5AVBA

Human nucleosome core particle
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
99
structure length
99
Chain Sequence
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords Histone H3.1
publication title Intra- and inter-nucleosomal interactions of the histone H4 tail revealed with a human nucleosome core particle with genetically-incorporated H4 tetra-acetylation
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5avbA00
3REJB 3W96D 1ZLAB 4ZUXC 3AZFB 3NQJA 3B6FA 1P3KC 5B1MD 5JRGA 1KX5A 3X1UA 5B40D 5B2JC 5GT0B 5CHLB 5JA4B 3WAAB 1P3IC 4ZBJC 3AZEB 5CPJB 5AV9B 4ZUXA 3WA9B 1P3KA 3AZID 4KUDB 5AVCD 3VH5W 3LZ1B 1P3BD 5FUGB 5B2JA 1BH9A 5AV6C 4R8PB 3UT9D 1ID3B 1P3IA 4KGCC 1ZLAD 3KUYC 1AOIB 1EQZB 5B1LB 2NQBB 4UUZB 3REHD 3RELB 5AV6A 3C1BB 1P3OD 3AZGD 3AZKC 3WAAD 5B2IC 5C3IB 1F1EA 2FJ7C 4XZQD 4JJND 5CPKD 1P3PD 4KGCA 3AZED 4J8XD 5AV9D 3KUYA 4Z5TD 5B0ZB 4H9QB 3REIB 4H9RB 5B32G 4XUJB 3LZ1D 4HGAC 3A6NC 3AV1C 1ID3D 5AV8C 2F8NB 3AZKA 4WU8C 5B2IA 4CSRB 3KXBB 1P34B 2FJ7A 1R4VA 4NE6A 3MGQC 1U35B 5BNVB 3B0DC 3AZHB 2IO5B 1BFMA 3A6NA 3AV1A 3AYWC 3B6FD 5AV8A 5CP6B 2AROC 5B24C 4WU8A 1KX5D 3X1UD 3AZLB 5B31B 1P3FC 3MGQA 3TU4B 3B0CW 1M1AB 3MGRD 3REID 4XUJD 3X1TB 4ZUXD 1P3AC 4WV4B 3AYWA 4EO5B 2F8ND 2AROA 5B24A 3KXBD 3AN2C 1BH8A 2YFWA 1U35D 1P3FA 4Z66D 3X1VD 3AZHD 2CV5B 4AWLC 1P3AA 3WKJC 1KX4B 2JSSA 5BT1C 5B0YD 4Z2MG 4J8VB 3C1CC 3AN2A 3AZLD 1M18B 2YFVB 5AV5C 5DNNB 2HIOC 4J8UC 1KX3B 5AVBC 3AV2C 3AZMB 3KUYD 3UTBD 3MVDC 3WKJA 3C1CA 3VH6A 3W96B 2F8NH 3AZNC 3REJC 5AV5A 3AZKD 5B2ID 2HIOA 3V9RB 5B1MB 4J8UA 3AZFC 4LD9C 2FJ7D 5AVBA 3AV2A 3MVDA 4CAYA 1KX4D 3W98C 4QLCB 5G49A 2BYKA 2NZDC 5GXQC 1HTAA 3A6ND 3AV1D 3AZNA 4H9NA 5AV8D 3REJA 5GT3B 5F99C 3X1SC 3AZIB 3AZFA 1ULYA 5AVCB 4LD9A 4KHAA 3WA9C 3AZMD 1F66C 5B33D 3MNNC 1M19C 3W98A 4R8PC 5BO0B 3REKC 2NZDA 5B32C 5GXQA 4DRAA 3AYWD 4YM6C 5F99A 3X1SA 1F66A 3REHB 2CWEA 2LY8A 5BS7C 3MNNA 4YS3B 1M19A 5B1LC 1P3OB 2NQBC 3AZGB 1H3OB 4NE3A 4QLCD 3REKA 4XZQB 4JJNB 5CPKB 1P3PB 5B32A 4J8XB 3R45B 4Z5TB 5AY8C 1P3MC 4YM6A 5GT3D 3UTAB 3MGPB 4G91B 3AN2D 5B0ZC 5BS7A 5B1LA 2NQBA 1WWSA 1KU5A 3W97C 1TAFA 3KWQC 1P34C 3WKJD 5AY8A 1P3MA 5KDMA 5BT1D 3LJAC 1B6WA 3AZJD 5B0ZA 1TZYC 4YS3D 4J8WC 2HIOD 3B6FB 5JRGB 1KX5B 3W97A 3X1UB 3AV2D 3B6GD 3KWQA 5CP6C 4M6BA 4H9PA 3MGSC 4X23C 3MVDD 1P34A 3W99C 3VH5T 3MGRB 3UTAD 3MGPD 3LJAA 3LELC 4ZUXB 1HQ3C 3AZND 1TZYA 3LZ0C 4J8WA 5CPID 2RVQC 5E5AC 1P3GC 4LD9D 1P3LD 3AFAC 5CP6A 1N1JA 3MGSA 4X23A 4Z66B 3W99A 3X1VB 5GXQD 3LELA 1HQ3A 3LZ0A 2CV5C 3X1SD 5JRGD 5E5AA 5B0YB 1P3GA 3AFAA 1F66D 3MNND 1M19D 4J8VC 2PYOC 1A7WA 4G92B 1M18C 2F8NG 4H9OA 5B32D 4KGCB 3KUYB 3UTBB 2CV5A 1P3KD 1S32C 5BNXB 5B2JD 3WTPC 2PYOA 1JFIA 3AZKB 3W96C 5B2IB 1P3ID 5DNMC 1M18A 2FJ7B 3NQUA 5B1MC 1P3MD 5B40C 5B31G 1S32A 3B0CT 3A6NB 5AV6D 3AV1B 3WTPA 5GSUC 5AV8B 4WU8B 5DNMA 3KWQD 3WTPE 4KGCD 5B33B 3MGQB 5B1MA 3O62C 3AZIC 1P3BC 3B0BA 5B40A 3LJAD 3UT9C 5GSUA 3AYWB 4WU9C 1ZLAC 2BYMB 3MGSD 4X23D 2YFWB 1P3FB 3O62A 1P3BA 3REHC 5GT0C 3UT9A 1P3OC 3WAAC 2HUEB 4WU9A 4JJNC 5CPKC 2RVQD 4NE5A 5E5AD 3AZEC 4WU8D 5AV9C 5CPJC 3AFAD 4Z5TC 1P3GD 3AN2B 1ZLAA 3MGQD 4KUDC 3LZ1C 3REHA 5GT0A 1ID3C 1P3OA 5JA4A 3WAAA 3WKJB 3VH6W 4JJNA 2L5AA 2AROD 5B24D 3AZEA 5CPJA 3R45A 5AV9A 3AZJB 4Z5TA 1AOIC 3WA9A 1EQZC 1P3FD 2PYOD 4KUDA 2HIOB 3LZ1A 4J8UB 5FUGA 3RELC 4R8PA 5AVBB 3AV2B 3C1BC 1ID3A 3VH5A 3B6GB 3MVDB 1P3AD 4CAYB 4Z2MH 1WWIA 5C3IC 2BYKB 4WNNB 1S32D 3MGRC 1AOIA 3REIC 3AZNB 1EQZA 4XUJC 5CPIB 4UUZA 5DNMD 3RELA 4LD9B 4KHAB 1P3LB 3C1BA 3VH6T 3KXBC 4E45A 3W98B 1B67A 1U35C 4DRBA 4Z66C 3C1CD 2NZDB 5GXQB 4H9QA 3MGRA 5GSUD 3REIA 3NQJB 3X1VC 4H9RA 2IO5C 5AV5D 5F99B 3AZHC 4XUJA 4J8UD 3X1SB 5AVBD 1F66B 5B0YC 3MNNB 3O62D 1M19B 2F8NA 4CSRA 3KXBA 3AZLC 5B31C 3REKB 1U35A 3TU4C 4Z66A 1M1AC 5BNVA 5B32B 4G92C 4YM6B 4WU9D 3AZHA 3REJD 3X1VA 3X1TC 3UTBC 1P3KB 3AZFD 5B2JB 1BH9B 4EO5C 5B0YA 3W98D 3AZLA 1P3IB 5GT0D 5B31A 1TAFB 4ZBJB 3TU4A 1M1AA 2NZDD 5AY8B 1P3MB 5KDMB 5F99D 5CPJD 3X1TA 3UTBA 1KX4C 3WA9D 5AV6B 4KUDD 4H9SC 5BNXA 4R8PD 3W97B 3REKD 3KWQB 4H9PB 5DNNC 1KX3C 4YM6D 3AZMC 5B33C 3LJAB 1KX4A 1AOID 1EQZD 1TZYB 4J8VA 4H9SA 5B1LD 4J8WB 2NQBD 3RELD 3C1BD 2YFVA 3KSYA 1N1JB 5DNNA 3MGSB 4X23B 3W99B 5AY8D 1KX3A 3AZMA 5B33A 5B0ZD 3LELB 1HQ3B 4HGAB 4QLCC 3LZ0B 5E5AB 3W96A 1P3GB 3W97D 3AFAB 2HUEC 5GT3C 3V9RA 1P34D 2BYMA 5AVCC 3B0DB 4E44A 4H9OB 1TZYD 4QLCA 4J8WD 2AROB 5B24B 4NFTA 5CP6D 5GT3A 1BH8B 2PYOB 3AZIA 3AZJC 3W99D 1JFIB 5AVCA 1Q9CA 5B31D 4YS3C 3TU4D 1M1AD 3NQUB 3AZGC 3LELD 1HQ3D 1P3AB 5BO0A 3LZ0D 3B6GC 2F8NK 4XZQC 3X1TD 1P3PC 4J8XC 1S32B 3WTPB 3UTAC 3MGPC 4G91C 3AZJA 5DNMB 4YS3A 3AZGA 5CPIC 1H3OA 4AWLB 1P3LC 3B6GA 5B40B 2CV5D 4XZQA 5CPKA 1P3PA 4J8XA 3C1CB 4J8VD 5GSUB 3MGPA 3UTAA 4WNNA 5AV5B 1M18D 4WZSB 5DNND 3B6FC 5JRGC 5CPIA 3O62B 1KX5C 1P3BB 1KX3D 3X1UC 1P3LA 3UT9B 5G49B 3WTPD 4H9NB 4WU9B
chains in the Genus database with same CATH superfamily
3REJB 3W96D 1ZLAB 4ZUXC 3AZFB 3A1IA 3NQJA 3B6FA 1P3KC 5B1MD 5JRGA 1KX5A 3X1UA 5B40D 5B2JC 2Y2KA 5GT0B 5CHLB 5JA4B 3WAAB 1T3UA 1P3IC 4ZBJC 3AZEB 5CPJB 5AV9B 4ZUXA 3WA9B 1P3KA 3AZID 4KUDB 5AVCD 3VH5W 3LZ1B 1P3BD 5FUGB 5B2JA 1BH9A 5AV6C 4R8PB 3UT9D 1ID3B 1P3IA 4KGCC 1ZLAD 3KUYC 1AOIB 1EQZB 5B1LB 2NQBB 4UUZB 3REHD 3RELB 5AV6A 3C1BB 1P3OD 3AZGD 3AZKC 3WAAD 1PZRA 5B2IC 5C3IB 1F1EA 2FJ7C 4XZQD 4JJND 5CPKD 1P3PD 4KGCA 3AZED 4J8XD 5AV9D 3KUYA 4Z5TD 5B0ZB 4H9QB 3REIB 4H9RB 5B32G 4XUJB 3LZ1D 4HGAC 3A6NC 3AV1C 1ID3D 5AV8C 2F8NB 3AZKA 4WU8C 5B2IA 4CSRB 3KXBB 1P34B 2JE5A 2FJ7A 1R4VA 4NE6A 2ZY4A 3MGQC 1U35B 5BNVB 3B0DC 3AZHB 2IO5B 1BFMA 3A6NA 3AV1A 3AYWC 2Y2IA 5AV8A 5CP6B 3B6FD 2AROC 5B24C 4WU8A 1KX5D 3X1UD 3EPKA 2JCHA 3AZLB 5B31B 3EPLA 1P3FC 3MGQA 3TU4B 3B0CW 1M1AB 3MGRD 3REID 2Y2NA 4XUJD 3X1TB 4ZUXD 1P3AC 4WV4B 3AYWA 4EO5B 2F8ND 2AROA 5B24A 3KXBD 3AN2C 1BH8A 2YFWA 1U35D 1P3FA 4Z66D 3X1VD 3AZHD 2CV5B 2G5HC 2Y2LA 4AWLC 1P3AA 3WKJC 1KX4B 2JSSA 5BT1C 5B0YD 4Z2MG 4J8VB 3C1CC 3AN2A 3AZLD 1M18B 2YFVB 5AV5C 5DNNB 2HIOC 4J8UC 1KX3B 5AVBC 3AV2C 3AZMB 3KUYD 3UTBD 3MVDC 3WKJA 4WJ3C 3C1CA 3VH6A 3W96B 2F8NH 3AZNC 3REJC 5AV5A 3AZKD 5B2ID 2HIOA 3V9RB 5B1MB 4J8UA 3AZFC 4LD9C 3EPJA 2FJ7D 5AVBA 3AV2A 2XD1A 3MVDA 4CAYA 1KX4D 3W98C 4QLCB 5G49A 2BYKA 2NZDC 5GXQC 1HTAA 1W2EA 3A6ND 3AV1D 3AZNA 4H9NA 5AV8D 3REJA 5GT3B 5F99C 3X1SC 3AZIB 3AZFA 1ULYA 5AVCB 4LD9A 4KHAA 3WA9C 3AZMD 1F66C 2Y2QA 5B33D 3MNNC 1M19C 2UWXA 3W98A 4R8PC 5BO0B 3REKC 2NZDA 5B32C 5GXQA 4DRAA 3AYWD 4YM6C 3EPHA 5F99A 3X1SA 1F66A 3REHB 2CWEA 2LY8A 5BS7C 3MNNA 4YS3B 1M19A 5B1LC 1P3OB 2NQBC 3AZGB 1H3OB 4NE3A 4QLCD 3REKA 4XZQB 2Y2GA 4JJNB 5CPKB 1P3PB 5B32A 4J8XB 3R45B 4Z5TB 5AY8C 1P3MC 4YM6A 5GT3D 3UTAB 3MGPB 4G91B 3AN2D 5B0ZC 5BS7A 5B1LA 2NQBA 1WWSA 1KU5A 3W97C 1TAFA 3KWQC 1P34C 3WKJD 5AY8A 1P3MA 5KDMA 5BT1D 3LJAC 1B6WA 3AZJD 5B0ZA 1TZYC 4YS3D 4J8WC 2HIOD 3B6FB 5JRGB 1KX5B 3W97A 3X1UB 3AV2D 3B6GD 3KWQA 5CP6C 4M6BA 4H9PA 2W8SA 4X23C 3MVDD 3MGSC 1P34A 3W99C 3VH5T 3MGRB 3UTAD 3MGPD 3LJAA 3LELC 4ZUXB 1HQ3C 3AZND 1TZYA 3LZ0C 4J8WA 5CPID 2RVQC 5E5AC 1P3GC 4LD9D 1P3LD 3AFAC 2DF4C 3H0LC 1N1JA 5CP6A 3MGSA 4X23A 4Z66B 3W99A 3X1VB 5GXQD 3LELA 1HQ3A 3LZ0A 4UPKA 2CV5C 5JRGD 5B0YB 5E5AA 3X1SD 1P3GA 3AFAA 1F66D 3MNND 1M19D 4J8VC 2PYOC 1A7WA 4G92B 1M18C 2F8NG 4H9OA 2J8PA 3FDDA 5B32D 4KGCB 3KUYB 3UTBB 3KFUG 2CV5A 1P3KD 1S32C 5BNXB 5B2JD 3WTPC 2PYOA 1JFIA 3AZKB 3W96C 5B2IB 1P3ID 3IP4C 5DNMC 1M18A 2FJ7B 3NQUA 5B1MC 1P3MD 5B40C 5B31G 1S32A 3B0CT 3A6NB 5AV6D 3AV1B 3WTPA 5GSUC 5AV8B 4WU8B 5DNMA 3KWQD 3WTPE 4KGCD 5B33B 3MGQB 5B1MA 3O62C 2Y2PA 3AZIC 1P3BC 3B0BA 5B40A 3LJAD 3UT9C 5GSUA 3AYWB 4WU9C 1ZLAC 2BYMB 3MGSD 4X23D 2F2AC 2YFWB 1P3FB 3O62A 1P3BA 3REHC 5GT0C 3UT9A 2XD5A 2BG1A 1P3OC 2Y2JA 3WAAC 2HUEB 4WU9A 4JJNC 5CPKC 2RVQD 4NE5A 5E5AD 3AZEC 4WU8D 5AV9C 5CPJC 3AFAD 4Z5TC 1P3GD 3F6TA 3AN2B 1ZLAA 3MGQD 4KUDC 3LZ1C 3REHA 5GT0A 1ID3C 1P3OA 5JA4A 2ZY5A 3WAAA 3WKJB 3VH6W 4JJNA 2L5AA 2AROD 2ZY3A 5B24D 3AZEA 3R45A 5AV9A 3AZJB 4Z5TA 5CPJA 1AOIC 3WA9A 1EQZC 1P3FD 2PYOD 4KUDA 2HIOB 3LZ1A 4J8UB 5FUGA 3RELC 4R8PA 5AVBB 3AV2B 3C1BC 1ID3A 3VH5A 3B6GB 3MVDB 1P3AD 4CAYB 4Z2MH 1WWIA 5C3IC 2BYKB 4WNNB 1S32D 3MGRC 1AOIA 3REIC 3AZNB 1EQZA 3AL0C 4XUJC 5CPIB 4UUZA 5DNMD 3RELA 4LD9B 4KHAB 1P3LB 3C1BA 3VH6T 3KXBC 4E45A 3W98B 2Y2HA 1B67A 1U35C 4DRBA 4Z66C 3C1CD 2NZDB 5GXQB 4H9QA 3MGRA 5GSUD 3REIA 3NQJB 3X1VC 4H9RA 2IO5C 5AV5D 5F99B 3AZHC 4XUJA 4J8UD 3X1SB 5AVBD 1F66B 5B0YC 3MNNB 3O62D 1M19B 2F8NA 4CSRA 3KXBA 3AZLC 5B31C 2FFFB 3REKB 1U35A 3TU4C 4Z66A 1M1AC 5BNVA 5B32B 4G92C 4YM6B 4WU9D 3AZHA 3REJD 3X1VA 3X1TC 3UTBC 1P3KB 3AZFD 5B2JB 1BH9B 4EO5C 5B0YA 3W98D 3AZLA 1P3IB 5GT0D 5B31A 1TAFB 4ZBJB 3TU4A 1M1AA 2NZDD 5AY8B 1P3MB 5KDMB 5F99D 5CPJD 3X1TA 3UTBA 1KX4C 3WA9D 5AV6B 4KUDD 4H9SC 5BNXA 4R8PD 3W97B 3REKD 3KWQB 4H9PB 5DNNC 2ZM5A 3A1KA 1KX3C 4YM6D 3AZMC 5B33C 3LJAB 3EG5B 1KX4A 1AOID 1EQZD 1TZYB 2Y2OA 4J8VA 4H9SA 5B1LD 4J8WB 2NQBD 3RELD 3C1BD 2YFVA 3KSYA 1N1JB 5DNNA 3MGSB 4X23B 3W99B 5AY8D 2DQNC 1KX3A 3AZMA 5B33A 2Y2MA 5B0ZD 3LELB 1HQ3B 4HGAB 4QLCC 3LZ0B 5E5AB 3W96A 1P3GB 3W97D 3AFAB 2HUEC 5GT3C 3V9RA 1P34D 2BYMA 3P5JB 5AVCC 3H0MC 3B0DB 4E44A 4H9OB 1TZYD 4QLCA 4J8WD 2AROB 5B24B 4NFTA 5CP6D 5GT3A 1BH8B 2PYOB 3AZIA 3AZJC 3W99D 1JFIB 5AVCA 1Q9CA 3H0RC 5B31D 4YS3C 3TU4D 1M1AD 3NQUB 3AZGC 3LELD 1HQ3D 1P3AB 5BO0A 3LZ0D 3B6GC 2F8NK 4XZQC 3X1TD 1P3PC 2RIQA 4J8XC 1S32B 3WTPB 3UTAC 3MGPC 4G91C 3AZJA 5DNMB 4YS3A 3AZGA 5CPIC 1H3OA 4AWLB 2G5IC 1P3LC 3B6GA 5B40B 2CV5D 4XZQA 5CPKA 1P3PA 4J8XA 3C1CB 4DQYB 4J8VD 5GSUB 3MGPA 3UTAA 4WNNA 5AV5B 1Z2CB 1M18D 4WZSB 5DNND 3B6FC 2VQRA 5JRGC 3O62B 5CPIA 1KX5C 1P3BB 1KX3D 3X1UC 1P3LA 2ZY2A 3UT9B 5G49B 3WTPD 4H9NB 4WU9B
chains in the Genus database with same CATH topology
3REJB 3W96D 1ZLAB 4ZUXC 3AZFB 3A1IA 3NQJA 3B6FA 1P3KC 5B1MD 5JRGA 1KX5A 3X1UA 5B40D 5B2JC 2Y2KA 5GT0B 5CHLB 5JA4B 3WAAB 1T3UA 1P3IC 4ZBJC 3AZEB 5CPJB 5AV9B 4ZUXA 3WA9B 1P3KA 3AZID 4KUDB 5AVCD 3VH5W 3LZ1B 1P3BD 5FUGB 5B2JA 1BH9A 5AV6C 4R8PB 3UT9D 1ID3B 1P3IA 4KGCC 1ZLAD 3KUYC 1AOIB 1EQZB 5B1LB 2NQBB 4UUZB 3REHD 3RELB 5AV6A 3C1BB 1P3OD 3AZGD 3AZKC 3WAAD 1PZRA 5B2IC 5C3IB 1F1EA 2FJ7C 4XZQD 4JJND 5CPKD 1P3PD 4KGCA 3AZED 4J8XD 5AV9D 3KUYA 4Z5TD 5B0ZB 4H9QB 3REIB 4H9RB 5B32G 4XUJB 3LZ1D 4HGAC 3A6NC 3AV1C 1ID3D 5AV8C 2F8NB 3AZKA 4WU8C 5B2IA 4CSRB 3KXBB 1P34B 2JE5A 2FJ7A 1R4VA 4NE6A 2ZY4A 3MGQC 1U35B 5BNVB 3B0DC 3AZHB 2IO5B 1BFMA 3A6NA 3AV1A 3AYWC 2Y2IA 5AV8A 5CP6B 3B6FD 2AROC 5B24C 4WU8A 1KX5D 3X1UD 3EPKA 2JCHA 3AZLB 5B31B 3EPLA 1P3FC 3MGQA 3TU4B 3B0CW 1M1AB 3MGRD 3REID 2Y2NA 4XUJD 3X1TB 4ZUXD 1P3AC 4WV4B 3AYWA 4EO5B 2F8ND 2AROA 5B24A 3KXBD 3AN2C 1BH8A 2YFWA 1U35D 1P3FA 4Z66D 3X1VD 3AZHD 2CV5B 2G5HC 2Y2LA 4AWLC 1P3AA 3WKJC 1KX4B 2JSSA 5BT1C 5B0YD 4Z2MG 4J8VB 3C1CC 3AN2A 3AZLD 1M18B 2YFVB 5AV5C 5DNNB 2HIOC 4J8UC 1KX3B 5AVBC 3AV2C 3AZMB 3KUYD 3UTBD 3MVDC 3WKJA 4WJ3C 3C1CA 3VH6A 3W96B 2F8NH 3AZNC 3REJC 5AV5A 3AZKD 5B2ID 2HIOA 3V9RB 5B1MB 4J8UA 3AZFC 4LD9C 3EPJA 2FJ7D 5AVBA 3AV2A 2XD1A 3MVDA 4CAYA 1KX4D 3W98C 4QLCB 5G49A 2BYKA 2NZDC 5GXQC 1HTAA 1W2EA 3A6ND 3AV1D 3AZNA 4H9NA 5AV8D 3REJA 5GT3B 5F99C 3X1SC 3AZIB 3AZFA 1ULYA 5AVCB 4LD9A 4KHAA 3WA9C 3AZMD 1F66C 2Y2QA 5B33D 3MNNC 1M19C 2UWXA 3W98A 4R8PC 5BO0B 3REKC 2NZDA 5B32C 5GXQA 4DRAA 3AYWD 4YM6C 3EPHA 5F99A 3X1SA 1F66A 3REHB 2CWEA 2LY8A 5BS7C 3MNNA 4YS3B 1M19A 5B1LC 1P3OB 2NQBC 3AZGB 1H3OB 4NE3A 4QLCD 3REKA 4XZQB 2Y2GA 4JJNB 5CPKB 1P3PB 5B32A 4J8XB 3R45B 4Z5TB 5AY8C 1P3MC 4YM6A 5GT3D 3UTAB 3MGPB 4G91B 3AN2D 5B0ZC 5BS7A 5B1LA 2NQBA 1WWSA 1KU5A 3W97C 1TAFA 3KWQC 1P34C 3WKJD 5AY8A 1P3MA 5KDMA 5BT1D 3LJAC 1B6WA 3AZJD 5B0ZA 1TZYC 4YS3D 4J8WC 2HIOD 3B6FB 5JRGB 1KX5B 3W97A 3X1UB 3AV2D 3B6GD 3KWQA 5CP6C 4M6BA 4H9PA 2W8SA 4X23C 3MVDD 3MGSC 1P34A 3W99C 3VH5T 3MGRB 3UTAD 3MGPD 3LJAA 3LELC 4ZUXB 1HQ3C 3AZND 1TZYA 3LZ0C 4J8WA 5CPID 2RVQC 5E5AC 1P3GC 4LD9D 1P3LD 3AFAC 2DF4C 3H0LC 1N1JA 5CP6A 3MGSA 4X23A 4Z66B 3W99A 3X1VB 5GXQD 3LELA 1HQ3A 3LZ0A 4UPKA 2CV5C 5JRGD 5B0YB 5E5AA 3X1SD 1P3GA 3AFAA 1F66D 3MNND 1M19D 4J8VC 2PYOC 1A7WA 4G92B 1M18C 2F8NG 4H9OA 2J8PA 3FDDA 5B32D 4KGCB 3KUYB 3UTBB 3KFUG 2CV5A 1P3KD 1S32C 5BNXB 5B2JD 3WTPC 2PYOA 1JFIA 3AZKB 3W96C 5B2IB 1P3ID 3IP4C 5DNMC 1M18A 2FJ7B 3NQUA 5B1MC 1P3MD 5B40C 5B31G 1S32A 3B0CT 3A6NB 5AV6D 3AV1B 3WTPA 5GSUC 5AV8B 4WU8B 5DNMA 3KWQD 3WTPE 4KGCD 5B33B 3MGQB 5B1MA 3O62C 2Y2PA 3AZIC 1P3BC 3B0BA 5B40A 3LJAD 3UT9C 5GSUA 3AYWB 4WU9C 1ZLAC 2BYMB 3MGSD 4X23D 2F2AC 2YFWB 1P3FB 3O62A 1P3BA 3REHC 5GT0C 3UT9A 2XD5A 2BG1A 1P3OC 2Y2JA 3WAAC 2HUEB 4WU9A 4JJNC 5CPKC 2RVQD 4NE5A 5E5AD 3AZEC 4WU8D 5AV9C 5CPJC 3AFAD 4Z5TC 1P3GD 3F6TA 3AN2B 1ZLAA 3MGQD 4KUDC 3LZ1C 3REHA 5GT0A 1ID3C 1P3OA 5JA4A 2ZY5A 3WAAA 3WKJB 3VH6W 4JJNA 2L5AA 2AROD 2ZY3A 5B24D 3AZEA 3R45A 5AV9A 3AZJB 4Z5TA 5CPJA 1AOIC 3WA9A 1EQZC 1P3FD 2PYOD 4KUDA 2HIOB 3LZ1A 4J8UB 5FUGA 3RELC 4R8PA 5AVBB 3AV2B 3C1BC 1ID3A 3VH5A 3B6GB 3MVDB 1P3AD 4CAYB 4Z2MH 1WWIA 5C3IC 2BYKB 4WNNB 1S32D 3MGRC 1AOIA 3REIC 3AZNB 1EQZA 3AL0C 4XUJC 5CPIB 4UUZA 5DNMD 3RELA 4LD9B 4KHAB 1P3LB 3C1BA 3VH6T 3KXBC 4E45A 3W98B 2Y2HA 1B67A 1U35C 4DRBA 4Z66C 3C1CD 2NZDB 5GXQB 4H9QA 3MGRA 5GSUD 3REIA 3NQJB 3X1VC 4H9RA 2IO5C 5AV5D 5F99B 3AZHC 4XUJA 4J8UD 3X1SB 5AVBD 1F66B 5B0YC 3MNNB 3O62D 1M19B 2F8NA 4CSRA 3KXBA 3AZLC 5B31C 2FFFB 3REKB 1U35A 3TU4C 4Z66A 1M1AC 5BNVA 5B32B 4G92C 4YM6B 4WU9D 3AZHA 3REJD 3X1VA 3X1TC 3UTBC 1P3KB 3AZFD 5B2JB 1BH9B 4EO5C 5B0YA 3W98D 3AZLA 1P3IB 5GT0D 5B31A 1TAFB 4ZBJB 3TU4A 1M1AA 2NZDD 5AY8B 1P3MB 5KDMB 5F99D 5CPJD 3X1TA 3UTBA 1KX4C 3WA9D 5AV6B 4KUDD 4H9SC 5BNXA 4R8PD 3W97B 3REKD 3KWQB 4H9PB 5DNNC 2ZM5A 3A1KA 1KX3C 4YM6D 3AZMC 5B33C 3LJAB 3EG5B 1KX4A 1AOID 1EQZD 1TZYB 2Y2OA 4J8VA 4H9SA 5B1LD 4J8WB 2NQBD 3RELD 3C1BD 2YFVA 3KSYA 1N1JB 5DNNA 3MGSB 4X23B 3W99B 5AY8D 2DQNC 1KX3A 3AZMA 5B33A 2Y2MA 5B0ZD 3LELB 1HQ3B 4HGAB 4QLCC 3LZ0B 5E5AB 3W96A 1P3GB 3W97D 3AFAB 2HUEC 5GT3C 3V9RA 1P34D 2BYMA 3P5JB 5AVCC 3H0MC 3B0DB 4E44A 4H9OB 1TZYD 4QLCA 4J8WD 2AROB 5B24B 4NFTA 5CP6D 5GT3A 1BH8B 2PYOB 3AZIA 3AZJC 3W99D 1JFIB 5AVCA 1Q9CA 3H0RC 5B31D 4YS3C 3TU4D 1M1AD 3NQUB 3AZGC 3LELD 1HQ3D 1P3AB 5BO0A 3LZ0D 3B6GC 2F8NK 4XZQC 3X1TD 1P3PC 2RIQA 4J8XC 1S32B 3WTPB 3UTAC 3MGPC 4G91C 3AZJA 5DNMB 4YS3A 3AZGA 5CPIC 1H3OA 4AWLB 2G5IC 1P3LC 3B6GA 5B40B 2CV5D 4XZQA 5CPKA 1P3PA 4J8XA 3C1CB 4DQYB 4J8VD 5GSUB 3MGPA 3UTAA 4WNNA 5AV5B 1Z2CB 1M18D 4WZSB 5DNND 3B6FC 2VQRA 5JRGC 3O62B 5CPIA 1KX5C 1P3BB 1KX3D 3X1UC 1P3LA 2ZY2A 3UT9B 5G49B 3WTPD 4H9NB 4WU9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3REJ B;  3W96 D;  1ZLA B;  4ZUX C;  3AZF B;  3NQJ A;  3B6F A;  1P3K C;  5B1M D;  5JRG A;  1KX5 A;  3X1U A;  5B40 D;  5B2J C;  5GT0 B;  5CHL B;  5JA4 B;  3WAA B;  1P3I C;  4ZBJ C;  3AZE B;  5CPJ B;  5AV9 B;  4ZUX A;  3WA9 B;  1P3K A;  3AZI D;  4KUD B;  5AVC D;  3VH5 W;  3LZ1 B;  1P3B D;  5FUG B;  5B2J A;  1BH9 A;  5AV6 C;  4R8P B;  3UT9 D;  1ID3 B;  1P3I A;  4KGC C;  1ZLA D;  3KUY C;  1AOI B;  1EQZ B;  5B1L B;  2NQB B;  4UUZ B;  3REH D;  3REL B;  5AV6 A;  3C1B B;  1P3O D;  3AZG D;  3AZK C;  3WAA D;  5B2I C;  5C3I B;  1F1E A;  2FJ7 C;  4XZQ D;  4JJN D;  5CPK D;  1P3P D;  4KGC A;  3AZE D;  4J8X D;  5AV9 D;  3KUY A;  4Z5T D;  5B0Z B;  4H9Q B;  3REI B;  4H9R B;  5B32 G;  4XUJ B;  3LZ1 D;  4HGA C;  3A6N C;  3AV1 C;  1ID3 D;  5AV8 C;  2F8N B;  3AZK A;  4WU8 C;  5B2I A;  4CSR B;  3KXB B;  1P34 B;  2FJ7 A;  1R4V A;  4NE6 A;  3MGQ C;  1U35 B;  5BNV B;  3B0D C;  3AZH B;  2IO5 B;  1BFM A;  3A6N A;  3AV1 A;  3AYW C;  3B6F D;  5AV8 A;  5CP6 B;  2ARO C;  5B24 C;  4WU8 A;  1KX5 D;  3X1U D;  3AZL B;  5B31 B;  1P3F C;  3MGQ A;  3TU4 B;  3B0C W;  1M1A B;  3MGR D;  3REI D;  4XUJ D;  3X1T B;  4ZUX D;  1P3A C;  4WV4 B;  3AYW A;  4EO5 B;  2F8N D;  2ARO A;  5B24 A;  3KXB D;  3AN2 C;  1BH8 A;  2YFW A;  1U35 D;  1P3F A;  4Z66 D;  3X1V D;  3AZH D;  2CV5 B;  4AWL C;  1P3A A;  3WKJ C;  1KX4 B;  2JSS A;  5BT1 C;  5B0Y D;  4Z2M G;  4J8V B;  3C1C C;  3AN2 A;  3AZL D;  1M18 B;  2YFV B;  5AV5 C;  5DNN B;  2HIO C;  4J8U C;  1KX3 B;  5AVB C;  3AV2 C;  3AZM B;  3KUY D;  3UTB D;  3MVD C;  3WKJ A;  3C1C A;  3VH6 A;  3W96 B;  2F8N H;  3AZN C;  3REJ C;  5AV5 A;  3AZK D;  5B2I D;  2HIO A;  3V9R B;  5B1M B;  4J8U A;  3AZF C;  4LD9 C;  2FJ7 D;  5AVB A;  3AV2 A;  3MVD A;  4CAY A;  1KX4 D;  3W98 C;  4QLC B;  5G49 A;  2BYK A;  2NZD C;  5GXQ C;  1HTA A;  3A6N D;  3AV1 D;  3AZN A;  4H9N A;  5AV8 D;  3REJ A;  5GT3 B;  5F99 C;  3X1S C;  3AZI B;  3AZF A;  1ULY A;  5AVC B;  4LD9 A;  4KHA A;  3WA9 C;  3AZM D;  1F66 C;  5B33 D;  3MNN C;  1M19 C;  3W98 A;  4R8P C;  5BO0 B;  3REK C;  2NZD A;  5B32 C;  5GXQ A;  4DRA A;  3AYW D;  4YM6 C;  5F99 A;  3X1S A;  1F66 A;  3REH B;  2CWE A;  2LY8 A;  5BS7 C;  3MNN A;  4YS3 B;  1M19 A;  5B1L C;  1P3O B;  2NQB C;  3AZG B;  1H3O B;  4NE3 A;  4QLC D;  3REK A;  4XZQ B;  4JJN B;  5CPK B;  1P3P B;  5B32 A;  4J8X B;  3R45 B;  4Z5T B;  5AY8 C;  1P3M C;  4YM6 A;  5GT3 D;  3UTA B;  3MGP B;  4G91 B;  3AN2 D;  5B0Z C;  5BS7 A;  5B1L A;  2NQB A;  1WWS A;  1KU5 A;  3W97 C;  1TAF A;  3KWQ C;  1P34 C;  3WKJ D;  5AY8 A;  1P3M A;  5KDM A;  5BT1 D;  3LJA C;  1B6W A;  3AZJ D;  5B0Z A;  1TZY C;  4YS3 D;  4J8W C;  2HIO D;  3B6F B;  5JRG B;  1KX5 B;  3W97 A;  3X1U B;  3AV2 D;  3B6G D;  3KWQ A;  5CP6 C;  4M6B A;  4H9P A;  3MGS C;  4X23 C;  3MVD D;  1P34 A;  3W99 C;  3VH5 T;  3MGR B;  3UTA D;  3MGP D;  3LJA A;  3LEL C;  4ZUX B;  1HQ3 C;  3AZN D;  1TZY A;  3LZ0 C;  4J8W A;  5CPI D;  2RVQ C;  5E5A C;  1P3G C;  4LD9 D;  1P3L D;  3AFA C;  5CP6 A;  1N1J A;  3MGS A;  4X23 A;  4Z66 B;  3W99 A;  3X1V B;  5GXQ D;  3LEL A;  1HQ3 A;  3LZ0 A;  2CV5 C;  3X1S D;  5JRG D;  5E5A A;  5B0Y B;  1P3G A;  3AFA A;  1F66 D;  3MNN D;  1M19 D;  4J8V C;  2PYO C;  1A7W A;  4G92 B;  1M18 C;  2F8N G;  4H9O A;  5B32 D;  4KGC B;  3KUY B;  3UTB B;  2CV5 A;  1P3K D;  1S32 C;  5BNX B;  5B2J D;  3WTP C;  2PYO A;  1JFI A;  3AZK B;  3W96 C;  5B2I B;  1P3I D;  5DNM C;  1M18 A;  2FJ7 B;  3NQU A;  5B1M C;  1P3M D;  5B40 C;  5B31 G;  1S32 A;  3B0C T;  3A6N B;  5AV6 D;  3AV1 B;  3WTP A;  5GSU C;  5AV8 B;  4WU8 B;  5DNM A;  3KWQ D;  3WTP E;  4KGC D;  5B33 B;  3MGQ B;  5B1M A;  3O62 C;  3AZI C;  1P3B C;  3B0B A;  5B40 A;  3LJA D;  3UT9 C;  5GSU A;  3AYW B;  4WU9 C;  1ZLA C;  2BYM B;  3MGS D;  4X23 D;  2YFW B;  1P3F B;  3O62 A;  1P3B A;  3REH C;  5GT0 C;  3UT9 A;  1P3O C;  3WAA C;  2HUE B;  4WU9 A;  4JJN C;  5CPK C;  2RVQ D;  4NE5 A;  5E5A D;  3AZE C;  4WU8 D;  5AV9 C;  5CPJ C;  3AFA D;  4Z5T C;  1P3G D;  3AN2 B;  1ZLA A;  3MGQ D;  4KUD C;  3LZ1 C;  3REH A;  5GT0 A;  1ID3 C;  1P3O A;  5JA4 A;  3WAA A;  3WKJ B;  3VH6 W;  4JJN A;  2L5A A;  2ARO D;  5B24 D;  3AZE A;  5CPJ A;  3R45 A;  5AV9 A;  3AZJ B;  4Z5T A;  1AOI C;  3WA9 A;  1EQZ C;  1P3F D;  2PYO D;  4KUD A;  2HIO B;  3LZ1 A;  4J8U B;  5FUG A;  3REL C;  4R8P A;  5AVB B;  3AV2 B;  3C1B C;  1ID3 A;  3VH5 A;  3B6G B;  3MVD B;  1P3A D;  4CAY B;  4Z2M H;  1WWI A;  5C3I C;  2BYK B;  4WNN B;  1S32 D;  3MGR C;  1AOI A;  3REI C;  3AZN B;  1EQZ A;  4XUJ C;  5CPI B;  4UUZ A;  5DNM D;  3REL A;  4LD9 B;  4KHA B;  1P3L B;  3C1B A;  3VH6 T;  3KXB C;  4E45 A;  3W98 B;  1B67 A;  1U35 C;  4DRB A;  4Z66 C;  3C1C D;  2NZD B;  5GXQ B;  4H9Q A;  3MGR A;  5GSU D;  3REI A;  3NQJ B;  3X1V C;  4H9R A;  2IO5 C;  5AV5 D;  5F99 B;  3AZH C;  4XUJ A;  4J8U D;  3X1S B;  5AVB D;  1F66 B;  5B0Y C;  3MNN B;  3O62 D;  1M19 B;  2F8N A;  4CSR A;  3KXB A;  3AZL C;  5B31 C;  3REK B;  1U35 A;  3TU4 C;  4Z66 A;  1M1A C;  5BNV A;  5B32 B;  4G92 C;  4YM6 B;  4WU9 D;  3AZH A;  3REJ D;  3X1V A;  3X1T C;  3UTB C;  1P3K B;  3AZF D;  5B2J B;  1BH9 B;  4EO5 C;  5B0Y A;  3W98 D;  3AZL A;  1P3I B;  5GT0 D;  5B31 A;  1TAF B;  4ZBJ B;  3TU4 A;  1M1A A;  2NZD D;  5AY8 B;  1P3M B;  5KDM B;  5F99 D;  5CPJ D;  3X1T A;  3UTB A;  1KX4 C;  3WA9 D;  5AV6 B;  4KUD D;  4H9S C;  5BNX A;  4R8P D;  3W97 B;  3REK D;  3KWQ B;  4H9P B;  5DNN C;  1KX3 C;  4YM6 D;  3AZM C;  5B33 C;  3LJA B;  1KX4 A;  1AOI D;  1EQZ D;  1TZY B;  4J8V A;  4H9S A;  5B1L D;  4J8W B;  2NQB D;  3REL D;  3C1B D;  2YFV A;  3KSY A;  1N1J B;  5DNN A;  3MGS B;  4X23 B;  3W99 B;  5AY8 D;  1KX3 A;  3AZM A;  5B33 A;  5B0Z D;  3LEL B;  1HQ3 B;  4HGA B;  4QLC C;  3LZ0 B;  5E5A B;  3W96 A;  1P3G B;  3W97 D;  3AFA B;  2HUE C;  5GT3 C;  3V9R A;  1P34 D;  2BYM A;  5AVC C;  3B0D B;  4E44 A;  4H9O B;  1TZY D;  4QLC A;  4J8W D;  2ARO B;  5B24 B;  4NFT A;  5CP6 D;  5GT3 A;  1BH8 B;  2PYO B;  3AZI A;  3AZJ C;  3W99 D;  1JFI B;  5AVC A;  1Q9C A;  5B31 D;  4YS3 C;  3TU4 D;  1M1A D;  3NQU B;  3AZG C;  3LEL D;  1HQ3 D;  1P3A B;  5BO0 A;  3LZ0 D;  3B6G C;  2F8N K;  4XZQ C;  3X1T D;  1P3P C;  4J8X C;  1S32 B;  3WTP B;  3UTA C;  3MGP C;  4G91 C;  3AZJ A;  5DNM B;  4YS3 A;  3AZG A;  5CPI C;  1H3O A;  4AWL B;  1P3L C;  3B6G A;  5B40 B;  2CV5 D;  4XZQ A;  5CPK A;  1P3P A;  4J8X A;  3C1C B;  4J8V D;  5GSU B;  3MGP A;  3UTA A;  4WNN A;  5AV5 B;  1M18 D;  4WZS B;  5DNN D;  3B6F C;  5JRG C;  5CPI A;  3O62 B;  1KX5 C;  1P3B B;  1KX3 D;  3X1U C;  1P3L A;  3UT9 B;  5G49 B;  3WTP D;  4H9N B;  4WU9 B; 
#chains in the Genus database with same CATH topology
 3REJ B;  3W96 D;  1ZLA B;  4ZUX C;  3AZF B;  3A1I A;  3NQJ A;  3B6F A;  1P3K C;  5B1M D;  5JRG A;  1KX5 A;  3X1U A;  5B40 D;  5B2J C;  2Y2K A;  5GT0 B;  5CHL B;  5JA4 B;  3WAA B;  1T3U A;  1P3I C;  4ZBJ C;  3AZE B;  5CPJ B;  5AV9 B;  4ZUX A;  3WA9 B;  1P3K A;  3AZI D;  4KUD B;  5AVC D;  3VH5 W;  3LZ1 B;  1P3B D;  5FUG B;  5B2J A;  1BH9 A;  5AV6 C;  4R8P B;  3UT9 D;  1ID3 B;  1P3I A;  4KGC C;  1ZLA D;  3KUY C;  1AOI B;  1EQZ B;  5B1L B;  2NQB B;  4UUZ B;  3REH D;  3REL B;  5AV6 A;  3C1B B;  1P3O D;  3AZG D;  3AZK C;  3WAA D;  1PZR A;  5B2I C;  5C3I B;  1F1E A;  2FJ7 C;  4XZQ D;  4JJN D;  5CPK D;  1P3P D;  4KGC A;  3AZE D;  4J8X D;  5AV9 D;  3KUY A;  4Z5T D;  5B0Z B;  4H9Q B;  3REI B;  4H9R B;  5B32 G;  4XUJ B;  3LZ1 D;  4HGA C;  3A6N C;  3AV1 C;  1ID3 D;  5AV8 C;  2F8N B;  3AZK A;  4WU8 C;  5B2I A;  4CSR B;  3KXB B;  1P34 B;  2JE5 A;  2FJ7 A;  1R4V A;  4NE6 A;  2ZY4 A;  3MGQ C;  1U35 B;  5BNV B;  3B0D C;  3AZH B;  2IO5 B;  1BFM A;  3A6N A;  3AV1 A;  3AYW C;  2Y2I A;  5AV8 A;  5CP6 B;  3B6F D;  2ARO C;  5B24 C;  4WU8 A;  1KX5 D;  3X1U D;  3EPK A;  2JCH A;  3AZL B;  5B31 B;  3EPL A;  1P3F C;  3MGQ A;  3TU4 B;  3B0C W;  1M1A B;  3MGR D;  3REI D;  2Y2N A;  4XUJ D;  3X1T B;  4ZUX D;  1P3A C;  4WV4 B;  3AYW A;  4EO5 B;  2F8N D;  2ARO A;  5B24 A;  3KXB D;  3AN2 C;  1BH8 A;  2YFW A;  1U35 D;  1P3F A;  4Z66 D;  3X1V D;  3AZH D;  2CV5 B;  2G5H C;  2Y2L A;  4AWL C;  1P3A A;  3WKJ C;  1KX4 B;  2JSS A;  5BT1 C;  5B0Y D;  4Z2M G;  4J8V B;  3C1C C;  3AN2 A;  3AZL D;  1M18 B;  2YFV B;  5AV5 C;  5DNN B;  2HIO C;  4J8U C;  1KX3 B;  5AVB C;  3AV2 C;  3AZM B;  3KUY D;  3UTB D;  3MVD C;  3WKJ A;  4WJ3 C;  3C1C A;  3VH6 A;  3W96 B;  2F8N H;  3AZN C;  3REJ C;  5AV5 A;  3AZK D;  5B2I D;  2HIO A;  3V9R B;  5B1M B;  4J8U A;  3AZF C;  4LD9 C;  3EPJ A;  2FJ7 D;  5AVB A;  3AV2 A;  2XD1 A;  3MVD A;  4CAY A;  1KX4 D;  3W98 C;  4QLC B;  5G49 A;  2BYK A;  2NZD C;  5GXQ C;  1HTA A;  1W2E A;  3A6N D;  3AV1 D;  3AZN A;  4H9N A;  5AV8 D;  3REJ A;  5GT3 B;  5F99 C;  3X1S C;  3AZI B;  3AZF A;  1ULY A;  5AVC B;  4LD9 A;  4KHA A;  3WA9 C;  3AZM D;  1F66 C;  2Y2Q A;  5B33 D;  3MNN C;  1M19 C;  2UWX A;  3W98 A;  4R8P C;  5BO0 B;  3REK C;  2NZD A;  5B32 C;  5GXQ A;  4DRA A;  3AYW D;  4YM6 C;  3EPH A;  5F99 A;  3X1S A;  1F66 A;  3REH B;  2CWE A;  2LY8 A;  5BS7 C;  3MNN A;  4YS3 B;  1M19 A;  5B1L C;  1P3O B;  2NQB C;  3AZG B;  1H3O B;  4NE3 A;  4QLC D;  3REK A;  4XZQ B;  2Y2G A;  4JJN B;  5CPK B;  1P3P B;  5B32 A;  4J8X B;  3R45 B;  4Z5T B;  5AY8 C;  1P3M C;  4YM6 A;  5GT3 D;  3UTA B;  3MGP B;  4G91 B;  3AN2 D;  5B0Z C;  5BS7 A;  5B1L A;  2NQB A;  1WWS A;  1KU5 A;  3W97 C;  1TAF A;  3KWQ C;  1P34 C;  3WKJ D;  5AY8 A;  1P3M A;  5KDM A;  5BT1 D;  3LJA C;  1B6W A;  3AZJ D;  5B0Z A;  1TZY C;  4YS3 D;  4J8W C;  2HIO D;  3B6F B;  5JRG B;  1KX5 B;  3W97 A;  3X1U B;  3AV2 D;  3B6G D;  3KWQ A;  5CP6 C;  4M6B A;  4H9P A;  2W8S A;  4X23 C;  3MVD D;  3MGS C;  1P34 A;  3W99 C;  3VH5 T;  3MGR B;  3UTA D;  3MGP D;  3LJA A;  3LEL C;  4ZUX B;  1HQ3 C;  3AZN D;  1TZY A;  3LZ0 C;  4J8W A;  5CPI D;  2RVQ C;  5E5A C;  1P3G C;  4LD9 D;  1P3L D;  3AFA C;  2DF4 C;  3H0L C;  1N1J A;  5CP6 A;  3MGS A;  4X23 A;  4Z66 B;  3W99 A;  3X1V B;  5GXQ D;  3LEL A;  1HQ3 A;  3LZ0 A;  4UPK A;  2CV5 C;  5JRG D;  5B0Y B;  5E5A A;  3X1S D;  1P3G A;  3AFA A;  1F66 D;  3MNN D;  1M19 D;  4J8V C;  2PYO C;  1A7W A;  4G92 B;  1M18 C;  2F8N G;  4H9O A;  2J8P A;  3FDD A;  5B32 D;  4KGC B;  3KUY B;  3UTB B;  3KFU G;  2CV5 A;  1P3K D;  1S32 C;  5BNX B;  5B2J D;  3WTP C;  2PYO A;  1JFI A;  3AZK B;  3W96 C;  5B2I B;  1P3I D;  3IP4 C;  5DNM C;  1M18 A;  2FJ7 B;  3NQU A;  5B1M C;  1P3M D;  5B40 C;  5B31 G;  1S32 A;  3B0C T;  3A6N B;  5AV6 D;  3AV1 B;  3WTP A;  5GSU C;  5AV8 B;  4WU8 B;  5DNM A;  3KWQ D;  3WTP E;  4KGC D;  5B33 B;  3MGQ B;  5B1M A;  3O62 C;  2Y2P A;  3AZI C;  1P3B C;  3B0B A;  5B40 A;  3LJA D;  3UT9 C;  5GSU A;  3AYW B;  4WU9 C;  1ZLA C;  2BYM B;  3MGS D;  4X23 D;  2F2A C;  2YFW B;  1P3F B;  3O62 A;  1P3B A;  3REH C;  5GT0 C;  3UT9 A;  2XD5 A;  2BG1 A;  1P3O C;  2Y2J A;  3WAA C;  2HUE B;  4WU9 A;  4JJN C;  5CPK C;  2RVQ D;  4NE5 A;  5E5A D;  3AZE C;  4WU8 D;  5AV9 C;  5CPJ C;  3AFA D;  4Z5T C;  1P3G D;  3F6T A;  3AN2 B;  1ZLA A;  3MGQ D;  4KUD C;  3LZ1 C;  3REH A;  5GT0 A;  1ID3 C;  1P3O A;  5JA4 A;  2ZY5 A;  3WAA A;  3WKJ B;  3VH6 W;  4JJN A;  2L5A A;  2ARO D;  2ZY3 A;  5B24 D;  3AZE A;  3R45 A;  5AV9 A;  3AZJ B;  4Z5T A;  5CPJ A;  1AOI C;  3WA9 A;  1EQZ C;  1P3F D;  2PYO D;  4KUD A;  2HIO B;  3LZ1 A;  4J8U B;  5FUG A;  3REL C;  4R8P A;  5AVB B;  3AV2 B;  3C1B C;  1ID3 A;  3VH5 A;  3B6G B;  3MVD B;  1P3A D;  4CAY B;  4Z2M H;  1WWI A;  5C3I C;  2BYK B;  4WNN B;  1S32 D;  3MGR C;  1AOI A;  3REI C;  3AZN B;  1EQZ A;  3AL0 C;  4XUJ C;  5CPI B;  4UUZ A;  5DNM D;  3REL A;  4LD9 B;  4KHA B;  1P3L B;  3C1B A;  3VH6 T;  3KXB C;  4E45 A;  3W98 B;  2Y2H A;  1B67 A;  1U35 C;  4DRB A;  4Z66 C;  3C1C D;  2NZD B;  5GXQ B;  4H9Q A;  3MGR A;  5GSU D;  3REI A;  3NQJ B;  3X1V C;  4H9R A;  2IO5 C;  5AV5 D;  5F99 B;  3AZH C;  4XUJ A;  4J8U D;  3X1S B;  5AVB D;  1F66 B;  5B0Y C;  3MNN B;  3O62 D;  1M19 B;  2F8N A;  4CSR A;  3KXB A;  3AZL C;  5B31 C;  2FFF B;  3REK B;  1U35 A;  3TU4 C;  4Z66 A;  1M1A C;  5BNV A;  5B32 B;  4G92 C;  4YM6 B;  4WU9 D;  3AZH A;  3REJ D;  3X1V A;  3X1T C;  3UTB C;  1P3K B;  3AZF D;  5B2J B;  1BH9 B;  4EO5 C;  5B0Y A;  3W98 D;  3AZL A;  1P3I B;  5GT0 D;  5B31 A;  1TAF B;  4ZBJ B;  3TU4 A;  1M1A A;  2NZD D;  5AY8 B;  1P3M B;  5KDM B;  5F99 D;  5CPJ D;  3X1T A;  3UTB A;  1KX4 C;  3WA9 D;  5AV6 B;  4KUD D;  4H9S C;  5BNX A;  4R8P D;  3W97 B;  3REK D;  3KWQ B;  4H9P B;  5DNN C;  2ZM5 A;  3A1K A;  1KX3 C;  4YM6 D;  3AZM C;  5B33 C;  3LJA B;  3EG5 B;  1KX4 A;  1AOI D;  1EQZ D;  1TZY B;  2Y2O A;  4J8V A;  4H9S A;  5B1L D;  4J8W B;  2NQB D;  3REL D;  3C1B D;  2YFV A;  3KSY A;  1N1J B;  5DNN A;  3MGS B;  4X23 B;  3W99 B;  5AY8 D;  2DQN C;  1KX3 A;  3AZM A;  5B33 A;  2Y2M A;  5B0Z D;  3LEL B;  1HQ3 B;  4HGA B;  4QLC C;  3LZ0 B;  5E5A B;  3W96 A;  1P3G B;  3W97 D;  3AFA B;  2HUE C;  5GT3 C;  3V9R A;  1P34 D;  2BYM A;  3P5J B;  5AVC C;  3H0M C;  3B0D B;  4E44 A;  4H9O B;  1TZY D;  4QLC A;  4J8W D;  2ARO B;  5B24 B;  4NFT A;  5CP6 D;  5GT3 A;  1BH8 B;  2PYO B;  3AZI A;  3AZJ C;  3W99 D;  1JFI B;  5AVC A;  1Q9C A;  3H0R C;  5B31 D;  4YS3 C;  3TU4 D;  1M1A D;  3NQU B;  3AZG C;  3LEL D;  1HQ3 D;  1P3A B;  5BO0 A;  3LZ0 D;  3B6G C;  2F8N K;  4XZQ C;  3X1T D;  1P3P C;  2RIQ A;  4J8X C;  1S32 B;  3WTP B;  3UTA C;  3MGP C;  4G91 C;  3AZJ A;  5DNM B;  4YS3 A;  3AZG A;  5CPI C;  1H3O A;  4AWL B;  2G5I C;  1P3L C;  3B6G A;  5B40 B;  2CV5 D;  4XZQ A;  5CPK A;  1P3P A;  4J8X A;  3C1C B;  4DQY B;  4J8V D;  5GSU B;  3MGP A;  3UTA A;  4WNN A;  5AV5 B;  1Z2C B;  1M18 D;  4WZS B;  5DNN D;  3B6F C;  2VQR A;  5JRG C;  3O62 B;  5CPI A;  1KX5 C;  1P3B B;  1KX3 D;  3X1U C;  1P3L A;  2ZY2 A;  3UT9 B;  5G49 B;  3WTP D;  4H9N B;  4WU9 B; 
#chains in the Genus database with same CATH homology
 3REJ B;  3W96 D;  1ZLA B;  4ZUX C;  3AZF B;  3A1I A;  3NQJ A;  3B6F A;  1P3K C;  5B1M D;  5JRG A;  1KX5 A;  3X1U A;  5B40 D;  5B2J C;  2Y2K A;  5GT0 B;  5CHL B;  5JA4 B;  3WAA B;  1T3U A;  1P3I C;  4ZBJ C;  3AZE B;  5CPJ B;  5AV9 B;  4ZUX A;  3WA9 B;  1P3K A;  3AZI D;  4KUD B;  5AVC D;  3VH5 W;  3LZ1 B;  1P3B D;  5FUG B;  5B2J A;  1BH9 A;  5AV6 C;  4R8P B;  3UT9 D;  1ID3 B;  1P3I A;  4KGC C;  1ZLA D;  3KUY C;  1AOI B;  1EQZ B;  5B1L B;  2NQB B;  4UUZ B;  3REH D;  3REL B;  5AV6 A;  3C1B B;  1P3O D;  3AZG D;  3AZK C;  3WAA D;  1PZR A;  5B2I C;  5C3I B;  1F1E A;  2FJ7 C;  4XZQ D;  4JJN D;  5CPK D;  1P3P D;  4KGC A;  3AZE D;  4J8X D;  5AV9 D;  3KUY A;  4Z5T D;  5B0Z B;  4H9Q B;  3REI B;  4H9R B;  5B32 G;  4XUJ B;  3LZ1 D;  4HGA C;  3A6N C;  3AV1 C;  1ID3 D;  5AV8 C;  2F8N B;  3AZK A;  4WU8 C;  5B2I A;  4CSR B;  3KXB B;  1P34 B;  2JE5 A;  2FJ7 A;  1R4V A;  4NE6 A;  2ZY4 A;  3MGQ C;  1U35 B;  5BNV B;  3B0D C;  3AZH B;  2IO5 B;  1BFM A;  3A6N A;  3AV1 A;  3AYW C;  2Y2I A;  5AV8 A;  5CP6 B;  3B6F D;  2ARO C;  5B24 C;  4WU8 A;  1KX5 D;  3X1U D;  3EPK A;  2JCH A;  3AZL B;  5B31 B;  3EPL A;  1P3F C;  3MGQ A;  3TU4 B;  3B0C W;  1M1A B;  3MGR D;  3REI D;  2Y2N A;  4XUJ D;  3X1T B;  4ZUX D;  1P3A C;  4WV4 B;  3AYW A;  4EO5 B;  2F8N D;  2ARO A;  5B24 A;  3KXB D;  3AN2 C;  1BH8 A;  2YFW A;  1U35 D;  1P3F A;  4Z66 D;  3X1V D;  3AZH D;  2CV5 B;  2G5H C;  2Y2L A;  4AWL C;  1P3A A;  3WKJ C;  1KX4 B;  2JSS A;  5BT1 C;  5B0Y D;  4Z2M G;  4J8V B;  3C1C C;  3AN2 A;  3AZL D;  1M18 B;  2YFV B;  5AV5 C;  5DNN B;  2HIO C;  4J8U C;  1KX3 B;  5AVB C;  3AV2 C;  3AZM B;  3KUY D;  3UTB D;  3MVD C;  3WKJ A;  4WJ3 C;  3C1C A;  3VH6 A;  3W96 B;  2F8N H;  3AZN C;  3REJ C;  5AV5 A;  3AZK D;  5B2I D;  2HIO A;  3V9R B;  5B1M B;  4J8U A;  3AZF C;  4LD9 C;  3EPJ A;  2FJ7 D;  5AVB A;  3AV2 A;  2XD1 A;  3MVD A;  4CAY A;  1KX4 D;  3W98 C;  4QLC B;  5G49 A;  2BYK A;  2NZD C;  5GXQ C;  1HTA A;  1W2E A;  3A6N D;  3AV1 D;  3AZN A;  4H9N A;  5AV8 D;  3REJ A;  5GT3 B;  5F99 C;  3X1S C;  3AZI B;  3AZF A;  1ULY A;  5AVC B;  4LD9 A;  4KHA A;  3WA9 C;  3AZM D;  1F66 C;  2Y2Q A;  5B33 D;  3MNN C;  1M19 C;  2UWX A;  3W98 A;  4R8P C;  5BO0 B;  3REK C;  2NZD A;  5B32 C;  5GXQ A;  4DRA A;  3AYW D;  4YM6 C;  3EPH A;  5F99 A;  3X1S A;  1F66 A;  3REH B;  2CWE A;  2LY8 A;  5BS7 C;  3MNN A;  4YS3 B;  1M19 A;  5B1L C;  1P3O B;  2NQB C;  3AZG B;  1H3O B;  4NE3 A;  4QLC D;  3REK A;  4XZQ B;  2Y2G A;  4JJN B;  5CPK B;  1P3P B;  5B32 A;  4J8X B;  3R45 B;  4Z5T B;  5AY8 C;  1P3M C;  4YM6 A;  5GT3 D;  3UTA B;  3MGP B;  4G91 B;  3AN2 D;  5B0Z C;  5BS7 A;  5B1L A;  2NQB A;  1WWS A;  1KU5 A;  3W97 C;  1TAF A;  3KWQ C;  1P34 C;  3WKJ D;  5AY8 A;  1P3M A;  5KDM A;  5BT1 D;  3LJA C;  1B6W A;  3AZJ D;  5B0Z A;  1TZY C;  4YS3 D;  4J8W C;  2HIO D;  3B6F B;  5JRG B;  1KX5 B;  3W97 A;  3X1U B;  3AV2 D;  3B6G D;  3KWQ A;  5CP6 C;  4M6B A;  4H9P A;  2W8S A;  4X23 C;  3MVD D;  3MGS C;  1P34 A;  3W99 C;  3VH5 T;  3MGR B;  3UTA D;  3MGP D;  3LJA A;  3LEL C;  4ZUX B;  1HQ3 C;  3AZN D;  1TZY A;  3LZ0 C;  4J8W A;  5CPI D;  2RVQ C;  5E5A C;  1P3G C;  4LD9 D;  1P3L D;  3AFA C;  2DF4 C;  3H0L C;  1N1J A;  5CP6 A;  3MGS A;  4X23 A;  4Z66 B;  3W99 A;  3X1V B;  5GXQ D;  3LEL A;  1HQ3 A;  3LZ0 A;  4UPK A;  2CV5 C;  5JRG D;  5B0Y B;  5E5A A;  3X1S D;  1P3G A;  3AFA A;  1F66 D;  3MNN D;  1M19 D;  4J8V C;  2PYO C;  1A7W A;  4G92 B;  1M18 C;  2F8N G;  4H9O A;  2J8P A;  3FDD A;  5B32 D;  4KGC B;  3KUY B;  3UTB B;  3KFU G;  2CV5 A;  1P3K D;  1S32 C;  5BNX B;  5B2J D;  3WTP C;  2PYO A;  1JFI A;  3AZK B;  3W96 C;  5B2I B;  1P3I D;  3IP4 C;  5DNM C;  1M18 A;  2FJ7 B;  3NQU A;  5B1M C;  1P3M D;  5B40 C;  5B31 G;  1S32 A;  3B0C T;  3A6N B;  5AV6 D;  3AV1 B;  3WTP A;  5GSU C;  5AV8 B;  4WU8 B;  5DNM A;  3KWQ D;  3WTP E;  4KGC D;  5B33 B;  3MGQ B;  5B1M A;  3O62 C;  2Y2P A;  3AZI C;  1P3B C;  3B0B A;  5B40 A;  3LJA D;  3UT9 C;  5GSU A;  3AYW B;  4WU9 C;  1ZLA C;  2BYM B;  3MGS D;  4X23 D;  2F2A C;  2YFW B;  1P3F B;  3O62 A;  1P3B A;  3REH C;  5GT0 C;  3UT9 A;  2XD5 A;  2BG1 A;  1P3O C;  2Y2J A;  3WAA C;  2HUE B;  4WU9 A;  4JJN C;  5CPK C;  2RVQ D;  4NE5 A;  5E5A D;  3AZE C;  4WU8 D;  5AV9 C;  5CPJ C;  3AFA D;  4Z5T C;  1P3G D;  3F6T A;  3AN2 B;  1ZLA A;  3MGQ D;  4KUD C;  3LZ1 C;  3REH A;  5GT0 A;  1ID3 C;  1P3O A;  5JA4 A;  2ZY5 A;  3WAA A;  3WKJ B;  3VH6 W;  4JJN A;  2L5A A;  2ARO D;  2ZY3 A;  5B24 D;  3AZE A;  3R45 A;  5AV9 A;  3AZJ B;  4Z5T A;  5CPJ A;  1AOI C;  3WA9 A;  1EQZ C;  1P3F D;  2PYO D;  4KUD A;  2HIO B;  3LZ1 A;  4J8U B;  5FUG A;  3REL C;  4R8P A;  5AVB B;  3AV2 B;  3C1B C;  1ID3 A;  3VH5 A;  3B6G B;  3MVD B;  1P3A D;  4CAY B;  4Z2M H;  1WWI A;  5C3I C;  2BYK B;  4WNN B;  1S32 D;  3MGR C;  1AOI A;  3REI C;  3AZN B;  1EQZ A;  3AL0 C;  4XUJ C;  5CPI B;  4UUZ A;  5DNM D;  3REL A;  4LD9 B;  4KHA B;  1P3L B;  3C1B A;  3VH6 T;  3KXB C;  4E45 A;  3W98 B;  2Y2H A;  1B67 A;  1U35 C;  4DRB A;  4Z66 C;  3C1C D;  2NZD B;  5GXQ B;  4H9Q A;  3MGR A;  5GSU D;  3REI A;  3NQJ B;  3X1V C;  4H9R A;  2IO5 C;  5AV5 D;  5F99 B;  3AZH C;  4XUJ A;  4J8U D;  3X1S B;  5AVB D;  1F66 B;  5B0Y C;  3MNN B;  3O62 D;  1M19 B;  2F8N A;  4CSR A;  3KXB A;  3AZL C;  5B31 C;  2FFF B;  3REK B;  1U35 A;  3TU4 C;  4Z66 A;  1M1A C;  5BNV A;  5B32 B;  4G92 C;  4YM6 B;  4WU9 D;  3AZH A;  3REJ D;  3X1V A;  3X1T C;  3UTB C;  1P3K B;  3AZF D;  5B2J B;  1BH9 B;  4EO5 C;  5B0Y A;  3W98 D;  3AZL A;  1P3I B;  5GT0 D;  5B31 A;  1TAF B;  4ZBJ B;  3TU4 A;  1M1A A;  2NZD D;  5AY8 B;  1P3M B;  5KDM B;  5F99 D;  5CPJ D;  3X1T A;  3UTB A;  1KX4 C;  3WA9 D;  5AV6 B;  4KUD D;  4H9S C;  5BNX A;  4R8P D;  3W97 B;  3REK D;  3KWQ B;  4H9P B;  5DNN C;  2ZM5 A;  3A1K A;  1KX3 C;  4YM6 D;  3AZM C;  5B33 C;  3LJA B;  3EG5 B;  1KX4 A;  1AOI D;  1EQZ D;  1TZY B;  2Y2O A;  4J8V A;  4H9S A;  5B1L D;  4J8W B;  2NQB D;  3REL D;  3C1B D;  2YFV A;  3KSY A;  1N1J B;  5DNN A;  3MGS B;  4X23 B;  3W99 B;  5AY8 D;  2DQN C;  1KX3 A;  3AZM A;  5B33 A;  2Y2M A;  5B0Z D;  3LEL B;  1HQ3 B;  4HGA B;  4QLC C;  3LZ0 B;  5E5A B;  3W96 A;  1P3G B;  3W97 D;  3AFA B;  2HUE C;  5GT3 C;  3V9R A;  1P34 D;  2BYM A;  3P5J B;  5AVC C;  3H0M C;  3B0D B;  4E44 A;  4H9O B;  1TZY D;  4QLC A;  4J8W D;  2ARO B;  5B24 B;  4NFT A;  5CP6 D;  5GT3 A;  1BH8 B;  2PYO B;  3AZI A;  3AZJ C;  3W99 D;  1JFI B;  5AVC A;  1Q9C A;  3H0R C;  5B31 D;  4YS3 C;  3TU4 D;  1M1A D;  3NQU B;  3AZG C;  3LEL D;  1HQ3 D;  1P3A B;  5BO0 A;  3LZ0 D;  3B6G C;  2F8N K;  4XZQ C;  3X1T D;  1P3P C;  2RIQ A;  4J8X C;  1S32 B;  3WTP B;  3UTA C;  3MGP C;  4G91 C;  3AZJ A;  5DNM B;  4YS3 A;  3AZG A;  5CPI C;  1H3O A;  4AWL B;  2G5I C;  1P3L C;  3B6G A;  5B40 B;  2CV5 D;  4XZQ A;  5CPK A;  1P3P A;  4J8X A;  3C1C B;  4DQY B;  4J8V D;  5GSU B;  3MGP A;  3UTA A;  4WNN A;  5AV5 B;  1Z2C B;  1M18 D;  4WZS B;  5DNN D;  3B6F C;  2VQR A;  5JRG C;  3O62 B;  5CPI A;  1KX5 C;  1P3B B;  1KX3 D;  3X1U C;  1P3L A;  2ZY2 A;  3UT9 B;  5G49 B;  3WTP D;  4H9N B;  4WU9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...