWLC 3C1CB 5B24C 4CAYB 1KX5A 2NQBD 3C1BD 5AV8A 5DNNC 1P3IA 3R45B 3LZ0B 2NQBB 3W96A 2Y2LA 2AROD 3AV1A 3X1TA 3WAAA 2NZDA 3AZFC 5BNXA 1M1AC 1HTAA 3W99A 1M19A 5JRGD 3AZHC 3FDDA 2YFVA 5B40A 5CPID 5JRGB 4EO5C 3AZJB 3KSYA 2FJ7A 3MGQD 1U35A 3AZNA 3WA9A 2F2AC 5CPIB 5GXQB 1TZYB 4J8UD 1P3LC 1P3OD 4X23A 1M18A 3B6GA 4H9RA 4J8WD 5B33A 1AOIB 5KDMB 3AZMD 5GT3A 3REJC 5B24A 1P3OB 1ZLAC 4J8WB 3W97C 1H3OA 4QLCB 3UTAC 3AZMB 3WKJD 1F66D 4J8XD 5AV6D 4JJND 3MNNC 3C1CA 3KUYA 3WKJB 1B6WA 4NE5A 2AROC 4KHAB 4J8VD 3LJAD 4J8VB 2Y2OA 4R8PC 3WTPE 3LZ1A 3B0BA 5AVCA 3W98C 5CPKD 3V9RB 3EPHA 4XZQB 4Z5TD 4ZBJB 1P3MD 1P3PC 5CPKB 1P3BD 5B1MD 4CSRB 1P3FD 1P3AC 3WTPC 1P34C 1KU5A 3X1SD 5GSUC 4WNNB 5B31B 4J8UC 1P3MB 4NFTA 5B1MB 3LELC 1P3FB 4WU8D 1B67A 5B32G 5DNMB 3RELA 2CV5C 5FUGB 3KXBC 3TU4B 4H9OA 4H9QB 4DRAA 4Z2MH 5GXQA 1TZYA 3REHC 3AZLB 1F66C 3AZEC 1P3GD 1HQ3C 5E5AA 3A6NB 3AFAB 4UPKA 3AZGC 3X1UC 1P3KB 4YS3A 4QLCA 5B1LB 3LJAC 4DQYB 4ZUXC 2HIOA 3AV2D 3MGPC 4NE3A 4YM6C 3AV2B 1KX5D 5AV9D 1ULYA 1S32A 5AV8D 2PYOC 1ID3C 4E45A 5B0ZC 3KWQD 3AYWC 2BYKB 1P3ID 5B0YC 3W96D 5AV8B 3AN2C 3X1TD 3AV1D 5BT1D 1P34A 3WAAD 2NZDD 5B32A 4XZQA 3X1TB 1EQZC 3W99D 1M19D 2CV5A 5B31A 4WNNA 5CP6A 3W99B 5F99C 5B40D 5DNMA 3AZEA 3TU4A 2BYMA 3VH6A 2FJ7D 2YFVB 5B40B 3AZLA 5CPJC 1M18D 1KX4C 3B6GD 3IP4C 5BO0A 5AV5A 4X23D 5B33D 3A6NA 3AFAA 4WU9C 2FJ7B 1U35B 5GT3D 1TAFA 3AZNB 3WA9B 4KGCB 2HUEB 3B6GB 4H9RB 5B33B 5B1LA 2DQNC 4AWLB 4XUJC 5GT3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B24 B;  4Z66 A;  3UT9 A;  2JSS A;  3C1C D;  3KUY D;  3AZI C;  3O62 A;  5AY8 A;  3KUY B;  3REI C;  2BYK A;  3LZ0 D;  3LZ1 D;  5AVC D;  3X1V C;  3LZ1 B;  1M1A B;  5AVC B;  5B2J C;  3B6F A;  1KX3 C;  4KUD C;  3AZK A;  3NQU A;  3UTB A;  4WZS B;  4EO5 B;  4LD9 A;  3REL D;  3AZJ D;  3MGR A;  5GT0 A;  1P3L B;  5GXQ D;  1TZY D;  3REL B;  5JA4 A;  1AOI D;  4H9O B;  3MGS C;  4KGC A;  5E5A D;  3MVD A;  5AVB A;  2IO5 B;  1WWI A;  5B2I A;  3REK A;  4YS3 D;  3UTA B;  4QLC D;  3AZI A;  5E5A B;  2HIO D;  1A7W A;  2NQB C;  3C1B C;  5C3I B;  4YS3 B;  2HIO B;  1S32 D;  5DNN A;  4H9N A;  3VH5 A;  1S32 B;  3W98 B;  5B32 D;  4XZQ D;  3AZF A;  1M1A A;  5JRG C;  3AZJ C;  1P34 B;  5B32 B;  1BH9 A;  3AZH A;  5GSU B;  5BS7 C;  5CPI C;  5B31 D;  5CP6 D;  3MGQ C;  2CV5 B;  5DNM D;  5CP6 B;  1P3O C;  3MGS A;  3NQJ A;  4J8W C;  3TU4 D;  3AZM C;  1BFM A;  1P3L A;  1WWS A;  3AZL D;  3AZE B;  2BYM B;  3WKJ C;  3REJ A;  3A6N D;  3AFA D;  1ZLA A;  4J8X C;  3W97 A;  5AV6 C;  3X1U B;  4JJN C;  3UTA A;  5BO0 B;  1P3K D;  5AV5 B;  5B1L D;  3MNN A;  3MGP B;  1TAF B;  4G91 C;  4H9P A;  4J8V C;  2F8N G;  4Z66 D;  2ARO A;  4Z2M G;  4G92 B;  4Z66 B;  3UT9 B;  1ID3 B;  3O62 D;  4R8P A;  5CPK C;  5B0Y B;  4Z5T C;  3O62 B;  5AY8 B;  3AN2 B;  3W98 A;  1P3M C;  4HGA B;  1P3B C;  5B1M C;  1P3F C;  2RVQ D;  1P3P A;  3X1S C;  1EQZ B;  1P3A A;  3WTP A;  3B6F D;  5GSU A;  2YFW A;  4J8U A;  3LEL A;  3AZK D;  5F99 B;  3UTB D;  3B6F B;  3B0D C;  3KXB A;  1R4V A;  4LD9 D;  3AZK B;  1F1E A;  1P3G C;  3NQU B;  3MGR D;  4J8X A;  3REH A;  3UTB B;  5CPJ B;  5GT0 D;  1F66 A;  1KX4 B;  2F8N A;  4LD9 B;  1HQ3 A;  3MGR B;  3AZG A;  5GT0 B;  3AZN D;  1U35 D;  3X1U A;  3MVD D;  5AVB D;  3AV2 C;  3WA9 D;  4KGC D;  3LJA A;  5JA4 B;  2LY8 A;  5B2I D;  4ZUX A;  3REK D;  2PYO B;  5G49 B;  3MGP A;  3MVD B;  5AVB B;  1KX5 C;  5B24 D;  5AV9 C;  4YM6 A;  5B2I B;  5AV8 C;  3REK B;  3AZI B;  3KWQ C;  1P3I C;  4Z5T A;  1ID3 A;  3W96 C;  5B0Z A;  3REI B;  5DNN D;  3AYW A;  3AV1 C;  3X1T C;  5B0Y A;  5BT1 C;  3WAA C;  2NZD C;  3AN2 A;  5DNN B;  4H9N B;  3W99 C;  1M19 C;  4DRB A;  3AZF D;  1M1A D;  1EQZ A;  3B0C T;  4E44 A;  4UUZ A;  5B40 C;  3AZH D;  3AZF B;  1JFI A;  5F99 A;  2FJ7 C;  1BH9 B;  3WA9 C;  3AZH B;  1M18 C;  3B6G C;  4X23 C;  5B33 C;  5CPJ A;  2F8N K;  5GT3 C;  1P3L D;  1KX4 A;  3MGS B;  3NQJ B;  4WU9 A;  3REJ D;  4WU8 C;  5AV9 A;  1ZLA D;  3W97 D;  3C1C C;  2PYO A;  3UTA D;  4XUJ A;  3KWQ A;  3KUY C;  5G49 A;  4WV4 B;  3REJ B;  3MNN D;  1ZLA B;  3W97 B;  3C1B B;  3MNN B;  3LZ0 C;  4H9P B;  2ARO B;  3LZ1 C;  3REI A;  1Q9C A;  5AVC C;  4R8P D;  3W98 D;  3X1V A;  4R8P B;  1P3P D;  5B2J A;  1P3A D;  3WTP D;  1P34 D;  1KX3 A;  4KUD A;  5GSU D;  1P3P B;  2L5A A;  3REL C;  3LEL D;  3MGQ B;  3WTP B;  1P3A B;  2CV5 D;  1BH8 A;  2YFW B;  4J8U B;  5GXQ C;  1TZY C;  3KXB D;  3LEL B;  2IO5 C;  4WU8 A;  1AOI C;  1N1J B;  3REH D;  5E5A C;  3KXB B;  3AZE D;  2F8N D;  4CAY A;  1HQ3 D;  5C3I C;  4YS3 C;  4QLC C;  1F66 B;  3REH B;  4J8X B;  3VH6 T;  5AV6 B;  4JJN B;  3AZG D;  2HIO C;  3X1U D;  2F8N B;  1HQ3 B;  5AV5 D;  4ZUX D;  3R45 A;  3LZ0 A;  4G91 B;  3AZG B;  3MGP D;  2NQB A;  3C1B A;  1S32 C;  4NE6 A;  4H9S C;  3LJA B;  4ZUX B;  4YM6 D;  3VH6 W;  3UT9 D;  1ID3 D;  4YM6 B;  5B0Z D;  3AYW D;  5B0Y D;  4Z5T B;  5B32 C;  4XZQ C;  5AY8 D;  5BNV B;  4ZBJ C;  5B0Z B;  3AYW B;  3AN2 D;  1P3B B;  3X1S B;  5JRG A;  5B31 C;  1EQZ D;  5CP6 C;  3AZJ A;  2F8N H;  5BS7 A;  5CPI A;  4M6B A;  2CWE A;  5B31 G;  5DNM C;  1AOI A;  5KDM A;  3TU4 C;  3MGQ A;  5F99 D;  1P3O A;  4UUZ B;  4J8W A;  3AZL C;  1JFI B;  3AZM A;  1P3G B;  5AV5 C;  1N1J A;  5CPJ D;  3A6N C;  3AFA C;  1KX4 D;  3WKJ A;  1P3K C;  4WU9 D;  4KHA A;  4G92 C;  5B1L C;  5AV6 A;  4JJN A;  4H9S A;  4Z66 C;  3UT9 C;  2PYO D;  4WU9 B;  4XUJ D;  4J8V A;  1KX5 B;  5AV9 B;  3O62 C;  5AY8 C;  3B0D B;  4XUJ B;  3KWQ B;  3AZI D;  1P3I B;  3V9R A;  4HGA C;  3W96 B;  3REI D;  5CPK A;  3AV1 B;  5CHL B;  4CSR A;  3WAA B;  2NZD B;  2RVQ C;  1P3M A;  5BNV A;  1P3B A;  5B1M A;  5BNX B;  1P3F A;  3X1V D;  1M19 B;  3VH5 T;  3X1S A;  3B6F C;  5FUG A;  4H9Q A;  5B2J D;  3AZK C;  3X1V B;  1KX3 D;  3UTB C;  4KUD D;  4LD9 C;  5B2J B;  3VH5 W;  1KX3 B;  3MGR C;  4KUD B;  5GT0 C;  1M18 B;  1P3K A;  4X23 B;  1P3G A;  1U35 C;  3AZN C;  4KGC C;  1BH8 B;  3MVD C;  3B0C W;  5AVB C;  2HUE C;  3MGS D;  1H3O B;  5B2I C;  4WU8 B;  3REK C;  3AV2 A;  4AWL C;  3C1C B;  5B24 C;  4CAY B;  1KX5 A;  2NQB D;  3C1B D;  5AV8 A;  5DNN C;  1P3I A;  3R45 B;  3LZ0 B;  2NQB B;  3W96 A;  2ARO D;  3AV1 A;  3X1T A;  3WAA A;  2NZD A;  3AZF C;  5BNX A;  1M1A C;  1HTA A;  3W99 A;  1M19 A;  5JRG D;  3AZH C;  2YFV A;  5B40 A;  5CPI D;  5JRG B;  4EO5 C;  3AZJ B;  3KSY A;  2FJ7 A;  3MGQ D;  1U35 A;  3AZN A;  3WA9 A;  5CPI B;  1M18 A;  5GXQ B;  1TZY B;  4J8U D;  1P3L C;  1P3O D;  4X23 A;  3B6G A;  4H9R A;  4J8W D;  5B33 A;  1AOI B;  5KDM B;  3AZM D;  5GT3 A;  3REJ C;  5B24 A;  1P3O B;  1ZLA C;  4J8W B;  3W97 C;  1H3O A;  4QLC B;  3UTA C;  3AZM B;  3WKJ D;  1F66 D;  4J8X D;  5AV6 D;  4JJN D;  3MNN C;  3C1C A;  3KUY A;  3WKJ B;  1B6W A;  4NE5 A;  2ARO C;  4KHA B;  4J8V D;  3LJA D;  4J8V B;  4R8P C;  3WTP E;  3LZ1 A;  3B0B A;  5AVC A;  3W98 C;  5CPK D;  3V9R B;  4XZQ B;  4Z5T D;  4ZBJ B;  1P3M D;  1P3P C;  5CPK B;  1P3B D;  5B1M D;  4CSR B;  1P3F D;  1P3A C;  3WTP C;  1P34 C;  1KU5 A;  3X1S D;  5GSU C;  4WNN B;  5B31 B;  4J8U C;  1P3M B;  4NFT A;  5B1M B;  3LEL C;  1P3F B;  4WU8 D;  1B67 A;  5B32 G;  5DNM B;  3REL A;  2CV5 C;  5FUG B;  3KXB C;  3TU4 B;  4H9O A;  4H9Q B;  4DRA A;  4Z2M H;  5GXQ A;  1TZY A;  3REH C;  3AZL B;  1F66 C;  3AZE C;  1P3G D;  1HQ3 C;  5E5A A;  3A6N B;  3AFA B;  3AZG C;  3X1U C;  1P3K B;  4YS3 A;  4QLC A;  5B1L B;  3LJA C;  4ZUX C;  2HIO A;  3AV2 D;  3MGP C;  4NE3 A;  4YM6 C;  3AV2 B;  1KX5 D;  5AV9 D;  1ULY A;  1S32 A;  5AV8 D;  1ID3 C;  4E45 A;  5B0Z C;  3KWQ D;  3AYW C;  2BYK B;  1P3I D;  5B0Y C;  3W96 D;  5AV8 B;  3AN2 C;  3X1T D;  3AV1 D;  5BT1 D;  1P34 A;  3WAA D;  2NZD D;  5B32 A;  4XZQ A;  3X1T B;  1EQZ C;  3W99 D;  1M19 D;  2CV5 A;  5B31 A;  4WNN A;  5CP6 A;  3W99 B;  5F99 C;  5B40 D;  5DNM A;  3AZE A;  3TU4 A;  2BYM A;  3VH6 A;  2FJ7 D;  2YFV B;  5B40 B;  3AZL A;  5CPJ C;  1M18 D;  1KX4 C;  3B6G D;  5BO0 A;  4X23 D;  5AV5 A;  5B33 D;  3A6N A;  3AFA A;  4WU9 C;  2FJ7 B;  1U35 B;  5GT3 D;  1TAF A;  3AZN B;  3WA9 B;  4KGC B;  2HUE B;  3B6G B;  4H9R B;  5B33 B;  5B1L A;  2PYO C;  4AWL B;  4XUJ C;  5GT3 B; 
#chains in the Genus database with same CATH topology
 5B24 B;  4Z66 A;  3UT9 A;  2JSS A;  3C1C D;  3KUY D;  1W2E A;  3AZI C;  3O62 A;  5AY8 A;  2Y2J A;  3KUY B;  3REI C;  2BYK A;  3LZ0 D;  3LZ1 D;  5AVC D;  3KFU G;  2G5H C;  3X1V C;  3LZ1 B;  1M1A B;  5AVC B;  5B2J C;  3B6F A;  1KX3 C;  4KUD C;  2Y2Q A;  3AZK A;  1T3U A;  3NQU A;  3UTB A;  2G5I C;  4WZS B;  4EO5 B;  4LD9 A;  3REL D;  3AZJ D;  3MGR A;  5GT0 A;  1P3L B;  5GXQ D;  1TZY D;  3REL B;  5JA4 A;  1AOI D;  4H9O B;  3MGS C;  2UWX A;  4KGC A;  5E5A D;  3MVD A;  5AVB A;  2IO5 B;  1WWI A;  2W8S A;  5B2I A;  4YS3 D;  3REK A;  4QLC D;  3UTA B;  3AZI A;  5E5A B;  2HIO D;  1A7W A;  2NQB C;  3C1B C;  5C3I B;  4YS3 B;  2HIO B;  1S32 D;  5DNN A;  4H9N A;  3VH5 A;  1S32 B;  3W98 B;  2JE5 A;  5B32 D;  4XZQ D;  3AZF A;  1M1A A;  5JRG C;  3AZJ C;  1P34 B;  5B32 B;  1BH9 A;  3AZH A;  5GSU B;  5BS7 C;  5CPI C;  5B31 D;  5CP6 D;  3MGQ C;  2CV5 B;  5DNM D;  5CP6 B;  1P3O C;  3MGS A;  3NQJ A;  4J8W C;  3TU4 D;  3AZM C;  1BFM A;  1P3L A;  1WWS A;  3AZL D;  3AZE B;  2BYM B;  3WKJ C;  3REJ A;  3A6N D;  2ZY4 A;  3AFA D;  1ZLA A;  4J8X C;  3W97 A;  5AV6 C;  3X1U B;  4JJN C;  3UTA A;  5BO0 B;  1P3K D;  5AV5 B;  2FFF B;  2J8P A;  5B1L D;  3MNN A;  3MGP B;  1TAF B;  4G91 C;  4H9P A;  4J8V C;  2F8N G;  4Z66 D;  3EPK A;  2ARO A;  4Z2M G;  4G92 B;  2Y2M A;  2ZY3 A;  4Z66 B;  3UT9 B;  1ID3 B;  3O62 D;  4R8P A;  5CPK C;  5B0Y B;  4Z5T C;  3O62 B;  5AY8 B;  3AN2 B;  3W98 A;  1P3M C;  4HGA B;  1P3B C;  5B1M C;  1P3F C;  2RVQ D;  1P3P A;  3X1S C;  1EQZ B;  1P3A A;  3WTP A;  3B6F D;  5GSU A;  2YFW A;  4J8U A;  3LEL A;  3AZK D;  5F99 B;  2ZM5 A;  3UTB D;  3B6F B;  3B0D C;  3KXB A;  1R4V A;  4WJ3 C;  2RIQ A;  4LD9 D;  3AZK B;  1F1E A;  1P3G C;  3NQU B;  3MGR D;  4J8X A;  3REH A;  3UTB B;  5CPJ B;  5GT0 D;  1F66 A;  1KX4 B;  2F8N A;  4LD9 B;  1HQ3 A;  3MGR B;  3AZG A;  5GT0 B;  3AZN D;  1U35 D;  3X1U A;  3MVD D;  5AVB D;  3AV2 C;  3WA9 D;  4KGC D;  3LJA A;  5JA4 B;  2LY8 A;  5B2I D;  4ZUX A;  3REK D;  2VQR A;  2PYO B;  3AL0 C;  5G49 B;  3MGP A;  3MVD B;  5AVB B;  1KX5 C;  5B24 D;  5AV9 C;  4YM6 A;  5B2I B;  5AV8 C;  3REK B;  3AZI B;  3KWQ C;  1P3I C;  4Z5T A;  1ID3 A;  3W96 C;  5B0Z A;  3REI B;  5DNN D;  3AYW A;  3AV1 C;  3X1T C;  5B0Y A;  5BT1 C;  3WAA C;  2NZD C;  3AN2 A;  2Y2P A;  5DNN B;  4H9N B;  3W99 C;  1M19 C;  4DRB A;  3AZF D;  1M1A D;  1EQZ A;  3B0C T;  4E44 A;  4UUZ A;  5B40 C;  3AZH D;  3AZF B;  1JFI A;  5F99 A;  2FJ7 C;  1BH9 B;  3WA9 C;  3AZH B;  1M18 C;  3B6G C;  4X23 C;  5B33 C;  5CPJ A;  2F8N K;  5GT3 C;  1P3L D;  1KX4 A;  3MGS B;  3NQJ B;  4WU9 A;  3REJ D;  4WU8 C;  5AV9 A;  1ZLA D;  3W97 D;  3C1C C;  2PYO A;  3UTA D;  4XUJ A;  3KWQ A;  3KUY C;  5G49 A;  4WV4 B;  1Z2C B;  3REJ B;  3MNN D;  1ZLA B;  3W97 B;  3C1B B;  3A1K A;  3MNN B;  3LZ0 C;  4H9P B;  2XD1 A;  2ARO B;  3LZ1 C;  3REI A;  1Q9C A;  5AVC C;  4R8P D;  3W98 D;  3X1V A;  4R8P B;  1P3P D;  2JCH A;  5B2J A;  1P3A D;  3WTP D;  1P34 D;  1KX3 A;  4KUD A;  3F6T A;  5GSU D;  2L5A A;  1P3P B;  3REL C;  2Y2I A;  2DF4 C;  1PZR A;  3LEL D;  3MGQ B;  3WTP B;  2ZY2 A;  1P3A B;  2CV5 D;  1BH8 A;  2YFW B;  4J8U B;  5GXQ C;  1TZY C;  3KXB D;  3LEL B;  2IO5 C;  4WU8 A;  1AOI C;  1N1J B;  2XD5 A;  3REH D;  5E5A C;  3KXB B;  3AZE D;  2F8N D;  4CAY A;  1HQ3 D;  5C3I C;  4YS3 C;  4QLC C;  1F66 B;  3REH B;  4J8X B;  3VH6 T;  5AV6 B;  4JJN B;  3AZG D;  2HIO C;  3X1U D;  2F8N B;  3H0M C;  1HQ3 B;  5AV5 D;  4ZUX D;  3R45 A;  3LZ0 A;  4G91 B;  3AZG B;  3MGP D;  2NQB A;  3C1B A;  1S32 C;  4NE6 A;  4H9S C;  3LJA B;  4ZUX B;  4YM6 D;  3VH6 W;  3UT9 D;  1ID3 D;  4YM6 B;  5B0Z D;  3AYW D;  5B0Y D;  4Z5T B;  5B32 C;  4XZQ C;  5AY8 D;  5BNV B;  4ZBJ C;  5B0Z B;  3AYW B;  3AN2 D;  1P3B B;  3EPL A;  3X1S B;  5JRG A;  5B31 C;  1EQZ D;  5CP6 C;  3AZJ A;  2F8N H;  5BS7 A;  5CPI A;  4M6B A;  2BG1 A;  2CWE A;  5B31 G;  5DNM C;  3EG5 B;  1AOI A;  5KDM A;  3TU4 C;  3MGQ A;  5F99 D;  1P3O A;  4UUZ B;  4J8W A;  3AZL C;  1JFI B;  3AZM A;  1P3G B;  2Y2H A;  5AV5 C;  1N1J A;  3H0L C;  5CPJ D;  3A6N C;  3AFA C;  1KX4 D;  3EPJ A;  3A1I A;  3WKJ A;  1P3K C;  3P5J B;  4WU9 D;  4KHA A;  4G92 C;  5B1L C;  5AV6 A;  4JJN A;  4H9S A;  4Z66 C;  3UT9 C;  2Y2N A;  4WU9 B;  2PYO D;  2ZY5 A;  4XUJ D;  4J8V A;  1KX5 B;  5AV9 B;  3O62 C;  5AY8 C;  3B0D B;  4XUJ B;  3KWQ B;  3AZI D;  1P3I B;  3V9R A;  4HGA C;  3W96 B;  3REI D;  5CPK A;  3AV1 B;  5CHL B;  4CSR A;  3WAA B;  2NZD B;  2RVQ C;  1P3M A;  2Y2K A;  5BNV A;  2Y2G A;  1P3B A;  5B1M A;  5BNX B;  1P3F A;  3X1V D;  1M19 B;  3VH5 T;  3X1S A;  3B6F C;  5FUG A;  4H9Q A;  5B2J D;  3AZK C;  3X1V B;  1KX3 D;  3UTB C;  4KUD D;  4LD9 C;  5B2J B;  3H0R C;  3VH5 W;  1KX3 B;  3MGR C;  4KUD B;  5GT0 C;  1M18 B;  1P3K A;  4X23 B;  1P3G A;  1U35 C;  3AZN C;  4KGC C;  1BH8 B;  3MVD C;  3B0C W;  5AVB C;  2HUE C;  3MGS D;  1H3O B;  5B2I C;  4WU8 B;  3REK C;  3AV2 A;  4AWL C;  3C1C B;  5B24 C;  4CAY B;  1KX5 A;  2NQB D;  3C1B D;  5AV8 A;  5DNN C;  1P3I A;  3R45 B;  3LZ0 B;  2NQB B;  3W96 A;  2Y2L A;  2ARO D;  3AV1 A;  3X1T A;  3WAA A;  2NZD A;  3AZF C;  5BNX A;  1M1A C;  1HTA A;  3W99 A;  1M19 A;  5JRG D;  3AZH C;  3FDD A;  2YFV A;  5B40 A;  5CPI D;  5JRG B;  4EO5 C;  3AZJ B;  3KSY A;  2FJ7 A;  3MGQ D;  1U35 A;  3AZN A;  3WA9 A;  2F2A C;  5CPI B;  5GXQ B;  1TZY B;  4J8U D;  1P3L C;  1P3O D;  4X23 A;  1M18 A;  3B6G A;  4H9R A;  4J8W D;  5B33 A;  1AOI B;  5KDM B;  3AZM D;  5GT3 A;  3REJ C;  5B24 A;  1P3O B;  1ZLA C;  4J8W B;  3W97 C;  1H3O A;  4QLC B;  3UTA C;  3AZM B;  3WKJ D;  1F66 D;  4J8X D;  5AV6 D;  4JJN D;  3MNN C;  3C1C A;  3KUY A;  3WKJ B;  1B6W A;  4NE5 A;  2ARO C;  4KHA B;  4J8V D;  3LJA D;  4J8V B;  2Y2O A;  4R8P C;  3WTP E;  3LZ1 A;  3B0B A;  5AVC A;  3W98 C;  5CPK D;  3V9R B;  3EPH A;  4XZQ B;  4Z5T D;  4ZBJ B;  1P3M D;  1P3P C;  5CPK B;  1P3B D;  5B1M D;  4CSR B;  1P3F D;  1P3A C;  3WTP C;  1P34 C;  1KU5 A;  3X1S D;  5GSU C;  4WNN B;  5B31 B;  4J8U C;  1P3M B;  4NFT A;  5B1M B;  3LEL C;  1P3F B;  4WU8 D;  1B67 A;  5B32 G;  5DNM B;  3REL A;  2CV5 C;  5FUG B;  3KXB C;  3TU4 B;  4H9O A;  4H9Q B;  4DRA A;  4Z2M H;  5GXQ A;  1TZY A;  3REH C;  3AZL B;  1F66 C;  3AZE C;  1P3G D;  1HQ3 C;  5E5A A;  3A6N B;  3AFA B;  4UPK A;  3AZG C;  3X1U C;  1P3K B;  4YS3 A;  4QLC A;  5B1L B;  3LJA C;  4DQY B;  4ZUX C;  2HIO A;  3AV2 D;  3MGP C;  4NE3 A;  4YM6 C;  3AV2 B;  1KX5 D;  5AV9 D;  1ULY A;  1S32 A;  5AV8 D;  2PYO C;  1ID3 C;  4E45 A;  5B0Z C;  3KWQ D;  3AYW C;  2BYK B;  1P3I D;  5B0Y C;  3W96 D;  5AV8 B;  3AN2 C;  3X1T D;  3AV1 D;  5BT1 D;  1P34 A;  3WAA D;  2NZD D;  5B32 A;  4XZQ A;  3X1T B;  1EQZ C;  3W99 D;  1M19 D;  2CV5 A;  5B31 A;  4WNN A;  5CP6 A;  3W99 B;  5F99 C;  5B40 D;  5DNM A;  3AZE A;  3TU4 A;  2BYM A;  3VH6 A;  2FJ7 D;  2YFV B;  5B40 B;  3AZL A;  5CPJ C;  1M18 D;  1KX4 C;  3B6G D;  3IP4 C;  5BO0 A;  5AV5 A;  4X23 D;  5B33 D;  3A6N A;  3AFA A;  4WU9 C;  2FJ7 B;  1U35 B;  5GT3 D;  1TAF A;  3AZN B;  3WA9 B;  4KGC B;  2HUE B;  3B6G B;  4H9R B;  5B33 B;  5B1L A;  2DQN C;  4AWL B;  4XUJ C;  5GT3 B; 
#chains in the Genus database with same CATH homology
 5B24 B;  4Z66 A;  3UT9 A;  2JSS A;  3C1C D;  3KUY D;  1W2E A;  3AZI C;  3O62 A;  5AY8 A;  2Y2J A;  3KUY B;  3REI C;  2BYK A;  3LZ0 D;  3LZ1 D;  5AVC D;  3KFU G;  2G5H C;  3X1V C;  3LZ1 B;  1M1A B;  5AVC B;  5B2J C;  3B6F A;  1KX3 C;  4KUD C;  2Y2Q A;  3AZK A;  1T3U A;  3NQU A;  3UTB A;  2G5I C;  4WZS B;  4EO5 B;  4LD9 A;  3REL D;  3AZJ D;  3MGR A;  5GT0 A;  1P3L B;  5GXQ D;  1TZY D;  3REL B;  5JA4 A;  1AOI D;  4H9O B;  3MGS C;  2UWX A;  4KGC A;  5E5A D;  3MVD A;  5AVB A;  2IO5 B;  1WWI A;  2W8S A;  5B2I A;  4YS3 D;  3REK A;  4QLC D;  3UTA B;  3AZI A;  5E5A B;  2HIO D;  1A7W A;  2NQB C;  3C1B C;  5C3I B;  4YS3 B;  2HIO B;  1S32 D;  5DNN A;  4H9N A;  3VH5 A;  1S32 B;  3W98 B;  2JE5 A;  5B32 D;  4XZQ D;  3AZF A;  1M1A A;  5JRG C;  3AZJ C;  1P34 B;  5B32 B;  1BH9 A;  3AZH A;  5GSU B;  5BS7 C;  5CPI C;  5B31 D;  5CP6 D;  3MGQ C;  2CV5 B;  5DNM D;  5CP6 B;  1P3O C;  3MGS A;  3NQJ A;  4J8W C;  3TU4 D;  3AZM C;  1BFM A;  1P3L A;  1WWS A;  3AZL D;  3AZE B;  2BYM B;  3WKJ C;  3REJ A;  3A6N D;  2ZY4 A;  3AFA D;  1ZLA A;  4J8X C;  3W97 A;  5AV6 C;  3X1U B;  4JJN C;  3UTA A;  5BO0 B;  1P3K D;  5AV5 B;  2FFF B;  2J8P A;  5B1L D;  3MNN A;  3MGP B;  1TAF B;  4G91 C;  4H9P A;  4J8V C;  2F8N G;  4Z66 D;  3EPK A;  2ARO A;  4Z2M G;  4G92 B;  2Y2M A;  2ZY3 A;  4Z66 B;  3UT9 B;  1ID3 B;  3O62 D;  4R8P A;  5CPK C;  5B0Y B;  4Z5T C;  3O62 B;  5AY8 B;  3AN2 B;  3W98 A;  1P3M C;  4HGA B;  1P3B C;  5B1M C;  1P3F C;  2RVQ D;  1P3P A;  3X1S C;  1EQZ B;  1P3A A;  3WTP A;  3B6F D;  5GSU A;  2YFW A;  4J8U A;  3LEL A;  3AZK D;  5F99 B;  2ZM5 A;  3UTB D;  3B6F B;  3B0D C;  3KXB A;  1R4V A;  4WJ3 C;  2RIQ A;  4LD9 D;  3AZK B;  1F1E A;  1P3G C;  3NQU B;  3MGR D;  4J8X A;  3REH A;  3UTB B;  5CPJ B;  5GT0 D;  1F66 A;  1KX4 B;  2F8N A;  4LD9 B;  1HQ3 A;  3MGR B;  3AZG A;  5GT0 B;  3AZN D;  1U35 D;  3X1U A;  3MVD D;  5AVB D;  3AV2 C;  3WA9 D;  4KGC D;  3LJA A;  5JA4 B;  2LY8 A;  5B2I D;  4ZUX A;  3REK D;  2VQR A;  2PYO B;  3AL0 C;  5G49 B;  3MGP A;  3MVD B;  5AVB B;  1KX5 C;  5B24 D;  5AV9 C;  4YM6 A;  5B2I B;  5AV8 C;  3REK B;  3AZI B;  3KWQ C;  1P3I C;  4Z5T A;  1ID3 A;  3W96 C;  5B0Z A;  3REI B;  5DNN D;  3AYW A;  3AV1 C;  3X1T C;  5B0Y A;  5BT1 C;  3WAA C;  2NZD C;  3AN2 A;  2Y2P A;  5DNN B;  4H9N B;  3W99 C;  1M19 C;  4DRB A;  3AZF D;  1M1A D;  1EQZ A;  3B0C T;  4E44 A;  4UUZ A;  5B40 C;  3AZH D;  3AZF B;  1JFI A;  5F99 A;  2FJ7 C;  1BH9 B;  3WA9 C;  3AZH B;  1M18 C;  3B6G C;  4X23 C;  5B33 C;  5CPJ A;  2F8N K;  5GT3 C;  1P3L D;  1KX4 A;  3MGS B;  3NQJ B;  4WU9 A;  3REJ D;  4WU8 C;  5AV9 A;  1ZLA D;  3W97 D;  3C1C C;  2PYO A;  3UTA D;  4XUJ A;  3KWQ A;  3KUY C;  5G49 A;  4WV4 B;  1Z2C B;  3REJ B;  3MNN D;  1ZLA B;  3W97 B;  3C1B B;  3A1K A;  3MNN B;  3LZ0 C;  4H9P B;  2XD1 A;  2ARO B;  3LZ1 C;  3REI A;  1Q9C A;  5AVC C;  4R8P D;  3W98 D;  3X1V A;  4R8P B;  1P3P D;  2JCH A;  5B2J A;  1P3A D;  3WTP D;  1P34 D;  1KX3 A;  4KUD A;  3F6T A;  5GSU D;  2L5A A;  1P3P B;  3REL C;  2Y2I A;  2DF4 C;  1PZR A;  3LEL D;  3MGQ B;  3WTP B;  2ZY2 A;  1P3A B;  2CV5 D;  1BH8 A;  2YFW B;  4J8U B;  5GXQ C;  1TZY C;  3KXB D;  3LEL B;  2IO5 C;  4WU8 A;  1AOI C;  1N1J B;  2XD5 A;  3REH D;  5E5A C;  3KXB B;  3AZE D;  2F8N D;  4CAY A;  1HQ3 D;  5C3I C;  4YS3 C;  4QLC C;  1F66 B;  3REH B;  4J8X B;  3VH6 T;  5AV6 B;  4JJN B;  3AZG D;  2HIO C;  3X1U D;  2F8N B;  3H0M C;  1HQ3 B;  5AV5 D;  4ZUX D;  3R45 A;  3LZ0 A;  4G91 B;  3AZG B;  3MGP D;  2NQB A;  3C1B A;  1S32 C;  4NE6 A;  4H9S C;  3LJA B;  4ZUX B;  4YM6 D;  3VH6 W;  3UT9 D;  1ID3 D;  4YM6 B;  5B0Z D;  3AYW D;  5B0Y D;  4Z5T B;  5B32 C;  4XZQ C;  5AY8 D;  5BNV B;  4ZBJ C;  5B0Z B;  3AYW B;  3AN2 D;  1P3B B;  3EPL A;  3X1S B;  5JRG A;  5B31 C;  1EQZ D;  5CP6 C;  3AZJ A;  2F8N H;  5BS7 A;  5CPI A;  4M6B A;  2BG1 A;  2CWE A;  5B31 G;  5DNM C;  3EG5 B;  1AOI A;  5KDM A;  3TU4 C;  3MGQ A;  5F99 D;  1P3O A;  4UUZ B;  4J8W A;  3AZL C;  1JFI B;  3AZM A;  1P3G B;  2Y2H A;  5AV5 C;  1N1J A;  3H0L C;  5CPJ D;  3A6N C;  3AFA C;  1KX4 D;  3EPJ A;  3A1I A;  3WKJ A;  1P3K C;  3P5J B;  4WU9 D;  4KHA A;  4G92 C;  5B1L C;  5AV6 A;  4JJN A;  4H9S A;  4Z66 C;  3UT9 C;  2Y2N A;  4WU9 B;  2PYO D;  2ZY5 A;  4XUJ D;  4J8V A;  1KX5 B;  5AV9 B;  3O62 C;  5AY8 C;  3B0D B;  4XUJ B;  3KWQ B;  3AZI D;  1P3I B;  3V9R A;  4HGA C;  3W96 B;  3REI D;  5CPK A;  3AV1 B;  5CHL B;  4CSR A;  3WAA B;  2NZD B;  2RVQ C;  1P3M A;  2Y2K A;  5BNV A;  2Y2G A;  1P3B A;  5B1M A;  5BNX B;  1P3F A;  3X1V D;  1M19 B;  3VH5 T;  3X1S A;  3B6F C;  5FUG A;  4H9Q A;  5B2J D;  3AZK C;  3X1V B;  1KX3 D;  3UTB C;  4KUD D;  4LD9 C;  5B2J B;  3H0R C;  3VH5 W;  1KX3 B;  3MGR C;  4KUD B;  5GT0 C;  1M18 B;  1P3K A;  4X23 B;  1P3G A;  1U35 C;  3AZN C;  4KGC C;  1BH8 B;  3MVD C;  3B0C W;  5AVB C;  2HUE C;  3MGS D;  1H3O B;  5B2I C;  4WU8 B;  3REK C;  3AV2 A;  4AWL C;  3C1C B;  5B24 C;  4CAY B;  1KX5 A;  2NQB D;  3C1B D;  5AV8 A;  5DNN C;  1P3I A;  3R45 B;  3LZ0 B;  2NQB B;  3W96 A;  2Y2L A;  2ARO D;  3AV1 A;  3X1T A;  3WAA A;  2NZD A;  3AZF C;  5BNX A;  1M1A C;  1HTA A;  3W99 A;  1M19 A;  5JRG D;  3AZH C;  3FDD A;  2YFV A;  5B40 A;  5CPI D;  5JRG B;  4EO5 C;  3AZJ B;  3KSY A;  2FJ7 A;  3MGQ D;  1U35 A;  3AZN A;  3WA9 A;  2F2A C;  5CPI B;  5GXQ B;  1TZY B;  4J8U D;  1P3L C;  1P3O D;  4X23 A;  1M18 A;  3B6G A;  4H9R A;  4J8W D;  5B33 A;  1AOI B;  5KDM B;  3AZM D;  5GT3 A;  3REJ C;  5B24 A;  1P3O B;  1ZLA C;  4J8W B;  3W97 C;  1H3O A;  4QLC B;  3UTA C;  3AZM B;  3WKJ D;  1F66 D;  4J8X D;  5AV6 D;  4JJN D;  3MNN C;  3C1C A;  3KUY A;  3WKJ B;  1B6W A;  4NE5 A;  2ARO C;  4KHA B;  4J8V D;  3LJA D;  4J8V B;  2Y2O A;  4R8P C;  3WTP E;  3LZ1 A;  3B0B A;  5AVC A;  3W98 C;  5CPK D;  3V9R B;  3EPH A;  4XZQ B;  4Z5T D;  4ZBJ B;  1P3M D;  1P3P C;  5CPK B;  1P3B D;  5B1M D;  4CSR B;  1P3F D;  1P3A C;  3WTP C;  1P34 C;  1KU5 A;  3X1S D;  5GSU C;  4WNN B;  5B31 B;  4J8U C;  1P3M B;  4NFT A;  5B1M B;  3LEL C;  1P3F B;  4WU8 D;  1B67 A;  5B32 G;  5DNM B;  3REL A;  2CV5 C;  5FUG B;  3KXB C;  3TU4 B;  4H9O A;  4H9Q B;  4DRA A;  4Z2M H;  5GXQ A;  1TZY A;  3REH C;  3AZL B;  1F66 C;  3AZE C;  1P3G D;  1HQ3 C;  5E5A A;  3A6N B;  3AFA B;  4UPK A;  3AZG C;  3X1U C;  1P3K B;  4YS3 A;  4QLC A;  5B1L B;  3LJA C;  4DQY B;  4ZUX C;  2HIO A;  3AV2 D;  3MGP C;  4NE3 A;  4YM6 C;  3AV2 B;  1KX5 D;  5AV9 D;  1ULY A;  1S32 A;  5AV8 D;  2PYO C;  1ID3 C;  4E45 A;  5B0Z C;  3KWQ D;  3AYW C;  2BYK B;  1P3I D;  5B0Y C;  3W96 D;  5AV8 B;  3AN2 C;  3X1T D;  3AV1 D;  5BT1 D;  1P34 A;  3WAA D;  2NZD D;  5B32 A;  4XZQ A;  3X1T B;  1EQZ C;  3W99 D;  1M19 D;  2CV5 A;  5B31 A;  4WNN A;  5CP6 A;  3W99 B;  5F99 C;  5B40 D;  5DNM A;  3AZE A;  3TU4 A;  2BYM A;  3VH6 A;  2FJ7 D;  2YFV B;  5B40 B;  3AZL A;  5CPJ C;  1M18 D;  1KX4 C;  3B6G D;  3IP4 C;  5BO0 A;  5AV5 A;  4X23 D;  5B33 D;  3A6N A;  3AFA A;  4WU9 C;  2FJ7 B;  1U35 B;  5GT3 D;  1TAF A;  3AZN B;  3WA9 B;  4KGC B;  2HUE B;  3B6G B;  4H9R B;  5B33 B;  5B1L A;  2DQN C;  4AWL B;  4XUJ C;  5GT3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...