5CPJA

Nucleosome containing methylated sat2r dna
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
94
structure length
94
Chain Sequence
YRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags "structural protein/dna
molecule keywords Histone H3.1
publication title Influence of DNA methylation on positioning and DNA flexibility of nucleosomes with pericentric satellite DNA.
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 94
sequence length 94
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5cpjA00
3AZEA 4J8UA 4JJND 1M18C 3WA9A 4X23A 3KUYD 3C1BB 3LZ1D 1P3PB 5B33B 2F8NA 4EO5B 5BNVB 5F99C 4CSRB 4G91B 3AZJB 3AFAD 3LZ0D 1A7WA 4QLCB 4H9NB 3KWQB 4LD9D 4HGAC 5BNXB 5CP6D 4ZUXB 1P3OC 4KGCA 2HIOA 5DNMC 1ID3D 2CV5B 3AZLC 4J8WB 3B6FD 2IO5C 4Z5TC 5GT0C 3REIA 5AV6A 2NQBC 5GSUD 1WWIA 5B31D 5B32B 1P3GD 1BH8B 3MGSB 3LJAB 2HUEC 4YS3C 5DNNC 1F66B 1AOIC 1HQ3B 1P3KC 3VH5A 3W98A 3KXBA 3AZFA 5BO0A 4WU8B 5G49A 5CPIC 1P3FC 1TAFA 1ZLAB 5F99D 3UT9A 3X1SD 5B24A 5CPKA 2NZDB 1P3OD 4NE6A 5DNMD 3WAAD 3MGRB 3AZNC 2NQBD 3AZHB 3WTPB 3AZKB 3B0CT 4Z66D 1M19B 3REJB 4YS3D 3C1CA 2LY8A 5DNND 4H9QB 4G92B 3KSYA 3R45A 4KHAB 1AOID 1P3KD 1P3PA 5BT1D 3W96A 5E5AA 5BNVA 5GT3C 5B40A 1U35B 1P3BC 4Z2MG 2FJ7C 4QLCA 4H9SA 3AV1C 3W97A 5AV5A 5CPID 5B0YB 3AV2B 1P3FD 3LELD 4ZUXA 3A6NC 5GXQC 1P3AC 4CAYA 1M1AB 5B0ZA 3W99C 1TZYA 4XUJB 3REHA 5B32A 3MGSA 1EQZB 3AZEC 3RELA 1P3ID 3X1UA 4J8UC 3WA9C 1P3MA 1BH9A 3O62B 1P3LA 4X23C 3UTBB 2YFWB 4KUDB 2BYMA 5AVCB 5AV9B 4R8PA 4UUZB 3AYWB 4YM6D 2FJ7D 5B1MA 5KDMA 3AV1D 4KGCC 4J8VB 2HIOC 3UTAB 5B1LB 3WKJB 3A6ND 1KX4A 5GXQD 3MGRA 3X1VB 1P3AD 3REIC 3MGPD 3AN2D 5AV6C 3MNNB 3W99D 1H3OA 3V9RB 5AY8A 5AVBD 3AZHA 1P34D 1S32C 2PYOB 3AZED 4AWLB 1KX5B 3WA9D 3REKC 4X23D 1KU5A 5CPJD 1R4VA 3KXBC 3AZFC 3B6GB 3W98C 5JA4A 3TU4A 2F8ND 3NQUA 4JJNB 3UT9C 5B0YA 3KUYB 4WU9A 3LZ1B 5CPKC 5JRGA 3MVDA 2HIOD 3B0DC 4XUJA 3AZIA 4H9OA 3AFAB 3LZ0B 2BYKA 3REID 5AV6D 1JFIB 4LD9B 5CP6B 3UTBA 1S32D 1F1EA 1ID3B 3C1CC 1BFMA 1KX3A 3AZGA 3B6FB 1P3PC 5GSUB 3REKD 1N1JB 3VH6W 5B31B 1P3GB 3W96C 5E5AC 4EO5C 5B40C 2F8NK 3W98D 3KXBD 3AZFD 4XZQA 4QLCC 5B2IA 4H9SC 3X1TD 3AZMA 3W97C 5AV5C 2RVQC 4ZUXC 4J8XD 3UT9D 3UTAA 5B0ZC 1TZYC 4H9PA 3REHC 5B32C 5F99B 3MGSC 2AROA 1M18D 3RELC 3X1SB 3X1UC 1P3MC 4E45A 1P3LC 4HGAB 5B32G 1P3OB 5B2JA 5DNMB 3WAAB 3C1CD 2IO5B 4R8PC 5FUGB 2NQBB 5AV8A 4M6BA 5E5AD 3MGQA 3W96D 5B40D 2HUEB 4Z66B 3KUYA 4YS3B 5B1MC 5DNNB 3W97D 5AV5D 4WNNB 1AOIB 2RVQD 3AZLD 1P3KB 1B67A 1KX4C 4Z5TD 5GT0D 3MGRC 4WV4B 3AFAA 5B0ZD 1TZYD 5AY8C 1JFIA 3AZHC 5CPIB 1P3FB 3REHD 3LELB 5CP6A 3C1BA 3NQJB 3RELD 3X1UD 1P3MD 5B33A 1P3LD 4CSRA 5GSUA 3AZJA 1P3GA 4NE3A 5C3IB 4H9NA 3KWQA 3TU4C 5BNXA 1P3IB 4R8PD 5B0YC 4WU9C 2CV5A 4J8WA 4DRAA 5B1MD 5JRGC 3MVDC 1BH8A 4XUJC 3LJAA 3AZIC 1KX4D 3B0CW 3AZND 1F66A 1HQ3A 4YM6B 2FJ7B 3X1SA 5AY8D 3AV1B 3UTBC 1KX3C 3AZGC 3A6NB 3WAAA 5GXQB 4WU8A 1P3AB 4H9RB 3MGPB 3AN2B 1ZLAA 3W99B 5GT3D 1P3BD 5AVBB 2YFVB 1P34B 1ULYA 4XZQC 5B2IC 3AZMC 3AZEB 5BS7A 4Z66A 3TU4D 2NZDA 3WA9B 4X23B 4WNNA 3UTAC 4WU9D 5CPJB 5JRGD 3MVDD 3WTPA 2F8NB 3AZKA 3AZID 1M19A 3REJA 2AROC 3LELA 4H9QA 4J8UD 4KHAA 4ZBJC 3NQJA 5B2JC 2JSSA 2HIOB 4DRBA 1U35A 1KX3D 3AZGD 4WZSB 3REIB 5AV6B 3AV2A 5AV8C 1P3IA 3MGQC 3KUYC 5B24C 1S32B 5B2ID 4XZQD 3AZMD 4NE5A 1M1AA 4E44A 4KGCD 3REKB 1EQZA 3W98B 3KXBB 3AZFB 3AFAC 5BO0B 3X1TB 5G49B 3O62A 4YM6A 2YFWA 5CP6C 4J8XB 3UT9B 3C1BC 4KUDA 2AROD 5AVCA 5AV9A 5B33C 5CPKB 4H9RA 3MGPA 5B2JD 3AN2A 4G91C 5GSUC 3AZJC 1P3GC 4UUZA 3VH6A 5AVBA 3KWQC 3AYWA 1P34A 1M18B 4J8VA 5B1LA 5AV8D 5B31G 3WKJA 2CV5C 3MGQD 4NFTA 4J8WC 3VH5T 3X1VA 5B24D 5CPKD 3C1CB 3MNNA 5CPJA 3R45B 3V9RA 3LJAC 1HTAA 2PYOA 2F8NH 5E5AB 3W96B 5B40B 1F66C 1HQ3C 1KX5A 3X1SC 3W97B 5AV5B 3AZLB 3B6GA 3C1BD 3WAAC 4Z5TB 5GT0B 4WU8C 1P3PD 4CAYB 5B33D 1ZLAC 5B0ZB 4JJNA 1TZYB 3AZJD 3REHB 4QLCD 3KWQD 3LZ1A 5BS7C 4Z66C 1S32A 2NZDC 4ZUXD 3RELB 3VH5W 3X1UB 1P3MB 1BH9B 1P3LB 2CV5D 4J8WD 3REKA 3LZ0A 5BT1C 2BYMB 1B6WA 3WTPC 5B32D 4LD9A 4R8PB 3X1TA 3MGSD 3LJAD 3AZKC 1M19C 3REJC 1ID3A 3LELC 4J8XA 4G92C 1F66D 3B6FA 1HQ3D 5B1MB 5KDMB 1N1JA 5B31A 1U35C 1KX4B 4WU8D 3AZNB 5C3IC 2L5AA 3AV2C 1ZLAD 1M18A 1P3IC 1H3OB 5AY8B 5CHLB 1M1AC 2NZDD 5GT3B 5F99A 3MGRD 1P3BB 1EQZC 5JA4B 3B0BA 3AZHD 3O62C 3TU4B 3WTPD 4YM6C 1P3OA 3NQUB 3AZKD 5DNMA 3REJD 1M19D 4KUDC 4WU9B 3AZLA 5AVCC 5AV9C 4Z5TA 5GT0A 5FUGA 2NQBA 5JRGB 3MVDB 3MGPC 3AN2C 1U35D 3AZIB 5AVBC 3AYWC 4YS3A 1P34C 4H9OB 5DNNA 2BYKB 4J8UB 4J8VC 5B0YD 3AV2D 1AOIA 1P3KA 5B1LC 3WKJC 3X1VC 1KX3B 3AZGB 3MNNC 5CPJC 1M1AD 4XUJD 5CPIA 1P3FA 2PYOC 1EQZD 1WWSA 4AWLC 1KX5C 4XZQB 5B2IB 3AZMB 3WTPE 3O62D 4KGCB 3UTBD 2F8NG 3B6GC 4KUDD 5AVCD 5AV9D 3AZNA 4JJNC 4H9PB 3AYWD 3LZ1C 2AROB 2CWEA 4Z2MH 4J8VD 4ZBJB 3UTAD 5B1LD 3WKJD 5B2JB 5GT3A 3LZ0C 3X1VD 1P3BA 3MNND 2FJ7A 1TAFB 4LD9C 3VH6T 3AV1A 3X1TC 1Q9CA 2PYOD 5AV8B 1ID3C 3A6NA 3MGQB 4J8XC 5GXQA 1P3AA 5B24B 3B6FC 1KX5D 3W99A 3B0DB 5B31C 2YFVA 3B6GD
chains in the Genus database with same CATH superfamily
3AZEA 4J8UA 4JJND 1M18C 3WA9A 4X23A 3KUYD 3C1BB 3LZ1D 1P3PB 5B33B 2F8NA 4EO5B 5BNVB 5F99C 2G5IC 4CSRB 4G91B 3AZJB 3AFAD 3LZ0D 1A7WA 4QLCB 4H9NB 3KWQB 4LD9D 4ZUXB 4HGAC 5BNXB 5CP6D 1P3OC 4KGCA 2HIOA 5DNMC 1ID3D 2CV5B 3AZLC 4J8WB 3B6FD 2IO5C 4Z5TC 5GT0C 3REIA 5AV6A 2NQBC 5GSUD 1WWIA 5B31D 2Y2GA 5B32B 1P3GD 1BH8B 3FDDA 3MGSB 2Y2NA 2HUEC 3LJAB 4YS3C 5DNNC 1F66B 1AOIC 1HQ3B 2Y2KA 1P3KC 2VQRA 3VH5A 3W98A 3KXBA 3AZFA 5BO0A 4WU8B 5G49A 5CPIC 1P3FC 1TAFA 1ZLAB 5F99D 3UT9A 3H0MC 3X1SD 5B24A 5CPKA 2NZDB 1P3OD 4NE6A 5DNMD 3WAAD 3H0RC 3MGRB 3AZNC 2NQBD 3KFUG 3AZHB 3WTPB 3AZKB 3B0CT 4Z66D 1M19B 3REJB 4YS3D 3C1CA 2LY8A 5DNND 4H9QB 4G92B 3KSYA 3R45A 4KHAB 2ZM5A 1AOID 1P3KD 1P3PA 5BT1D 3W96A 5E5AA 5BNVA 5GT3C 5B40A 1U35B 1P3BC 4Z2MG 2FJ7C 4QLCA 4H9SA 3AV1C 3W97A 5AV5A 5CPID 5B0YB 3AV2B 1P3FD 3LELD 4ZUXA 3A6NC 5GXQC 1P3AC 4CAYA 1M1AB 5B0ZA 3W99C 1TZYA 4XUJB 3REHA 5B32A 3MGSA 1EQZB 3AZEC 3RELA 1P3ID 3A1KA 3X1UA 4J8UC 3WA9C 1P3MA 1BH9A 3O62B 1P3LA 4X23C 3UTBB 2YFWB 2DF4C 4KUDB 2BYMA 5AVCB 5AV9B 4R8PA 4UUZB 3AYWB 4YM6D 2FJ7D 5B1MA 5KDMA 3AV1D 4KGCC 4J8VB 2HIOC 3UTAB 5B1LB 3WKJB 3A6ND 1KX4A 5GXQD 3MGRA 3X1VB 1P3AD 3REIC 3MGPD 3AN2D 5AV6C 3MNNB 3W99D 1H3OA 3V9RB 5AY8A 5AVBD 3EPKA 3AZHA 1W2EA 1P34D 1S32C 2PYOB 3AZED 4AWLB 1KX5B 3WA9D 3REKC 4X23D 4DQYB 1KU5A 5CPJD 1R4VA 3KXBC 3AZFC 3B6GB 3W98C 5JA4A 3TU4A 2F8ND 3NQUA 4JJNB 3A1IA 3UT9C 2BG1A 5B0YA 3KUYB 4WU9A 3LZ1B 5CPKC 5JRGA 3MVDA 2HIOD 3B0DC 4XUJA 3AZIA 3AL0C 4H9OA 3AFAB 3LZ0B 2BYKA 3REID 5AV6D 1JFIB 4LD9B 5CP6B 3UTBA 1S32D 1F1EA 1ID3B 3C1CC 1BFMA 1KX3A 3AZGA 3B6FB 1P3PC 5GSUB 3REKD 1N1JB 5B31B 3VH6W 1P3GB 3W96C 5E5AC 4EO5C 5B40C 2F8NK 3W98D 3KXBD 3AZFD 4XZQA 4QLCC 5B2IA 4H9SC 3X1TD 3AZMA 3W97C 5AV5C 2RVQC 4ZUXC 4J8XD 3UT9D 3UTAA 5B0ZC 1TZYC 4H9PA 3REHC 5B32C 5F99B 3MGSC 2AROA 1Z2CB 1M18D 3RELC 3X1SB 3X1UC 2Y2OA 1P3MC 4E45A 1P3LC 4HGAB 5B32G 1P3OB 5B2JA 5DNMB 3WAAB 3C1CD 2IO5B 3IP4C 4R8PC 5FUGB 2NQBB 5AV8A 4M6BA 5E5AD 3MGQA 3W96D 5B40D 2HUEB 4Z66B 3KUYA 4YS3B 5B1MC 5DNNB 3W97D 5AV5D 4WNNB 2JCHA 2RVQD 3AZLD 1P3KB 1AOIB 1B67A 1KX4C 4Z5TD 2G5HC 5GT0D 3MGRC 4WV4B 3AFAA 5B0ZD 1TZYD 5AY8C 1JFIA 3AZHC 5CPIB 1P3FB 3REHD 3LELB 5CP6A 2ZY2A 3C1BA 3NQJB 4UPKA 3RELD 3X1UD 1P3MD 5B33A 1P3LD 4CSRA 5GSUA 3AZJA 1P3GA 4NE3A 5C3IB 4H9NA 3KWQA 3TU4C 5BNXA 1P3IB 4R8PD 5B0YC 4WU9C 2CV5A 4J8WA 2RIQA 2Y2JA 4DRAA 3H0LC 5B1MD 5JRGC 3MVDC 1BH8A 2J8PA 4XUJC 3LJAA 3AZIC 1KX4D 3B0CW 3AZND 1F66A 2Y2HA 1HQ3A 4YM6B 2FJ7B 3X1SA 5AY8D 3AV1B 3P5JB 3UTBC 1KX3C 3AZGC 3A6NB 3WAAA 5GXQB 4WU8A 1P3AB 4H9RB 3MGPB 3AN2B 1ZLAA 3W99B 5GT3D 1P3BD 5AVBB 2YFVB 1P34B 1ULYA 4XZQC 5B2IC 3AZMC 3AZEB 5BS7A 4Z66A 3TU4D 2NZDA 3WA9B 4X23B 4WNNA 3UTAC 4WU9D 5CPJB 5JRGD 3MVDD 3WTPA 2F8NB 3AZKA 3AZID 1M19A 3REJA 2AROC 3LELA 4H9QA 4J8UD 4KHAA 4ZBJC 3NQJA 3EG5B 2Y2LA 5B2JC 2JSSA 2HIOB 4DRBA 1U35A 1KX3D 3AZGD 4WZSB 3REIB 5AV6B 3AV2A 5AV8C 1P3IA 3MGQC 3KUYC 5B24C 1S32B 5B2ID 4XZQD 3AZMD 4NE5A 1M1AA 4E44A 4KGCD 3REKB 1EQZA 3W98B 3KXBB 3AZFB 3AFAC 5BO0B 3X1TB 2ZY4A 5G49B 3O62A 4YM6A 2YFWA 5CP6C 4J8XB 3UT9B 3C1BC 4KUDA 2AROD 5AVCA 5AV9A 5B33C 5CPKB 4H9RA 3MGPA 5B2JD 3AN2A 4G91C 5GSUC 3AZJC 1P3GC 4UUZA 3VH6A 5AVBA 3KWQC 3AYWA 1P34A 1M18B 4J8VA 5B1LA 5AV8D 5B31G 3WKJA 2CV5C 3MGQD 4NFTA 4J8WC 3VH5T 3X1VA 5B24D 5CPKD 3EPHA 3C1CB 3MNNA 5CPJA 3R45B 3V9RA 3LJAC 1HTAA 2PYOA 2F8NH 5E5AB 3W96B 5B40B 1F66C 1HQ3C 1KX5A 3X1SC 3W97B 5AV5B 3AZLB 3B6GA 3C1BD 3WAAC 4Z5TB 5GT0B 4WU8C 1P3PD 4CAYB 5B33D 1ZLAC 5B0ZB 4JJNA 1TZYB 3EPLA 3AZJD 3REHB 4QLCD 3KWQD 3LZ1A 5BS7C 4Z66C 1S32A 2NZDC 4ZUXD 3RELB 3VH5W 3X1UB 1P3MB 1BH9B 1P3LB 2CV5D 4J8WD 3REKA 3LZ0A 5BT1C 2BYMB 1B6WA 2ZY3A 5B32D 3WTPC 4LD9A 4R8PB 3X1TA 3MGSD 3LJAD 3AZKC 1M19C 3REJC 1ID3A 3LELC 3F6TA 4J8XA 4G92C 1F66D 3B6FA 1HQ3D 5B1MB 5KDMB 1N1JA 5B31A 1U35C 1KX4B 4WU8D 3AZNB 5C3IC 2L5AA 3AV2C 1ZLAD 1M18A 1P3IC 1H3OB 5AY8B 5CHLB 1M1AC 2ZY5A 2NZDD 2XD5A 2XD1A 5GT3B 5F99A 3MGRD 1P3BB 1EQZC 5JA4B 3B0BA 3AZHD 3O62C 3TU4B 3WTPD 4YM6C 1P3OA 3NQUB 2DQNC 3AZKD 5DNMA 3REJD 1M19D 4KUDC 4WU9B 3AZLA 5AVCC 5AV9C 4Z5TA 5GT0A 5FUGA 2NQBA 5JRGB 3MVDB 3MGPC 3AN2C 1U35D 3AZIB 5AVBC 3AYWC 2FFFB 4YS3A 4H9OB 1P34C 5DNNA 2BYKB 4J8UB 4J8VC 5B0YD 3AV2D 1AOIA 1P3KA 5B1LC 3WKJC 3X1VC 2Y2QA 1T3UA 2F2AC 3AZGB 1KX3B 2Y2IA 3MNNC 5CPJC 2Y2MA 1M1AD 4XUJD 5CPIA 1P3FA 2PYOC 1EQZD 1WWSA 4AWLC 1KX5C 4XZQB 5B2IB 3AZMB 3WTPE 3O62D 4KGCB 3UTBD 2JE5A 2F8NG 4WJ3C 3B6GC 4KUDD 5AVCD 5AV9D 3AZNA 4JJNC 4H9PB 3AYWD 3LZ1C 2AROB 2CWEA 4Z2MH 4J8VD 4ZBJB 3UTAD 5B1LD 3WKJD 5B2JB 3EPJA 1PZRA 5GT3A 3LZ0C 3X1VD 1P3BA 3MNND 2FJ7A 1TAFB 4LD9C 3VH6T 3AV1A 3X1TC 1Q9CA 2PYOD 5AV8B 1ID3C 3A6NA 3MGQB 4J8XC 5GXQA 1P3AA 5B24B 2W8SA 3B6FC 1KX5D 2Y2PA 3W99A 3B0DB 5B31C 2UWXA 2YFVA 3B6GD
chains in the Genus database with same CATH topology
3AZEA 4J8UA 4JJND 1M18C 3WA9A 4X23A 3KUYD 3C1BB 3LZ1D 1P3PB 5B33B 2F8NA 4EO5B 5BNVB 5F99C 2G5IC 4CSRB 4G91B 3AZJB 3AFAD 3LZ0D 1A7WA 4QLCB 4H9NB 3KWQB 4LD9D 4ZUXB 4HGAC 5BNXB 5CP6D 1P3OC 4KGCA 2HIOA 5DNMC 1ID3D 2CV5B 3AZLC 4J8WB 3B6FD 2IO5C 4Z5TC 5GT0C 3REIA 5AV6A 2NQBC 5GSUD 1WWIA 5B31D 2Y2GA 5B32B 1P3GD 1BH8B 3FDDA 3MGSB 2Y2NA 2HUEC 3LJAB 4YS3C 5DNNC 1F66B 1AOIC 1HQ3B 2Y2KA 1P3KC 2VQRA 3VH5A 3W98A 3KXBA 3AZFA 5BO0A 4WU8B 5G49A 5CPIC 1P3FC 1TAFA 1ZLAB 5F99D 3UT9A 3H0MC 3X1SD 5B24A 5CPKA 2NZDB 1P3OD 4NE6A 5DNMD 3WAAD 3H0RC 3MGRB 3AZNC 2NQBD 3KFUG 3AZHB 3WTPB 3AZKB 3B0CT 4Z66D 1M19B 3REJB 4YS3D 3C1CA 2LY8A 5DNND 4H9QB 4G92B 3KSYA 3R45A 4KHAB 2ZM5A 1AOID 1P3KD 1P3PA 5BT1D 3W96A 5E5AA 5BNVA 5GT3C 5B40A 1U35B 1P3BC 4Z2MG 2FJ7C 4QLCA 4H9SA 3AV1C 3W97A 5AV5A 5CPID 5B0YB 3AV2B 1P3FD 3LELD 4ZUXA 3A6NC 5GXQC 1P3AC 4CAYA 1M1AB 5B0ZA 3W99C 1TZYA 4XUJB 3REHA 5B32A 3MGSA 1EQZB 3AZEC 3RELA 1P3ID 3A1KA 3X1UA 4J8UC 3WA9C 1P3MA 1BH9A 3O62B 1P3LA 4X23C 3UTBB 2YFWB 2DF4C 4KUDB 2BYMA 5AVCB 5AV9B 4R8PA 4UUZB 3AYWB 4YM6D 2FJ7D 5B1MA 5KDMA 3AV1D 4KGCC 4J8VB 2HIOC 3UTAB 5B1LB 3WKJB 3A6ND 1KX4A 5GXQD 3MGRA 3X1VB 1P3AD 3REIC 3MGPD 3AN2D 5AV6C 3MNNB 3W99D 1H3OA 3V9RB 5AY8A 5AVBD 3EPKA 3AZHA 1W2EA 1P34D 1S32C 2PYOB 3AZED 4AWLB 1KX5B 3WA9D 3REKC 4X23D 4DQYB 1KU5A 5CPJD 1R4VA 3KXBC 3AZFC 3B6GB 3W98C 5JA4A 3TU4A 2F8ND 3NQUA 4JJNB 3A1IA 3UT9C 2BG1A 5B0YA 3KUYB 4WU9A 3LZ1B 5CPKC 5JRGA 3MVDA 2HIOD 3B0DC 4XUJA 3AZIA 3AL0C 4H9OA 3AFAB 3LZ0B 2BYKA 3REID 5AV6D 1JFIB 4LD9B 5CP6B 3UTBA 1S32D 1F1EA 1ID3B 3C1CC 1BFMA 1KX3A 3AZGA 3B6FB 1P3PC 5GSUB 3REKD 1N1JB 5B31B 3VH6W 1P3GB 3W96C 5E5AC 4EO5C 5B40C 2F8NK 3W98D 3KXBD 3AZFD 4XZQA 4QLCC 5B2IA 4H9SC 3X1TD 3AZMA 3W97C 5AV5C 2RVQC 4ZUXC 4J8XD 3UT9D 3UTAA 5B0ZC 1TZYC 4H9PA 3REHC 5B32C 5F99B 3MGSC 2AROA 1Z2CB 1M18D 3RELC 3X1SB 3X1UC 2Y2OA 1P3MC 4E45A 1P3LC 4HGAB 5B32G 1P3OB 5B2JA 5DNMB 3WAAB 3C1CD 2IO5B 3IP4C 4R8PC 5FUGB 2NQBB 5AV8A 4M6BA 5E5AD 3MGQA 3W96D 5B40D 2HUEB 4Z66B 3KUYA 4YS3B 5B1MC 5DNNB 3W97D 5AV5D 4WNNB 2JCHA 2RVQD 3AZLD 1P3KB 1AOIB 1B67A 1KX4C 4Z5TD 2G5HC 5GT0D 3MGRC 4WV4B 3AFAA 5B0ZD 1TZYD 5AY8C 1JFIA 3AZHC 5CPIB 1P3FB 3REHD 3LELB 5CP6A 2ZY2A 3C1BA 3NQJB 4UPKA 3RELD 3X1UD 1P3MD 5B33A 1P3LD 4CSRA 5GSUA 3AZJA 1P3GA 4NE3A 5C3IB 4H9NA 3KWQA 3TU4C 5BNXA 1P3IB 4R8PD 5B0YC 4WU9C 2CV5A 4J8WA 2RIQA 2Y2JA 4DRAA 3H0LC 5B1MD 5JRGC 3MVDC 1BH8A 2J8PA 4XUJC 3LJAA 3AZIC 1KX4D 3B0CW 3AZND 1F66A 2Y2HA 1HQ3A 4YM6B 2FJ7B 3X1SA 5AY8D 3AV1B 3P5JB 3UTBC 1KX3C 3AZGC 3A6NB 3WAAA 5GXQB 4WU8A 1P3AB 4H9RB 3MGPB 3AN2B 1ZLAA 3W99B 5GT3D 1P3BD 5AVBB 2YFVB 1P34B 1ULYA 4XZQC 5B2IC 3AZMC 3AZEB 5BS7A 4Z66A 3TU4D 2NZDA 3WA9B 4X23B 4WNNA 3UTAC 4WU9D 5CPJB 5JRGD 3MVDD 3WTPA 2F8NB 3AZKA 3AZID 1M19A 3REJA 2AROC 3LELA 4H9QA 4J8UD 4KHAA 4ZBJC 3NQJA 3EG5B 2Y2LA 5B2JC 2JSSA 2HIOB 4DRBA 1U35A 1KX3D 3AZGD 4WZSB 3REIB 5AV6B 3AV2A 5AV8C 1P3IA 3MGQC 3KUYC 5B24C 1S32B 5B2ID 4XZQD 3AZMD 4NE5A 1M1AA 4E44A 4KGCD 3REKB 1EQZA 3W98B 3KXBB 3AZFB 3AFAC 5BO0B 3X1TB 2ZY4A 5G49B 3O62A 4YM6A 2YFWA 5CP6C 4J8XB 3UT9B 3C1BC 4KUDA 2AROD 5AVCA 5AV9A 5B33C 5CPKB 4H9RA 3MGPA 5B2JD 3AN2A 4G91C 5GSUC 3AZJC 1P3GC 4UUZA 3VH6A 5AVBA 3KWQC 3AYWA 1P34A 1M18B 4J8VA 5B1LA 5AV8D 5B31G 3WKJA 2CV5C 3MGQD 4NFTA 4J8WC 3VH5T 3X1VA 5B24D 5CPKD 3EPHA 3C1CB 3MNNA 5CPJA 3R45B 3V9RA 3LJAC 1HTAA 2PYOA 2F8NH 5E5AB 3W96B 5B40B 1F66C 1HQ3C 1KX5A 3X1SC 3W97B 5AV5B 3AZLB 3B6GA 3C1BD 3WAAC 4Z5TB 5GT0B 4WU8C 1P3PD 4CAYB 5B33D 1ZLAC 5B0ZB 4JJNA 1TZYB 3EPLA 3AZJD 3REHB 4QLCD 3KWQD 3LZ1A 5BS7C 4Z66C 1S32A 2NZDC 4ZUXD 3RELB 3VH5W 3X1UB 1P3MB 1BH9B 1P3LB 2CV5D 4J8WD 3REKA 3LZ0A 5BT1C 2BYMB 1B6WA 2ZY3A 5B32D 3WTPC 4LD9A 4R8PB 3X1TA 3MGSD 3LJAD 3AZKC 1M19C 3REJC 1ID3A 3LELC 3F6TA 4J8XA 4G92C 1F66D 3B6FA 1HQ3D 5B1MB 5KDMB 1N1JA 5B31A 1U35C 1KX4B 4WU8D 3AZNB 5C3IC 2L5AA 3AV2C 1ZLAD 1M18A 1P3IC 1H3OB 5AY8B 5CHLB 1M1AC 2ZY5A 2NZDD 2XD5A 2XD1A 5GT3B 5F99A 3MGRD 1P3BB 1EQZC 5JA4B 3B0BA 3AZHD 3O62C 3TU4B 3WTPD 4YM6C 1P3OA 3NQUB 2DQNC 3AZKD 5DNMA 3REJD 1M19D 4KUDC 4WU9B 3AZLA 5AVCC 5AV9C 4Z5TA 5GT0A 5FUGA 2NQBA 5JRGB 3MVDB 3MGPC 3AN2C 1U35D 3AZIB 5AVBC 3AYWC 2FFFB 4YS3A 4H9OB 1P34C 5DNNA 2BYKB 4J8UB 4J8VC 5B0YD 3AV2D 1AOIA 1P3KA 5B1LC 3WKJC 3X1VC 2Y2QA 1T3UA 2F2AC 3AZGB 1KX3B 2Y2IA 3MNNC 5CPJC 2Y2MA 1M1AD 4XUJD 5CPIA 1P3FA 2PYOC 1EQZD 1WWSA 4AWLC 1KX5C 4XZQB 5B2IB 3AZMB 3WTPE 3O62D 4KGCB 3UTBD 2JE5A 2F8NG 4WJ3C 3B6GC 4KUDD 5AVCD 5AV9D 3AZNA 4JJNC 4H9PB 3AYWD 3LZ1C 2AROB 2CWEA 4Z2MH 4J8VD 4ZBJB 3UTAD 5B1LD 3WKJD 5B2JB 3EPJA 1PZRA 5GT3A 3LZ0C 3X1VD 1P3BA 3MNND 2FJ7A 1TAFB 4LD9C 3VH6T 3AV1A 3X1TC 1Q9CA 2PYOD 5AV8B 1ID3C 3A6NA 3MGQB 4J8XC 5GXQA 1P3AA 5B24B 2W8SA 3B6FC 1KX5D 2Y2PA 3W99A 3B0DB 5B31C 2UWXA 2YFVA 3B6GD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZE A;  4J8U A;  4JJN D;  1M18 C;  3WA9 A;  4X23 A;  3KUY D;  3C1B B;  3LZ1 D;  1P3P B;  5B33 B;  2F8N A;  4EO5 B;  5BNV B;  5F99 C;  4CSR B;  4G91 B;  3AZJ B;  3AFA D;  3LZ0 D;  1A7W A;  4QLC B;  4H9N B;  3KWQ B;  4LD9 D;  4HGA C;  5BNX B;  5CP6 D;  4ZUX B;  1P3O C;  4KGC A;  2HIO A;  5DNM C;  1ID3 D;  2CV5 B;  3AZL C;  4J8W B;  3B6F D;  2IO5 C;  4Z5T C;  5GT0 C;  3REI A;  5AV6 A;  2NQB C;  5GSU D;  1WWI A;  5B31 D;  5B32 B;  1P3G D;  1BH8 B;  3MGS B;  3LJA B;  2HUE C;  4YS3 C;  5DNN C;  1F66 B;  1AOI C;  1HQ3 B;  1P3K C;  3VH5 A;  3W98 A;  3KXB A;  3AZF A;  5BO0 A;  4WU8 B;  5G49 A;  5CPI C;  1P3F C;  1TAF A;  1ZLA B;  5F99 D;  3UT9 A;  3X1S D;  5B24 A;  5CPK A;  2NZD B;  1P3O D;  4NE6 A;  5DNM D;  3WAA D;  3MGR B;  3AZN C;  2NQB D;  3AZH B;  3WTP B;  3AZK B;  3B0C T;  4Z66 D;  1M19 B;  3REJ B;  4YS3 D;  3C1C A;  2LY8 A;  5DNN D;  4H9Q B;  4G92 B;  3KSY A;  3R45 A;  4KHA B;  1AOI D;  1P3K D;  1P3P A;  5BT1 D;  3W96 A;  5E5A A;  5BNV A;  5GT3 C;  5B40 A;  1U35 B;  1P3B C;  4Z2M G;  2FJ7 C;  4QLC A;  4H9S A;  3AV1 C;  3W97 A;  5AV5 A;  5CPI D;  5B0Y B;  3AV2 B;  1P3F D;  3LEL D;  4ZUX A;  3A6N C;  5GXQ C;  1P3A C;  4CAY A;  1M1A B;  5B0Z A;  3W99 C;  1TZY A;  4XUJ B;  3REH A;  5B32 A;  3MGS A;  1EQZ B;  3AZE C;  3REL A;  1P3I D;  3X1U A;  4J8U C;  3WA9 C;  1P3M A;  1BH9 A;  3O62 B;  1P3L A;  4X23 C;  3UTB B;  2YFW B;  4KUD B;  2BYM A;  5AVC B;  5AV9 B;  4R8P A;  4UUZ B;  3AYW B;  4YM6 D;  2FJ7 D;  5B1M A;  5KDM A;  3AV1 D;  4KGC C;  4J8V B;  2HIO C;  3UTA B;  5B1L B;  3WKJ B;  3A6N D;  1KX4 A;  5GXQ D;  3MGR A;  3X1V B;  1P3A D;  3REI C;  3MGP D;  3AN2 D;  5AV6 C;  3MNN B;  3W99 D;  1H3O A;  3V9R B;  5AY8 A;  5AVB D;  3AZH A;  1P34 D;  1S32 C;  2PYO B;  3AZE D;  4AWL B;  1KX5 B;  3WA9 D;  3REK C;  4X23 D;  1KU5 A;  5CPJ D;  1R4V A;  3KXB C;  3AZF C;  3B6G B;  3W98 C;  5JA4 A;  3TU4 A;  2F8N D;  3NQU A;  4JJN B;  3UT9 C;  5B0Y A;  3KUY B;  4WU9 A;  3LZ1 B;  5CPK C;  5JRG A;  3MVD A;  2HIO D;  3B0D C;  4XUJ A;  3AZI A;  4H9O A;  3AFA B;  3LZ0 B;  2BYK A;  3REI D;  5AV6 D;  1JFI B;  4LD9 B;  5CP6 B;  3UTB A;  1S32 D;  1F1E A;  1ID3 B;  3C1C C;  1BFM A;  1KX3 A;  3AZG A;  3B6F B;  1P3P C;  5GSU B;  3REK D;  1N1J B;  3VH6 W;  5B31 B;  1P3G B;  3W96 C;  5E5A C;  4EO5 C;  5B40 C;  2F8N K;  3W98 D;  3KXB D;  3AZF D;  4XZQ A;  4QLC C;  5B2I A;  4H9S C;  3X1T D;  3AZM A;  3W97 C;  5AV5 C;  2RVQ C;  4ZUX C;  4J8X D;  3UT9 D;  3UTA A;  5B0Z C;  1TZY C;  4H9P A;  3REH C;  5B32 C;  5F99 B;  3MGS C;  2ARO A;  1M18 D;  3REL C;  3X1S B;  3X1U C;  1P3M C;  4E45 A;  1P3L C;  4HGA B;  5B32 G;  1P3O B;  5B2J A;  5DNM B;  3WAA B;  3C1C D;  2IO5 B;  4R8P C;  5FUG B;  2NQB B;  5AV8 A;  4M6B A;  5E5A D;  3MGQ A;  3W96 D;  5B40 D;  2HUE B;  4Z66 B;  3KUY A;  4YS3 B;  5B1M C;  5DNN B;  3W97 D;  5AV5 D;  4WNN B;  1AOI B;  2RVQ D;  3AZL D;  1P3K B;  1B67 A;  1KX4 C;  4Z5T D;  5GT0 D;  3MGR C;  4WV4 B;  3AFA A;  5B0Z D;  1TZY D;  5AY8 C;  1JFI A;  3AZH C;  5CPI B;  1P3F B;  3REH D;  3LEL B;  5CP6 A;  3C1B A;  3NQJ B;  3REL D;  3X1U D;  1P3M D;  5B33 A;  1P3L D;  4CSR A;  5GSU A;  3AZJ A;  1P3G A;  4NE3 A;  5C3I B;  4H9N A;  3KWQ A;  3TU4 C;  5BNX A;  1P3I B;  4R8P D;  5B0Y C;  4WU9 C;  2CV5 A;  4J8W A;  4DRA A;  5B1M D;  5JRG C;  3MVD C;  1BH8 A;  4XUJ C;  3LJA A;  3AZI C;  1KX4 D;  3B0C W;  3AZN D;  1F66 A;  1HQ3 A;  4YM6 B;  2FJ7 B;  3X1S A;  5AY8 D;  3AV1 B;  3UTB C;  1KX3 C;  3AZG C;  3A6N B;  3WAA A;  5GXQ B;  4WU8 A;  1P3A B;  4H9R B;  3MGP B;  3AN2 B;  1ZLA A;  3W99 B;  5GT3 D;  1P3B D;  5AVB B;  2YFV B;  1P34 B;  1ULY A;  4XZQ C;  5B2I C;  3AZM C;  3AZE B;  5BS7 A;  4Z66 A;  3TU4 D;  2NZD A;  3WA9 B;  4X23 B;  4WNN A;  3UTA C;  4WU9 D;  5CPJ B;  5JRG D;  3MVD D;  3WTP A;  2F8N B;  3AZK A;  3AZI D;  1M19 A;  3REJ A;  2ARO C;  3LEL A;  4H9Q A;  4J8U D;  4KHA A;  4ZBJ C;  3NQJ A;  5B2J C;  2JSS A;  2HIO B;  4DRB A;  1U35 A;  1KX3 D;  3AZG D;  4WZS B;  3REI B;  5AV6 B;  3AV2 A;  5AV8 C;  1P3I A;  3MGQ C;  3KUY C;  5B24 C;  1S32 B;  5B2I D;  4XZQ D;  3AZM D;  4NE5 A;  1M1A A;  4E44 A;  4KGC D;  3REK B;  1EQZ A;  3W98 B;  3KXB B;  3AZF B;  3AFA C;  5BO0 B;  3X1T B;  5G49 B;  3O62 A;  4YM6 A;  2YFW A;  5CP6 C;  4J8X B;  3UT9 B;  3C1B C;  4KUD A;  2ARO D;  5AVC A;  5AV9 A;  5B33 C;  5CPK B;  4H9R A;  3MGP A;  5B2J D;  3AN2 A;  4G91 C;  5GSU C;  3AZJ C;  1P3G C;  4UUZ A;  3VH6 A;  5AVB A;  3KWQ C;  3AYW A;  1P34 A;  1M18 B;  4J8V A;  5B1L A;  5AV8 D;  5B31 G;  3WKJ A;  2CV5 C;  3MGQ D;  4NFT A;  4J8W C;  3VH5 T;  3X1V A;  5B24 D;  5CPK D;  3C1C B;  3MNN A;  5CPJ A;  3R45 B;  3V9R A;  3LJA C;  1HTA A;  2PYO A;  2F8N H;  5E5A B;  3W96 B;  5B40 B;  1F66 C;  1HQ3 C;  1KX5 A;  3X1S C;  3W97 B;  5AV5 B;  3AZL B;  3B6G A;  3C1B D;  3WAA C;  4Z5T B;  5GT0 B;  4WU8 C;  1P3P D;  4CAY B;  5B33 D;  1ZLA C;  5B0Z B;  4JJN A;  1TZY B;  3AZJ D;  3REH B;  4QLC D;  3KWQ D;  3LZ1 A;  5BS7 C;  4Z66 C;  1S32 A;  2NZD C;  4ZUX D;  3REL B;  3VH5 W;  3X1U B;  1P3M B;  1BH9 B;  1P3L B;  2CV5 D;  4J8W D;  3REK A;  3LZ0 A;  5BT1 C;  2BYM B;  1B6W A;  3WTP C;  5B32 D;  4LD9 A;  4R8P B;  3X1T A;  3MGS D;  3LJA D;  3AZK C;  1M19 C;  3REJ C;  1ID3 A;  3LEL C;  4J8X A;  4G92 C;  1F66 D;  3B6F A;  1HQ3 D;  5B1M B;  5KDM B;  1N1J A;  5B31 A;  1U35 C;  1KX4 B;  4WU8 D;  3AZN B;  5C3I C;  2L5A A;  3AV2 C;  1ZLA D;  1M18 A;  1P3I C;  1H3O B;  5AY8 B;  5CHL B;  1M1A C;  2NZD D;  5GT3 B;  5F99 A;  3MGR D;  1P3B B;  1EQZ C;  5JA4 B;  3B0B A;  3AZH D;  3O62 C;  3TU4 B;  3WTP D;  4YM6 C;  1P3O A;  3NQU B;  3AZK D;  5DNM A;  3REJ D;  1M19 D;  4KUD C;  4WU9 B;  3AZL A;  5AVC C;  5AV9 C;  4Z5T A;  5GT0 A;  5FUG A;  2NQB A;  5JRG B;  3MVD B;  3MGP C;  3AN2 C;  1U35 D;  3AZI B;  5AVB C;  3AYW C;  4YS3 A;  1P34 C;  4H9O B;  5DNN A;  2BYK B;  4J8U B;  4J8V C;  5B0Y D;  3AV2 D;  1AOI A;  1P3K A;  5B1L C;  3WKJ C;  3X1V C;  1KX3 B;  3AZG B;  3MNN C;  5CPJ C;  1M1A D;  4XUJ D;  5CPI A;  1P3F A;  2PYO C;  1EQZ D;  1WWS A;  4AWL C;  1KX5 C;  4XZQ B;  5B2I B;  3AZM B;  3WTP E;  3O62 D;  4KGC B;  3UTB D;  2F8N G;  3B6G C;  4KUD D;  5AVC D;  5AV9 D;  3AZN A;  4JJN C;  4H9P B;  3AYW D;  3LZ1 C;  2ARO B;  2CWE A;  4Z2M H;  4J8V D;  4ZBJ B;  3UTA D;  5B1L D;  3WKJ D;  5B2J B;  5GT3 A;  3LZ0 C;  3X1V D;  1P3B A;  3MNN D;  2FJ7 A;  1TAF B;  4LD9 C;  3VH6 T;  3AV1 A;  3X1T C;  1Q9C A;  2PYO D;  5AV8 B;  1ID3 C;  3A6N A;  3MGQ B;  4J8X C;  5GXQ A;  1P3A A;  5B24 B;  3B6F C;  1KX5 D;  3W99 A;  3B0D B;  5B31 C;  2YFV A;  3B6G D; 
#chains in the Genus database with same CATH topology
 3AZE A;  4J8U A;  4JJN D;  1M18 C;  3WA9 A;  4X23 A;  3KUY D;  3C1B B;  3LZ1 D;  1P3P B;  5B33 B;  2F8N A;  4EO5 B;  5BNV B;  5F99 C;  2G5I C;  4CSR B;  4G91 B;  3AZJ B;  3AFA D;  3LZ0 D;  1A7W A;  4QLC B;  4H9N B;  3KWQ B;  4LD9 D;  4ZUX B;  4HGA C;  5BNX B;  5CP6 D;  1P3O C;  4KGC A;  2HIO A;  5DNM C;  1ID3 D;  2CV5 B;  3AZL C;  4J8W B;  3B6F D;  2IO5 C;  4Z5T C;  5GT0 C;  3REI A;  5AV6 A;  2NQB C;  5GSU D;  1WWI A;  5B31 D;  2Y2G A;  5B32 B;  1P3G D;  1BH8 B;  3FDD A;  3MGS B;  2Y2N A;  2HUE C;  3LJA B;  4YS3 C;  5DNN C;  1F66 B;  1AOI C;  1HQ3 B;  2Y2K A;  1P3K C;  2VQR A;  3VH5 A;  3W98 A;  3KXB A;  3AZF A;  5BO0 A;  4WU8 B;  5G49 A;  5CPI C;  1P3F C;  1TAF A;  1ZLA B;  5F99 D;  3UT9 A;  3H0M C;  3X1S D;  5B24 A;  5CPK A;  2NZD B;  1P3O D;  4NE6 A;  5DNM D;  3WAA D;  3H0R C;  3MGR B;  3AZN C;  2NQB D;  3KFU G;  3AZH B;  3WTP B;  3AZK B;  3B0C T;  4Z66 D;  1M19 B;  3REJ B;  4YS3 D;  3C1C A;  2LY8 A;  5DNN D;  4H9Q B;  4G92 B;  3KSY A;  3R45 A;  4KHA B;  2ZM5 A;  1AOI D;  1P3K D;  1P3P A;  5BT1 D;  3W96 A;  5E5A A;  5BNV A;  5GT3 C;  5B40 A;  1U35 B;  1P3B C;  4Z2M G;  2FJ7 C;  4QLC A;  4H9S A;  3AV1 C;  3W97 A;  5AV5 A;  5CPI D;  5B0Y B;  3AV2 B;  1P3F D;  3LEL D;  4ZUX A;  3A6N C;  5GXQ C;  1P3A C;  4CAY A;  1M1A B;  5B0Z A;  3W99 C;  1TZY A;  4XUJ B;  3REH A;  5B32 A;  3MGS A;  1EQZ B;  3AZE C;  3REL A;  1P3I D;  3A1K A;  3X1U A;  4J8U C;  3WA9 C;  1P3M A;  1BH9 A;  3O62 B;  1P3L A;  4X23 C;  3UTB B;  2YFW B;  2DF4 C;  4KUD B;  2BYM A;  5AVC B;  5AV9 B;  4R8P A;  4UUZ B;  3AYW B;  4YM6 D;  2FJ7 D;  5B1M A;  5KDM A;  3AV1 D;  4KGC C;  4J8V B;  2HIO C;  3UTA B;  5B1L B;  3WKJ B;  3A6N D;  1KX4 A;  5GXQ D;  3MGR A;  3X1V B;  1P3A D;  3REI C;  3MGP D;  3AN2 D;  5AV6 C;  3MNN B;  3W99 D;  1H3O A;  3V9R B;  5AY8 A;  5AVB D;  3EPK A;  3AZH A;  1W2E A;  1P34 D;  1S32 C;  2PYO B;  3AZE D;  4AWL B;  1KX5 B;  3WA9 D;  3REK C;  4X23 D;  4DQY B;  1KU5 A;  5CPJ D;  1R4V A;  3KXB C;  3AZF C;  3B6G B;  3W98 C;  5JA4 A;  3TU4 A;  2F8N D;  3NQU A;  4JJN B;  3A1I A;  3UT9 C;  2BG1 A;  5B0Y A;  3KUY B;  4WU9 A;  3LZ1 B;  5CPK C;  5JRG A;  3MVD A;  2HIO D;  3B0D C;  4XUJ A;  3AZI A;  3AL0 C;  4H9O A;  3AFA B;  3LZ0 B;  2BYK A;  3REI D;  5AV6 D;  1JFI B;  4LD9 B;  5CP6 B;  3UTB A;  1S32 D;  1F1E A;  1ID3 B;  3C1C C;  1BFM A;  1KX3 A;  3AZG A;  3B6F B;  1P3P C;  5GSU B;  3REK D;  1N1J B;  5B31 B;  3VH6 W;  1P3G B;  3W96 C;  5E5A C;  4EO5 C;  5B40 C;  2F8N K;  3W98 D;  3KXB D;  3AZF D;  4XZQ A;  4QLC C;  5B2I A;  4H9S C;  3X1T D;  3AZM A;  3W97 C;  5AV5 C;  2RVQ C;  4ZUX C;  4J8X D;  3UT9 D;  3UTA A;  5B0Z C;  1TZY C;  4H9P A;  3REH C;  5B32 C;  5F99 B;  3MGS C;  2ARO A;  1Z2C B;  1M18 D;  3REL C;  3X1S B;  3X1U C;  2Y2O A;  1P3M C;  4E45 A;  1P3L C;  4HGA B;  5B32 G;  1P3O B;  5B2J A;  5DNM B;  3WAA B;  3C1C D;  2IO5 B;  3IP4 C;  4R8P C;  5FUG B;  2NQB B;  5AV8 A;  4M6B A;  5E5A D;  3MGQ A;  3W96 D;  5B40 D;  2HUE B;  4Z66 B;  3KUY A;  4YS3 B;  5B1M C;  5DNN B;  3W97 D;  5AV5 D;  4WNN B;  2JCH A;  2RVQ D;  3AZL D;  1P3K B;  1AOI B;  1B67 A;  1KX4 C;  4Z5T D;  2G5H C;  5GT0 D;  3MGR C;  4WV4 B;  3AFA A;  5B0Z D;  1TZY D;  5AY8 C;  1JFI A;  3AZH C;  5CPI B;  1P3F B;  3REH D;  3LEL B;  5CP6 A;  2ZY2 A;  3C1B A;  3NQJ B;  4UPK A;  3REL D;  3X1U D;  1P3M D;  5B33 A;  1P3L D;  4CSR A;  5GSU A;  3AZJ A;  1P3G A;  4NE3 A;  5C3I B;  4H9N A;  3KWQ A;  3TU4 C;  5BNX A;  1P3I B;  4R8P D;  5B0Y C;  4WU9 C;  2CV5 A;  4J8W A;  2RIQ A;  2Y2J A;  4DRA A;  3H0L C;  5B1M D;  5JRG C;  3MVD C;  1BH8 A;  2J8P A;  4XUJ C;  3LJA A;  3AZI C;  1KX4 D;  3B0C W;  3AZN D;  1F66 A;  2Y2H A;  1HQ3 A;  4YM6 B;  2FJ7 B;  3X1S A;  5AY8 D;  3AV1 B;  3P5J B;  3UTB C;  1KX3 C;  3AZG C;  3A6N B;  3WAA A;  5GXQ B;  4WU8 A;  1P3A B;  4H9R B;  3MGP B;  3AN2 B;  1ZLA A;  3W99 B;  5GT3 D;  1P3B D;  5AVB B;  2YFV B;  1P34 B;  1ULY A;  4XZQ C;  5B2I C;  3AZM C;  3AZE B;  5BS7 A;  4Z66 A;  3TU4 D;  2NZD A;  3WA9 B;  4X23 B;  4WNN A;  3UTA C;  4WU9 D;  5CPJ B;  5JRG D;  3MVD D;  3WTP A;  2F8N B;  3AZK A;  3AZI D;  1M19 A;  3REJ A;  2ARO C;  3LEL A;  4H9Q A;  4J8U D;  4KHA A;  4ZBJ C;  3NQJ A;  3EG5 B;  2Y2L A;  5B2J C;  2JSS A;  2HIO B;  4DRB A;  1U35 A;  1KX3 D;  3AZG D;  4WZS B;  3REI B;  5AV6 B;  3AV2 A;  5AV8 C;  1P3I A;  3MGQ C;  3KUY C;  5B24 C;  1S32 B;  5B2I D;  4XZQ D;  3AZM D;  4NE5 A;  1M1A A;  4E44 A;  4KGC D;  3REK B;  1EQZ A;  3W98 B;  3KXB B;  3AZF B;  3AFA C;  5BO0 B;  3X1T B;  2ZY4 A;  5G49 B;  3O62 A;  4YM6 A;  2YFW A;  5CP6 C;  4J8X B;  3UT9 B;  3C1B C;  4KUD A;  2ARO D;  5AVC A;  5AV9 A;  5B33 C;  5CPK B;  4H9R A;  3MGP A;  5B2J D;  3AN2 A;  4G91 C;  5GSU C;  3AZJ C;  1P3G C;  4UUZ A;  3VH6 A;  5AVB A;  3KWQ C;  3AYW A;  1P34 A;  1M18 B;  4J8V A;  5B1L A;  5AV8 D;  5B31 G;  3WKJ A;  2CV5 C;  3MGQ D;  4NFT A;  4J8W C;  3VH5 T;  3X1V A;  5B24 D;  5CPK D;  3EPH A;  3C1C B;  3MNN A;  5CPJ A;  3R45 B;  3V9R A;  3LJA C;  1HTA A;  2PYO A;  2F8N H;  5E5A B;  3W96 B;  5B40 B;  1F66 C;  1HQ3 C;  1KX5 A;  3X1S C;  3W97 B;  5AV5 B;  3AZL B;  3B6G A;  3C1B D;  3WAA C;  4Z5T B;  5GT0 B;  4WU8 C;  1P3P D;  4CAY B;  5B33 D;  1ZLA C;  5B0Z B;  4JJN A;  1TZY B;  3EPL A;  3AZJ D;  3REH B;  4QLC D;  3KWQ D;  3LZ1 A;  5BS7 C;  4Z66 C;  1S32 A;  2NZD C;  4ZUX D;  3REL B;  3VH5 W;  3X1U B;  1P3M B;  1BH9 B;  1P3L B;  2CV5 D;  4J8W D;  3REK A;  3LZ0 A;  5BT1 C;  2BYM B;  1B6W A;  2ZY3 A;  5B32 D;  3WTP C;  4LD9 A;  4R8P B;  3X1T A;  3MGS D;  3LJA D;  3AZK C;  1M19 C;  3REJ C;  1ID3 A;  3LEL C;  3F6T A;  4J8X A;  4G92 C;  1F66 D;  3B6F A;  1HQ3 D;  5B1M B;  5KDM B;  1N1J A;  5B31 A;  1U35 C;  1KX4 B;  4WU8 D;  3AZN B;  5C3I C;  2L5A A;  3AV2 C;  1ZLA D;  1M18 A;  1P3I C;  1H3O B;  5AY8 B;  5CHL B;  1M1A C;  2ZY5 A;  2NZD D;  2XD5 A;  2XD1 A;  5GT3 B;  5F99 A;  3MGR D;  1P3B B;  1EQZ C;  5JA4 B;  3B0B A;  3AZH D;  3O62 C;  3TU4 B;  3WTP D;  4YM6 C;  1P3O A;  3NQU B;  2DQN C;  3AZK D;  5DNM A;  3REJ D;  1M19 D;  4KUD C;  4WU9 B;  3AZL A;  5AVC C;  5AV9 C;  4Z5T A;  5GT0 A;  5FUG A;  2NQB A;  5JRG B;  3MVD B;  3MGP C;  3AN2 C;  1U35 D;  3AZI B;  5AVB C;  3AYW C;  2FFF B;  4YS3 A;  4H9O B;  1P34 C;  5DNN A;  2BYK B;  4J8U B;  4J8V C;  5B0Y D;  3AV2 D;  1AOI A;  1P3K A;  5B1L C;  3WKJ C;  3X1V C;  2Y2Q A;  1T3U A;  2F2A C;  3AZG B;  1KX3 B;  2Y2I A;  3MNN C;  5CPJ C;  2Y2M A;  1M1A D;  4XUJ D;  5CPI A;  1P3F A;  2PYO C;  1EQZ D;  1WWS A;  4AWL C;  1KX5 C;  4XZQ B;  5B2I B;  3AZM B;  3WTP E;  3O62 D;  4KGC B;  3UTB D;  2JE5 A;  2F8N G;  4WJ3 C;  3B6G C;  4KUD D;  5AVC D;  5AV9 D;  3AZN A;  4JJN C;  4H9P B;  3AYW D;  3LZ1 C;  2ARO B;  2CWE A;  4Z2M H;  4J8V D;  4ZBJ B;  3UTA D;  5B1L D;  3WKJ D;  5B2J B;  3EPJ A;  1PZR A;  5GT3 A;  3LZ0 C;  3X1V D;  1P3B A;  3MNN D;  2FJ7 A;  1TAF B;  4LD9 C;  3VH6 T;  3AV1 A;  3X1T C;  1Q9C A;  2PYO D;  5AV8 B;  1ID3 C;  3A6N A;  3MGQ B;  4J8X C;  5GXQ A;  1P3A A;  5B24 B;  2W8S A;  3B6F C;  1KX5 D;  2Y2P A;  3W99 A;  3B0D B;  5B31 C;  2UWX A;  2YFV A;  3B6G D; 
#chains in the Genus database with same CATH homology
 3AZE A;  4J8U A;  4JJN D;  1M18 C;  3WA9 A;  4X23 A;  3KUY D;  3C1B B;  3LZ1 D;  1P3P B;  5B33 B;  2F8N A;  4EO5 B;  5BNV B;  5F99 C;  2G5I C;  4CSR B;  4G91 B;  3AZJ B;  3AFA D;  3LZ0 D;  1A7W A;  4QLC B;  4H9N B;  3KWQ B;  4LD9 D;  4ZUX B;  4HGA C;  5BNX B;  5CP6 D;  1P3O C;  4KGC A;  2HIO A;  5DNM C;  1ID3 D;  2CV5 B;  3AZL C;  4J8W B;  3B6F D;  2IO5 C;  4Z5T C;  5GT0 C;  3REI A;  5AV6 A;  2NQB C;  5GSU D;  1WWI A;  5B31 D;  2Y2G A;  5B32 B;  1P3G D;  1BH8 B;  3FDD A;  3MGS B;  2Y2N A;  2HUE C;  3LJA B;  4YS3 C;  5DNN C;  1F66 B;  1AOI C;  1HQ3 B;  2Y2K A;  1P3K C;  2VQR A;  3VH5 A;  3W98 A;  3KXB A;  3AZF A;  5BO0 A;  4WU8 B;  5G49 A;  5CPI C;  1P3F C;  1TAF A;  1ZLA B;  5F99 D;  3UT9 A;  3H0M C;  3X1S D;  5B24 A;  5CPK A;  2NZD B;  1P3O D;  4NE6 A;  5DNM D;  3WAA D;  3H0R C;  3MGR B;  3AZN C;  2NQB D;  3KFU G;  3AZH B;  3WTP B;  3AZK B;  3B0C T;  4Z66 D;  1M19 B;  3REJ B;  4YS3 D;  3C1C A;  2LY8 A;  5DNN D;  4H9Q B;  4G92 B;  3KSY A;  3R45 A;  4KHA B;  2ZM5 A;  1AOI D;  1P3K D;  1P3P A;  5BT1 D;  3W96 A;  5E5A A;  5BNV A;  5GT3 C;  5B40 A;  1U35 B;  1P3B C;  4Z2M G;  2FJ7 C;  4QLC A;  4H9S A;  3AV1 C;  3W97 A;  5AV5 A;  5CPI D;  5B0Y B;  3AV2 B;  1P3F D;  3LEL D;  4ZUX A;  3A6N C;  5GXQ C;  1P3A C;  4CAY A;  1M1A B;  5B0Z A;  3W99 C;  1TZY A;  4XUJ B;  3REH A;  5B32 A;  3MGS A;  1EQZ B;  3AZE C;  3REL A;  1P3I D;  3A1K A;  3X1U A;  4J8U C;  3WA9 C;  1P3M A;  1BH9 A;  3O62 B;  1P3L A;  4X23 C;  3UTB B;  2YFW B;  2DF4 C;  4KUD B;  2BYM A;  5AVC B;  5AV9 B;  4R8P A;  4UUZ B;  3AYW B;  4YM6 D;  2FJ7 D;  5B1M A;  5KDM A;  3AV1 D;  4KGC C;  4J8V B;  2HIO C;  3UTA B;  5B1L B;  3WKJ B;  3A6N D;  1KX4 A;  5GXQ D;  3MGR A;  3X1V B;  1P3A D;  3REI C;  3MGP D;  3AN2 D;  5AV6 C;  3MNN B;  3W99 D;  1H3O A;  3V9R B;  5AY8 A;  5AVB D;  3EPK A;  3AZH A;  1W2E A;  1P34 D;  1S32 C;  2PYO B;  3AZE D;  4AWL B;  1KX5 B;  3WA9 D;  3REK C;  4X23 D;  4DQY B;  1KU5 A;  5CPJ D;  1R4V A;  3KXB C;  3AZF C;  3B6G B;  3W98 C;  5JA4 A;  3TU4 A;  2F8N D;  3NQU A;  4JJN B;  3A1I A;  3UT9 C;  2BG1 A;  5B0Y A;  3KUY B;  4WU9 A;  3LZ1 B;  5CPK C;  5JRG A;  3MVD A;  2HIO D;  3B0D C;  4XUJ A;  3AZI A;  3AL0 C;  4H9O A;  3AFA B;  3LZ0 B;  2BYK A;  3REI D;  5AV6 D;  1JFI B;  4LD9 B;  5CP6 B;  3UTB A;  1S32 D;  1F1E A;  1ID3 B;  3C1C C;  1BFM A;  1KX3 A;  3AZG A;  3B6F B;  1P3P C;  5GSU B;  3REK D;  1N1J B;  5B31 B;  3VH6 W;  1P3G B;  3W96 C;  5E5A C;  4EO5 C;  5B40 C;  2F8N K;  3W98 D;  3KXB D;  3AZF D;  4XZQ A;  4QLC C;  5B2I A;  4H9S C;  3X1T D;  3AZM A;  3W97 C;  5AV5 C;  2RVQ C;  4ZUX C;  4J8X D;  3UT9 D;  3UTA A;  5B0Z C;  1TZY C;  4H9P A;  3REH C;  5B32 C;  5F99 B;  3MGS C;  2ARO A;  1Z2C B;  1M18 D;  3REL C;  3X1S B;  3X1U C;  2Y2O A;  1P3M C;  4E45 A;  1P3L C;  4HGA B;  5B32 G;  1P3O B;  5B2J A;  5DNM B;  3WAA B;  3C1C D;  2IO5 B;  3IP4 C;  4R8P C;  5FUG B;  2NQB B;  5AV8 A;  4M6B A;  5E5A D;  3MGQ A;  3W96 D;  5B40 D;  2HUE B;  4Z66 B;  3KUY A;  4YS3 B;  5B1M C;  5DNN B;  3W97 D;  5AV5 D;  4WNN B;  2JCH A;  2RVQ D;  3AZL D;  1P3K B;  1AOI B;  1B67 A;  1KX4 C;  4Z5T D;  2G5H C;  5GT0 D;  3MGR C;  4WV4 B;  3AFA A;  5B0Z D;  1TZY D;  5AY8 C;  1JFI A;  3AZH C;  5CPI B;  1P3F B;  3REH D;  3LEL B;  5CP6 A;  2ZY2 A;  3C1B A;  3NQJ B;  4UPK A;  3REL D;  3X1U D;  1P3M D;  5B33 A;  1P3L D;  4CSR A;  5GSU A;  3AZJ A;  1P3G A;  4NE3 A;  5C3I B;  4H9N A;  3KWQ A;  3TU4 C;  5BNX A;  1P3I B;  4R8P D;  5B0Y C;  4WU9 C;  2CV5 A;  4J8W A;  2RIQ A;  2Y2J A;  4DRA A;  3H0L C;  5B1M D;  5JRG C;  3MVD C;  1BH8 A;  2J8P A;  4XUJ C;  3LJA A;  3AZI C;  1KX4 D;  3B0C W;  3AZN D;  1F66 A;  2Y2H A;  1HQ3 A;  4YM6 B;  2FJ7 B;  3X1S A;  5AY8 D;  3AV1 B;  3P5J B;  3UTB C;  1KX3 C;  3AZG C;  3A6N B;  3WAA A;  5GXQ B;  4WU8 A;  1P3A B;  4H9R B;  3MGP B;  3AN2 B;  1ZLA A;  3W99 B;  5GT3 D;  1P3B D;  5AVB B;  2YFV B;  1P34 B;  1ULY A;  4XZQ C;  5B2I C;  3AZM C;  3AZE B;  5BS7 A;  4Z66 A;  3TU4 D;  2NZD A;  3WA9 B;  4X23 B;  4WNN A;  3UTA C;  4WU9 D;  5CPJ B;  5JRG D;  3MVD D;  3WTP A;  2F8N B;  3AZK A;  3AZI D;  1M19 A;  3REJ A;  2ARO C;  3LEL A;  4H9Q A;  4J8U D;  4KHA A;  4ZBJ C;  3NQJ A;  3EG5 B;  2Y2L A;  5B2J C;  2JSS A;  2HIO B;  4DRB A;  1U35 A;  1KX3 D;  3AZG D;  4WZS B;  3REI B;  5AV6 B;  3AV2 A;  5AV8 C;  1P3I A;  3MGQ C;  3KUY C;  5B24 C;  1S32 B;  5B2I D;  4XZQ D;  3AZM D;  4NE5 A;  1M1A A;  4E44 A;  4KGC D;  3REK B;  1EQZ A;  3W98 B;  3KXB B;  3AZF B;  3AFA C;  5BO0 B;  3X1T B;  2ZY4 A;  5G49 B;  3O62 A;  4YM6 A;  2YFW A;  5CP6 C;  4J8X B;  3UT9 B;  3C1B C;  4KUD A;  2ARO D;  5AVC A;  5AV9 A;  5B33 C;  5CPK B;  4H9R A;  3MGP A;  5B2J D;  3AN2 A;  4G91 C;  5GSU C;  3AZJ C;  1P3G C;  4UUZ A;  3VH6 A;  5AVB A;  3KWQ C;  3AYW A;  1P34 A;  1M18 B;  4J8V A;  5B1L A;  5AV8 D;  5B31 G;  3WKJ A;  2CV5 C;  3MGQ D;  4NFT A;  4J8W C;  3VH5 T;  3X1V A;  5B24 D;  5CPK D;  3EPH A;  3C1C B;  3MNN A;  5CPJ A;  3R45 B;  3V9R A;  3LJA C;  1HTA A;  2PYO A;  2F8N H;  5E5A B;  3W96 B;  5B40 B;  1F66 C;  1HQ3 C;  1KX5 A;  3X1S C;  3W97 B;  5AV5 B;  3AZL B;  3B6G A;  3C1B D;  3WAA C;  4Z5T B;  5GT0 B;  4WU8 C;  1P3P D;  4CAY B;  5B33 D;  1ZLA C;  5B0Z B;  4JJN A;  1TZY B;  3EPL A;  3AZJ D;  3REH B;  4QLC D;  3KWQ D;  3LZ1 A;  5BS7 C;  4Z66 C;  1S32 A;  2NZD C;  4ZUX D;  3REL B;  3VH5 W;  3X1U B;  1P3M B;  1BH9 B;  1P3L B;  2CV5 D;  4J8W D;  3REK A;  3LZ0 A;  5BT1 C;  2BYM B;  1B6W A;  2ZY3 A;  5B32 D;  3WTP C;  4LD9 A;  4R8P B;  3X1T A;  3MGS D;  3LJA D;  3AZK C;  1M19 C;  3REJ C;  1ID3 A;  3LEL C;  3F6T A;  4J8X A;  4G92 C;  1F66 D;  3B6F A;  1HQ3 D;  5B1M B;  5KDM B;  1N1J A;  5B31 A;  1U35 C;  1KX4 B;  4WU8 D;  3AZN B;  5C3I C;  2L5A A;  3AV2 C;  1ZLA D;  1M18 A;  1P3I C;  1H3O B;  5AY8 B;  5CHL B;  1M1A C;  2ZY5 A;  2NZD D;  2XD5 A;  2XD1 A;  5GT3 B;  5F99 A;  3MGR D;  1P3B B;  1EQZ C;  5JA4 B;  3B0B A;  3AZH D;  3O62 C;  3TU4 B;  3WTP D;  4YM6 C;  1P3O A;  3NQU B;  2DQN C;  3AZK D;  5DNM A;  3REJ D;  1M19 D;  4KUD C;  4WU9 B;  3AZL A;  5AVC C;  5AV9 C;  4Z5T A;  5GT0 A;  5FUG A;  2NQB A;  5JRG B;  3MVD B;  3MGP C;  3AN2 C;  1U35 D;  3AZI B;  5AVB C;  3AYW C;  2FFF B;  4YS3 A;  4H9O B;  1P34 C;  5DNN A;  2BYK B;  4J8U B;  4J8V C;  5B0Y D;  3AV2 D;  1AOI A;  1P3K A;  5B1L C;  3WKJ C;  3X1V C;  2Y2Q A;  1T3U A;  2F2A C;  3AZG B;  1KX3 B;  2Y2I A;  3MNN C;  5CPJ C;  2Y2M A;  1M1A D;  4XUJ D;  5CPI A;  1P3F A;  2PYO C;  1EQZ D;  1WWS A;  4AWL C;  1KX5 C;  4XZQ B;  5B2I B;  3AZM B;  3WTP E;  3O62 D;  4KGC B;  3UTB D;  2JE5 A;  2F8N G;  4WJ3 C;  3B6G C;  4KUD D;  5AVC D;  5AV9 D;  3AZN A;  4JJN C;  4H9P B;  3AYW D;  3LZ1 C;  2ARO B;  2CWE A;  4Z2M H;  4J8V D;  4ZBJ B;  3UTA D;  5B1L D;  3WKJ D;  5B2J B;  3EPJ A;  1PZR A;  5GT3 A;  3LZ0 C;  3X1V D;  1P3B A;  3MNN D;  2FJ7 A;  1TAF B;  4LD9 C;  3VH6 T;  3AV1 A;  3X1T C;  1Q9C A;  2PYO D;  5AV8 B;  1ID3 C;  3A6N A;  3MGQ B;  4J8X C;  5GXQ A;  1P3A A;  5B24 B;  2W8S A;  3B6F C;  1KX5 D;  2Y2P A;  3W99 A;  3B0D B;  5B31 C;  2UWX A;  2YFV A;  3B6G D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...