5CPJA

Nucleosome containing methylated sat2r dna
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
94
structure length
94
Chain Sequence
YRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Influence of DNA methylation on positioning and DNA flexibility of nucleosomes with pericentric satellite DNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags "structural protein/dna
total genus 30
structure length 94
sequence length 94
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5cpjA00
5B1MA 3AZJC 3WA9B 5DNNA 3C1BA 4H9OB 4DRBA 3REIA 5AVCC 4WZSB 2CV5D 3B6FB 4J8UC 3W98D 1P3GC 2FJ7B 3AZJD 2F8NA 5AV9B 1EQZB 2BYKB 3AV2A 3W96B 5AVBA 5AVCD 3AZMA 3B6GB 4J8UD 4X23D 5CPIA 3B6FC 3W98C 1BH8A 3WA9D 3AZGA 5AV9C 1EQZC 2CWEA 3W96C 3WAAB 5B31B 3B6FD 3NQJB 4XUJA 3B6GC 2FJ7D 2NZDC 1P3KC 5BO0B 5AV9D 1EQZD 3UTBB 5CPJA 3LELA 3W96D 5DNMA 5B40A 1BH9A 3B6GD 1JFIA 5KDMA 5GT0A 5F99C 3MGSC 3KUYC 1TAFB 5GXQA 3UT9A 3X1SB 3TU4A 1P3PB 4G91C 4CSRA 4XZQA 3UTBC 3WAAD 5B31D 5F99D 3B0DB 4Z2MG 3MNNB 3MVDB 3UTAA 3REKA 4H9PA 5C3IC 5B2JA 3UTBD 1F66C 3MGPB 4QLCC 4H9RA 3MGRC 5B1MB 3AV1A 5B0ZC 3C1BB 3B0DC 3MNNC 3KSYA 4Z5TC 3REIB 3X1SD 1P3AA 1P3PD 1KX5A 3MGRD 2F8NB 5E5AA 4Z66A 3MGPC 5GSUC 3AV2B 3MNND 3X1TA 4Z5TD 5AVBB 3MGQA 3C1BC 3AZMB 3REIC 1F1EA 5B31G 3MGPD 5CPIB 4WNNB 1P3BA 1BH8B 2PYOB 5B1MD 4CAYB 3AZGB 3C1BD 1WWSA 4J8VC 3AV2C 3REID 1WWIA 4XUJB 5JA4A 2F8ND 5B1LA 5CPIC 2RVQC 3AV2D 3WTPC 5CPJB 3LELB 2PYOC 4M6BA 2BYMA 5DNMB 5B40B 5AVBD 1BH9B 1JFIB 1HTAA 5KDMB 3AN2A 5GT0B 5B0YC 5B32C 4WU9A 5CPID 2RVQD 4WU8A 1KX4A 5GXQB 3O62A 3UT9B 3WTPD 2PYOD 5CP6C 4J8WC 3TU4B 4LD9A 3NQUA 3AZGD 4XZQB 4H9QA 5CPJC 3LELC 3AZFC 5AV5B 1TZYC 5B40C 4XUJD 3UTAB 4E44A 1U35A 4ZUXB 5G49A 5GT0C 3REKB 5BS7A 5B2IA 5GXQC 5GT3A 5B2JB 3UT9C 5CPJD 3LELD 3TU4C 1BFMA 3B0BA 4H9RB 5B40D 5DNMD 3VH6T 4XZQC 1AOIA 3AV1B 5GT0D 5AV5C 3AYWB 2F8NG 4YM6A 5GXQD 3UT9D 4ZUXC 3TU4D 3REKC 1P3OA 3X1UA 1ULYA 5BNVA 1P3AB 1KX5B 4XZQD 1P3IC 1P3FA 4Z66B 4DRAA 5AV5D 3AZHA 3X1TB 3UTAD 3AV1C 4ZUXD 4NE5A 3MGQB 3REKD 3AYWC 1M18A 5B2JD 1P3AC 1P3BB 3AZEA 4YS3B 3AV1D 3AYWD 3LZ1A 4Z2MH 1P3AD 4HGAB 3AZIA 1KX5D 4X23C 5B1LB 4Z66D 5AV8A 4YS3C 4EO5B 3X1TD 2BYMB 3MGQD 3WA9C 4JJNA 3AN2B 2NQBA 5AY8A 1ID3B 4WU9B 1KX4B 4WU8B 4HGAC 1P3BD 3O62B 4YS3D 1ZLAB 4LD9B 3VH5T 2FJ7C 5B1LC 3NQUB 4H9QB 1A7WA 3RELB 4EO5C 2HIOA 3KXBA 1U35B 5G49B 3AN2C 1ID3C 5B1LD 1KX4C 5B2IB 4WU8C 3O62C 1ZLAC 4LD9C 4J8XA 1AOIB 3RELC 3AN2D 1M19A 1ID3D 3WAAC 4WU9D 5B31C 1KX4D 4WU8D 4YM6B 3O62D 4KUDA 1B67A 1ZLAD 1P3OB 3X1UB 4LD9D 5BNVB 5BS7C 5B33A 3AZNA 3RELD 1P3FB 3AZHB 1AOIC 1U35D 1M18B 5B2ID 1P3OC 3X1UC 3X1SC 1Q9CA 1P3PC 4H9SA 1AOID 1P3FC 4KGCA 3LZ1B 5CPKA 5DNNB 4YM6D 3MVDC 1P3OD 3X1UD 3W97A 3AZIB 1P3FD 3AZHD 4R8PA 3MVDD 4H9NA 5B1MC 5JRGA 5BT1D 1M18D 5DNNC 2F8NH 2NQBB 5AY8B 3AZIC 4NFTA 3B0CW 1P3MA 3LZ1D 5DNND 4E45A 2HIOB 3WKJA 3AZID 5AVBC 3AZMC 4ZBJB 3AZJA 2YFWA 3AZGC 3AZMD 2HIOC 1M19B 5AY8D 2NQBD 5CHLB 1P3GA 4XUJC 4KUDB 4ZBJC 5B33B 3AZNB 4CSRB 2HIOD 5DNMC 3VH6A 4H9PB 4KUDC 3A6NA 2BYKA 4KHAA 3W99A 4KGCB 5CPKB 3B6GA 4KUDD 3UTAC 2NZDA 3LJAA 3W97B 1P3KA 5B33D 3AZND 5AV6A 5B2JC 5E5AB 2IO5B 4R8PB 4H9NB 3REJA 1S32A 5F99A 5CPKC 3MGSA 3KUYA 3W97C 1KX5C 4KGCD 5E5AC 4Z66C 5CPKD 4NE6A 1KX3A 3KWQA 3X1TC 3WKJB 3LZ0A 1B6WA 3W97D 3MGQC 1F66A 3AZKA 4QLCA 5JA4B 2AROA 5E5AD 5B24A 2JSSA 4R8PD 3MGRA 1P3BC 3VH5A 5B0ZA 2YFWB 4Z5TA 3WKJC 1P3GB 2HUEB 5GSUA 3WKJD 3REHA 4WU9C 5GT3B 3C1CA 2HUEC 3A6NB 4J8VA 4KHAB 3W99B 5FUGA 3R45A 1P34A 5BNXA 1P3GD 1U35C 2NZDB 3LJAB 1P3KB 4WNNA 5AV6B 5B2IC 3WTPA 2PYOA 5GT3C 2L5AA 4CAYA 3A6NC 3W99C 3REJB 1HQ3A 1S32B 5F99B 5B0YA 5B32A 3MGSB 3KUYB 4YM6C 5GT3D 5CP6A 4J8WA 3V9RA 3LJAC 4G91B 3A6ND 3X1VA 5AV6C 3W99D 3AZEB 3AZFA 1TZYA 3AZHC 1KX3B 4UUZA 3KWQB 3REJC 2NZDD 1S32C 3LZ0B 3LJAD 1P3KD 1M18C 5BT1C 5AV6D 5C3IB 1F66B 3AZKB 3AZLA 4QLCB 2AROB 1P3LA 3AFAA 5B24B 3MGRB 5AV8B 3AZEC 3REJD 5B0ZB 5AV5A 1S32D 3MGSD 3KUYD 3LZ1C 4JJNB 1KX3C 4Z5TB 2YFVA 4ZUXA 3KWQC 4NE3A 3LZ0C 4G92B 1P3IA 3AZED 3AZKC 2AROC 4AWLB 5GSUB 5B24C 1KX3D 1M1AA 5AV8C 3KWQD 3AYWA 3LZ0D 1KU5A 3KXBB 1R4VA 3REHB 4JJNC 1F66D 3AZKD 4QLCD 5AY8C 2NQBC 2AROD 4G92C 5B24D 2CV5A 3W98A 1H3OA 4WV4B 5AV8D 3C1CB 5B0ZD 3VH6W 4J8XB 4J8VB 4AWLC 5FUGB 4JJND 2F8NK 3R45B 1P34B 3KXBC 5BNXB 5AVCA 3REHC 4J8UA 4X23A 5GSUD 3WTPB 4YS3A 1N1JA 3C1CC 3WA9A 4J8XC 3KXBD 3REHD 4H9OA 1HQ3B 5B0YB 5B32B 1M19C 1P34C 3B6FA 5CP6B 4J8WB 3V9RB 3C1CD 2FJ7A 3X1VB 4J8VD 4J8XD 5B33C 3AZNC 5AV9A 1EQZA 3AZFB 1TZYB 3W96A 1M19D 1P34D 4UUZB 1HQ3C 1ID3A 3AZLB 1ZLAA 1P3LB 3AFAB 3X1VC 3B0CT 4H9SC 3RELA 1HQ3D 4KGCC 3WAAA 5B0YD 5JRGB 5B31A 5B32D 2YFVB 3NQJA 5CP6D 4J8WD 3X1VD 1P3IB 5BO0A 3VH5W 3AZLC 3AZFD 3UTBA 1TZYD 1P3LC 3WTPE 3AFAC 1P3MB 2IO5C 4R8PC 1M1AB 5JRGC 1TAFA 3AZLD 3X1SA 1P3LD 3AFAD 1P3PA 2CV5B 3W98B 1H3OB 3AZJB 5JRGD 1P3MC 2LY8A 1M1AC 3MNNA 3MVDA 5AVCB 1P3ID 4J8UB 4X23B 5B32G 3MGPA 1P3MD 2CV5C 1M1AD 1N1JB
chains in the Genus database with same CATH superfamily
3A1KA 5B1MA 3AZJC 3WA9B 5DNNA 3C1BA 4H9OB 4DRBA 3REIA 5AVCC 4WZSB 2CV5D 3B6FB 4J8UC 3W98D 1P3GC 2FJ7B 3AZJD 2F8NA 5AV9B 1EQZB 2BYKB 3AV2A 3W96B 5AVBA 5AVCD 3AZMA 3B6GB 4J8UD 4X23D 2Y2HA 5CPIA 3B6FC 3W98C 1BH8A 2W8SA 3WA9D 3AZGA 3EG5B 5AV9C 1EQZC 2CWEA 3W96C 3WAAB 5B31B 3B6FD 3NQJB 4XUJA 3B6GC 2FJ7D 2NZDC 1P3KC 5BO0B 5AV9D 1EQZD 3UTBB 5CPJA 3LELA 3W96D 5DNMA 5B40A 1BH9A 3B6GD 1JFIA 5KDMA 5GT0A 5F99C 3MGSC 3KUYC 1TAFB 5GXQA 3UT9A 3X1SB 3TU4A 1P3PB 4G91C 4CSRA 4XZQA 3UTBC 3WAAD 5B31D 5F99D 3B0DB 4Z2MG 3MNNB 3MVDB 2ZY3A 3UTAA 3REKA 4H9PA 1T3UA 5C3IC 5B2JA 3UTBD 1F66C 3MGPB 4QLCC 4H9RA 3MGRC 5B1MB 3AV1A 5B0ZC 3C1BB 3B0DC 3MNNC 3KSYA 4Z5TC 3REIB 3X1SD 1P3AA 1P3PD 1KX5A 3MGRD 2F8NB 5E5AA 4Z66A 3MGPC 3EPKA 5GSUC 3AV2B 3MNND 3X1TA 4Z5TD 5AVBB 3MGQA 3C1BC 3AZMB 2ZY5A 3REIC 1F1EA 5B31G 3MGPD 5CPIB 4WNNB 1P3BA 1BH8B 2PYOB 5B1MD 4CAYB 3AZGB 3C1BD 1WWSA 4J8VC 3AV2C 3REID 1WWIA 4XUJB 5JA4A 2F8ND 5B1LA 5CPIC 2RVQC 3AV2D 3WTPC 5CPJB 3LELB 2PYOC 4M6BA 2BYMA 5DNMB 5B40B 5AVBD 1BH9B 1JFIB 1HTAA 5KDMB 3AN2A 5GT0B 5B0YC 5B32C 4WU9A 5CPID 2RVQD 4WU8A 1KX4A 5GXQB 3O62A 3UT9B 3WTPD 2PYOD 5CP6C 4J8WC 3TU4B 4LD9A 3NQUA 3AZGD 4XZQB 4H9QA 5CPJC 3LELC 3AZFC 5AV5B 1TZYC 5B40C 2Y2NA 4XUJD 3UTAB 4E44A 1U35A 4ZUXB 5G49A 5GT0C 3REKB 1Z2CB 5BS7A 5B2IA 5GXQC 5GT3A 5B2JB 3UT9C 5CPJD 3LELD 3TU4C 1BFMA 3B0BA 4H9RB 5B40D 5DNMD 3VH6T 4XZQC 1AOIA 3AV1B 5GT0D 5AV5C 3AYWB 2F8NG 4YM6A 5GXQD 3UT9D 4ZUXC 3TU4D 3REKC 1P3OA 3X1UA 1ULYA 5BNVA 1P3AB 1KX5B 4XZQD 1P3IC 1P3FA 4Z66B 4DRAA 5AV5D 3AZHA 3X1TB 3UTAD 3AV1C 4ZUXD 4NE5A 3MGQB 3REKD 3AYWC 1M18A 5B2JD 1P3AC 1P3BB 3AZEA 4YS3B 3AV1D 3AYWD 3LZ1A 2G5IC 4Z2MH 2FFFB 1P3AD 4HGAB 3AZIA 1KX5D 4X23C 5B1LB 4Z66D 5AV8A 4YS3C 4EO5B 3X1TD 2BYMB 3MGQD 3WA9C 4JJNA 2Y2MA 3AN2B 2NQBA 5AY8A 1ID3B 3H0MC 4WU9B 1KX4B 4WU8B 4HGAC 1P3BD 3O62B 4YS3D 1ZLAB 3F6TA 4LD9B 3VH5T 2FJ7C 5B1LC 3NQUB 4H9QB 1A7WA 3RELB 4EO5C 2HIOA 3KXBA 1U35B 5G49B 3AN2C 1ID3C 5B1LD 1KX4C 5B2IB 4WU8C 3O62C 1ZLAC 4LD9C 4J8XA 1AOIB 3RELC 3AN2D 1M19A 1ID3D 3WAAC 4WU9D 5B31C 1KX4D 4WU8D 4YM6B 3O62D 4KUDA 1B67A 1ZLAD 1P3OB 3X1UB 4LD9D 5BNVB 5BS7C 5B33A 3AZNA 3RELD 1P3FB 3AZHB 1AOIC 1U35D 1M18B 5B2ID 1P3OC 3X1UC 3X1SC 1Q9CA 1P3PC 4H9SA 1AOID 1P3FC 4KGCA 3H0LC 3LZ1B 5CPKA 5DNNB 2Y2KA 4YM6D 3MVDC 1P3OD 3X1UD 3W97A 3AZIB 1P3FD 3AZHD 4R8PA 3MVDD 4H9NA 5B1MC 5JRGA 5BT1D 1M18D 5DNNC 2F8NH 2NQBB 5AY8B 1PZRA 3AZIC 4NFTA 3B0CW 1P3MA 3LZ1D 5DNND 4E45A 2HIOB 3WKJA 3AZID 5AVBC 3AZMC 4ZBJB 3AZJA 2YFWA 3AZGC 3AZMD 2HIOC 1M19B 5AY8D 2NQBD 5CHLB 1P3GA 4XUJC 4KUDB 4ZBJC 5B33B 3AZNB 4CSRB 2HIOD 3FDDA 5DNMC 3VH6A 4H9PB 4KUDC 3EPHA 2DF4C 3A6NA 2BYKA 4KHAA 3W99A 4KGCB 5CPKB 3B6GA 4KUDD 3UTAC 2ZM5A 2NZDA 3LJAA 3W97B 1P3KA 5B33D 3AZND 5AV6A 5B2JC 5E5AB 3P5JB 2IO5B 4R8PB 4H9NB 3REJA 4UPKA 1S32A 5F99A 5CPKC 3MGSA 3KUYA 3W97C 1W2EA 1KX5C 4KGCD 5E5AC 4Z66C 5CPKD 2ZY4A 4NE6A 1KX3A 3KWQA 3X1TC 3WKJB 3LZ0A 1B6WA 3W97D 3MGQC 1F66A 3AZKA 4QLCA 5JA4B 2AROA 5E5AD 5B24A 2JSSA 4R8PD 3MGRA 1P3BC 3VH5A 5B0ZA 2YFWB 4Z5TA 3WKJC 1P3GB 2HUEB 5GSUA 3WKJD 3REHA 2RIQA 4WU9C 3EPLA 5GT3B 3C1CA 2HUEC 3A6NB 2Y2JA 4KHAB 4J8VA 2J8PA 4DQYB 3W99B 5FUGA 3R45A 1P34A 5BNXA 1P3GD 3AL0C 1U35C 2NZDB 3LJAB 1P3KB 4WNNA 5AV6B 5B2IC 3WTPA 2PYOA 5GT3C 2L5AA 4CAYA 3A6NC 3W99C 3REJB 1HQ3A 1S32B 5B0YA 5B32A 5F99B 3MGSB 3KUYB 4YM6C 5GT3D 5CP6A 4J8WA 3V9RA 3LJAC 4G91B 3A6ND 3X1VA 5AV6C 3W99D 3AZEB 3AZFA 1TZYA 2BG1A 3AZHC 1KX3B 4UUZA 3KWQB 3REJC 2Y2OA 2NZDD 1S32C 3LZ0B 3LJAD 1P3KD 1M18C 5BT1C 5AV6D 5C3IB 1F66B 3AZKB 3AZLA 4QLCB 2AROB 1P3LA 3AFAA 5B24B 3MGRB 3KFUG 2DQNC 5AV8B 3AZEC 3REJD 5B0ZB 5AV5A 1S32D 3MGSD 2Y2IA 3LZ1C 3KUYD 4JJNB 4Z5TB 2YFVA 1KX3C 2ZY2A 4ZUXA 3KWQC 4NE3A 3LZ0C 4G92B 1P3IA 2JE5A 3AZED 3AZKC 2XD5A 2AROC 4AWLB 5GSUB 5B24C 1KX3D 4WJ3C 1M1AA 5AV8C 3KWQD 3AYWA 3LZ0D 1KU5A 3KXBB 1R4VA 3REHB 4JJNC 1F66D 3AZKD 4QLCD 5AY8C 2NQBC 2AROD 2F2AC 4G92C 2JCHA 5B24D 2CV5A 3W98A 1H3OA 4WV4B 5AV8D 3C1CB 5B0ZD 3VH6W 4J8XB 4J8VB 4AWLC 5FUGB 4JJND 2F8NK 3R45B 1P34B 3KXBC 5BNXB 5AVCA 3REHC 4J8UA 4X23A 3A1IA 2Y2LA 5GSUD 3WTPB 4YS3A 1N1JA 3C1CC 3WA9A 4J8XC 3KXBD 3REHD 4H9OA 1HQ3B 5B0YB 5B32B 1M19C 1P34C 3B6FA 2Y2QA 5CP6B 4J8WB 3V9RB 3C1CD 2FJ7A 2VQRA 3X1VB 4J8VD 4J8XD 5B33C 3AZNC 5AV9A 1EQZA 3AZFB 1TZYB 3W96A 1M19D 1P34D 4UUZB 1HQ3C 2UWXA 1ID3A 2XD1A 3AZLB 1ZLAA 1P3LB 3AFAB 3X1VC 3B0CT 3H0RC 4H9SC 3RELA 1HQ3D 4KGCC 3WAAA 5B0YD 5JRGB 5B31A 5B32D 3EPJA 2YFVB 3NQJA 2Y2GA 5CP6D 4J8WD 3X1VD 1P3IB 5BO0A 3VH5W 3AZLC 3AZFD 3UTBA 1TZYD 1P3LC 3WTPE 3AFAC 1P3MB 2IO5C 4R8PC 1M1AB 5JRGC 1TAFA 3IP4C 3AZLD 3X1SA 2G5HC 1P3LD 3AFAD 1P3PA 2CV5B 3W98B 1H3OB 2Y2PA 3AZJB 5JRGD 1P3MC 2LY8A 1M1AC 3MNNA 3MVDA 5AVCB 1P3ID 4J8UB 4X23B 5B32G 3MGPA 1P3MD 2CV5C 1M1AD 1N1JB
chains in the Genus database with same CATH topology
3A1KA 5B1MA 3AZJC 3WA9B 5DNNA 3C1BA 4H9OB 4DRBA 3REIA 5AVCC 4WZSB 2CV5D 3B6FB 4J8UC 3W98D 1P3GC 2FJ7B 3AZJD 2F8NA 5AV9B 1EQZB 2BYKB 3AV2A 3W96B 5AVBA 5AVCD 3AZMA 3B6GB 4J8UD 4X23D 2Y2HA 5CPIA 3B6FC 3W98C 1BH8A 2W8SA 3WA9D 3AZGA 3EG5B 5AV9C 1EQZC 2CWEA 3W96C 3WAAB 5B31B 3B6FD 3NQJB 4XUJA 3B6GC 2FJ7D 2NZDC 1P3KC 5BO0B 5AV9D 1EQZD 3UTBB 5CPJA 3LELA 3W96D 5DNMA 5B40A 1BH9A 3B6GD 1JFIA 5KDMA 5GT0A 5F99C 3MGSC 3KUYC 1TAFB 5GXQA 3UT9A 3X1SB 3TU4A 1P3PB 4G91C 4CSRA 4XZQA 3UTBC 3WAAD 5B31D 5F99D 3B0DB 4Z2MG 3MNNB 3MVDB 2ZY3A 3UTAA 3REKA 4H9PA 1T3UA 5C3IC 5B2JA 3UTBD 1F66C 3MGPB 4QLCC 4H9RA 3MGRC 5B1MB 3AV1A 5B0ZC 3C1BB 3B0DC 3MNNC 3KSYA 4Z5TC 3REIB 3X1SD 1P3AA 1P3PD 1KX5A 3MGRD 2F8NB 5E5AA 4Z66A 3MGPC 3EPKA 5GSUC 3AV2B 3MNND 3X1TA 4Z5TD 5AVBB 3MGQA 3C1BC 3AZMB 2ZY5A 3REIC 1F1EA 5B31G 3MGPD 5CPIB 4WNNB 1P3BA 1BH8B 2PYOB 5B1MD 4CAYB 3AZGB 3C1BD 1WWSA 4J8VC 3AV2C 3REID 1WWIA 4XUJB 5JA4A 2F8ND 5B1LA 5CPIC 2RVQC 3AV2D 3WTPC 5CPJB 3LELB 2PYOC 4M6BA 2BYMA 5DNMB 5B40B 5AVBD 1BH9B 1JFIB 1HTAA 5KDMB 3AN2A 5GT0B 5B0YC 5B32C 4WU9A 5CPID 2RVQD 4WU8A 1KX4A 5GXQB 3O62A 3UT9B 3WTPD 2PYOD 5CP6C 4J8WC 3TU4B 4LD9A 3NQUA 3AZGD 4XZQB 4H9QA 5CPJC 3LELC 3AZFC 5AV5B 1TZYC 5B40C 2Y2NA 4XUJD 3UTAB 4E44A 1U35A 4ZUXB 5G49A 5GT0C 3REKB 1Z2CB 5BS7A 5B2IA 5GXQC 5GT3A 5B2JB 3UT9C 5CPJD 3LELD 3TU4C 1BFMA 3B0BA 4H9RB 5B40D 5DNMD 3VH6T 4XZQC 1AOIA 3AV1B 5GT0D 5AV5C 3AYWB 2F8NG 4YM6A 5GXQD 3UT9D 4ZUXC 3TU4D 3REKC 1P3OA 3X1UA 1ULYA 5BNVA 1P3AB 1KX5B 4XZQD 1P3IC 1P3FA 4Z66B 4DRAA 5AV5D 3AZHA 3X1TB 3UTAD 3AV1C 4ZUXD 4NE5A 3MGQB 3REKD 3AYWC 1M18A 5B2JD 1P3AC 1P3BB 3AZEA 4YS3B 3AV1D 3AYWD 3LZ1A 2G5IC 4Z2MH 2FFFB 1P3AD 4HGAB 3AZIA 1KX5D 4X23C 5B1LB 4Z66D 5AV8A 4YS3C 4EO5B 3X1TD 2BYMB 3MGQD 3WA9C 4JJNA 2Y2MA 3AN2B 2NQBA 5AY8A 1ID3B 3H0MC 4WU9B 1KX4B 4WU8B 4HGAC 1P3BD 3O62B 4YS3D 1ZLAB 3F6TA 4LD9B 3VH5T 2FJ7C 5B1LC 3NQUB 4H9QB 1A7WA 3RELB 4EO5C 2HIOA 3KXBA 1U35B 5G49B 3AN2C 1ID3C 5B1LD 1KX4C 5B2IB 4WU8C 3O62C 1ZLAC 4LD9C 4J8XA 1AOIB 3RELC 3AN2D 1M19A 1ID3D 3WAAC 4WU9D 5B31C 1KX4D 4WU8D 4YM6B 3O62D 4KUDA 1B67A 1ZLAD 1P3OB 3X1UB 4LD9D 5BNVB 5BS7C 5B33A 3AZNA 3RELD 1P3FB 3AZHB 1AOIC 1U35D 1M18B 5B2ID 1P3OC 3X1UC 3X1SC 1Q9CA 1P3PC 4H9SA 1AOID 1P3FC 4KGCA 3H0LC 3LZ1B 5CPKA 5DNNB 2Y2KA 4YM6D 3MVDC 1P3OD 3X1UD 3W97A 3AZIB 1P3FD 3AZHD 4R8PA 3MVDD 4H9NA 5B1MC 5JRGA 5BT1D 1M18D 5DNNC 2F8NH 2NQBB 5AY8B 1PZRA 3AZIC 4NFTA 3B0CW 1P3MA 3LZ1D 5DNND 4E45A 2HIOB 3WKJA 3AZID 5AVBC 3AZMC 4ZBJB 3AZJA 2YFWA 3AZGC 3AZMD 2HIOC 1M19B 5AY8D 2NQBD 5CHLB 1P3GA 4XUJC 4KUDB 4ZBJC 5B33B 3AZNB 4CSRB 2HIOD 3FDDA 5DNMC 3VH6A 4H9PB 4KUDC 3EPHA 2DF4C 3A6NA 2BYKA 4KHAA 3W99A 4KGCB 5CPKB 3B6GA 4KUDD 3UTAC 2ZM5A 2NZDA 3LJAA 3W97B 1P3KA 5B33D 3AZND 5AV6A 5B2JC 5E5AB 3P5JB 2IO5B 4R8PB 4H9NB 3REJA 4UPKA 1S32A 5F99A 5CPKC 3MGSA 3KUYA 3W97C 1W2EA 1KX5C 4KGCD 5E5AC 4Z66C 5CPKD 2ZY4A 4NE6A 1KX3A 3KWQA 3X1TC 3WKJB 3LZ0A 1B6WA 3W97D 3MGQC 1F66A 3AZKA 4QLCA 5JA4B 2AROA 5E5AD 5B24A 2JSSA 4R8PD 3MGRA 1P3BC 3VH5A 5B0ZA 2YFWB 4Z5TA 3WKJC 1P3GB 2HUEB 5GSUA 3WKJD 3REHA 2RIQA 4WU9C 3EPLA 5GT3B 3C1CA 2HUEC 3A6NB 2Y2JA 4KHAB 4J8VA 2J8PA 4DQYB 3W99B 5FUGA 3R45A 1P34A 5BNXA 1P3GD 3AL0C 1U35C 2NZDB 3LJAB 1P3KB 4WNNA 5AV6B 5B2IC 3WTPA 2PYOA 5GT3C 2L5AA 4CAYA 3A6NC 3W99C 3REJB 1HQ3A 1S32B 5B0YA 5B32A 5F99B 3MGSB 3KUYB 4YM6C 5GT3D 5CP6A 4J8WA 3V9RA 3LJAC 4G91B 3A6ND 3X1VA 5AV6C 3W99D 3AZEB 3AZFA 1TZYA 2BG1A 3AZHC 1KX3B 4UUZA 3KWQB 3REJC 2Y2OA 2NZDD 1S32C 3LZ0B 3LJAD 1P3KD 1M18C 5BT1C 5AV6D 5C3IB 1F66B 3AZKB 3AZLA 4QLCB 2AROB 1P3LA 3AFAA 5B24B 3MGRB 3KFUG 2DQNC 5AV8B 3AZEC 3REJD 5B0ZB 5AV5A 1S32D 3MGSD 2Y2IA 3LZ1C 3KUYD 4JJNB 4Z5TB 2YFVA 1KX3C 2ZY2A 4ZUXA 3KWQC 4NE3A 3LZ0C 4G92B 1P3IA 2JE5A 3AZED 3AZKC 2XD5A 2AROC 4AWLB 5GSUB 5B24C 1KX3D 4WJ3C 1M1AA 5AV8C 3KWQD 3AYWA 3LZ0D 1KU5A 3KXBB 1R4VA 3REHB 4JJNC 1F66D 3AZKD 4QLCD 5AY8C 2NQBC 2AROD 2F2AC 4G92C 2JCHA 5B24D 2CV5A 3W98A 1H3OA 4WV4B 5AV8D 3C1CB 5B0ZD 3VH6W 4J8XB 4J8VB 4AWLC 5FUGB 4JJND 2F8NK 3R45B 1P34B 3KXBC 5BNXB 5AVCA 3REHC 4J8UA 4X23A 3A1IA 2Y2LA 5GSUD 3WTPB 4YS3A 1N1JA 3C1CC 3WA9A 4J8XC 3KXBD 3REHD 4H9OA 1HQ3B 5B0YB 5B32B 1M19C 1P34C 3B6FA 2Y2QA 5CP6B 4J8WB 3V9RB 3C1CD 2FJ7A 2VQRA 3X1VB 4J8VD 4J8XD 5B33C 3AZNC 5AV9A 1EQZA 3AZFB 1TZYB 3W96A 1M19D 1P34D 4UUZB 1HQ3C 2UWXA 1ID3A 2XD1A 3AZLB 1ZLAA 1P3LB 3AFAB 3X1VC 3B0CT 3H0RC 4H9SC 3RELA 1HQ3D 4KGCC 3WAAA 5B0YD 5JRGB 5B31A 5B32D 3EPJA 2YFVB 3NQJA 2Y2GA 5CP6D 4J8WD 3X1VD 1P3IB 5BO0A 3VH5W 3AZLC 3AZFD 3UTBA 1TZYD 1P3LC 3WTPE 3AFAC 1P3MB 2IO5C 4R8PC 1M1AB 5JRGC 1TAFA 3IP4C 3AZLD 3X1SA 2G5HC 1P3LD 3AFAD 1P3PA 2CV5B 3W98B 1H3OB 2Y2PA 3AZJB 5JRGD 1P3MC 2LY8A 1M1AC 3MNNA 3MVDA 5AVCB 1P3ID 4J8UB 4X23B 5B32G 3MGPA 1P3MD 2CV5C 1M1AD 1N1JB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B1M A;  3AZJ C;  3WA9 B;  5DNN A;  3C1B A;  4H9O B;  4DRB A;  3REI A;  5AVC C;  4WZS B;  2CV5 D;  3B6F B;  4J8U C;  3W98 D;  1P3G C;  2FJ7 B;  3AZJ D;  2F8N A;  5AV9 B;  1EQZ B;  2BYK B;  3AV2 A;  3W96 B;  5AVB A;  5AVC D;  3AZM A;  3B6G B;  4J8U D;  4X23 D;  5CPI A;  3B6F C;  3W98 C;  1BH8 A;  3WA9 D;  3AZG A;  5AV9 C;  1EQZ C;  2CWE A;  3W96 C;  3WAA B;  5B31 B;  3B6F D;  3NQJ B;  4XUJ A;  3B6G C;  2FJ7 D;  2NZD C;  1P3K C;  5BO0 B;  5AV9 D;  1EQZ D;  3UTB B;  5CPJ A;  3LEL A;  3W96 D;  5DNM A;  5B40 A;  1BH9 A;  3B6G D;  1JFI A;  5KDM A;  5GT0 A;  5F99 C;  3MGS C;  3KUY C;  1TAF B;  5GXQ A;  3UT9 A;  3X1S B;  3TU4 A;  1P3P B;  4G91 C;  4CSR A;  4XZQ A;  3UTB C;  3WAA D;  5B31 D;  5F99 D;  3B0D B;  4Z2M G;  3MNN B;  3MVD B;  3UTA A;  3REK A;  4H9P A;  5C3I C;  5B2J A;  3UTB D;  1F66 C;  3MGP B;  4QLC C;  4H9R A;  3MGR C;  5B1M B;  3AV1 A;  5B0Z C;  3C1B B;  3B0D C;  3MNN C;  3KSY A;  4Z5T C;  3REI B;  3X1S D;  1P3A A;  1P3P D;  1KX5 A;  3MGR D;  2F8N B;  5E5A A;  4Z66 A;  3MGP C;  5GSU C;  3AV2 B;  3MNN D;  3X1T A;  4Z5T D;  5AVB B;  3MGQ A;  3C1B C;  3AZM B;  3REI C;  1F1E A;  5B31 G;  3MGP D;  5CPI B;  4WNN B;  1P3B A;  1BH8 B;  2PYO B;  5B1M D;  4CAY B;  3AZG B;  3C1B D;  1WWS A;  4J8V C;  3AV2 C;  3REI D;  1WWI A;  4XUJ B;  5JA4 A;  2F8N D;  5B1L A;  5CPI C;  2RVQ C;  3AV2 D;  3WTP C;  5CPJ B;  3LEL B;  2PYO C;  4M6B A;  2BYM A;  5DNM B;  5B40 B;  5AVB D;  1BH9 B;  1JFI B;  1HTA A;  5KDM B;  3AN2 A;  5GT0 B;  5B0Y C;  5B32 C;  4WU9 A;  5CPI D;  2RVQ D;  4WU8 A;  1KX4 A;  5GXQ B;  3O62 A;  3UT9 B;  3WTP D;  2PYO D;  5CP6 C;  4J8W C;  3TU4 B;  4LD9 A;  3NQU A;  3AZG D;  4XZQ B;  4H9Q A;  5CPJ C;  3LEL C;  3AZF C;  5AV5 B;  1TZY C;  5B40 C;  4XUJ D;  3UTA B;  4E44 A;  1U35 A;  4ZUX B;  5G49 A;  5GT0 C;  3REK B;  5BS7 A;  5B2I A;  5GXQ C;  5GT3 A;  5B2J B;  3UT9 C;  5CPJ D;  3LEL D;  3TU4 C;  1BFM A;  3B0B A;  4H9R B;  5B40 D;  5DNM D;  3VH6 T;  4XZQ C;  1AOI A;  3AV1 B;  5GT0 D;  5AV5 C;  3AYW B;  2F8N G;  4YM6 A;  5GXQ D;  3UT9 D;  4ZUX C;  3TU4 D;  3REK C;  1P3O A;  3X1U A;  1ULY A;  5BNV A;  1P3A B;  1KX5 B;  4XZQ D;  1P3I C;  1P3F A;  4Z66 B;  4DRA A;  5AV5 D;  3AZH A;  3X1T B;  3UTA D;  3AV1 C;  4ZUX D;  4NE5 A;  3MGQ B;  3REK D;  3AYW C;  1M18 A;  5B2J D;  1P3A C;  1P3B B;  3AZE A;  4YS3 B;  3AV1 D;  3AYW D;  3LZ1 A;  4Z2M H;  1P3A D;  4HGA B;  3AZI A;  1KX5 D;  4X23 C;  5B1L B;  4Z66 D;  5AV8 A;  4YS3 C;  4EO5 B;  3X1T D;  2BYM B;  3MGQ D;  3WA9 C;  4JJN A;  3AN2 B;  2NQB A;  5AY8 A;  1ID3 B;  4WU9 B;  1KX4 B;  4WU8 B;  4HGA C;  1P3B D;  3O62 B;  4YS3 D;  1ZLA B;  4LD9 B;  3VH5 T;  2FJ7 C;  5B1L C;  3NQU B;  4H9Q B;  1A7W A;  3REL B;  4EO5 C;  2HIO A;  3KXB A;  1U35 B;  5G49 B;  3AN2 C;  1ID3 C;  5B1L D;  1KX4 C;  5B2I B;  4WU8 C;  3O62 C;  1ZLA C;  4LD9 C;  4J8X A;  1AOI B;  3REL C;  3AN2 D;  1M19 A;  1ID3 D;  3WAA C;  4WU9 D;  5B31 C;  1KX4 D;  4WU8 D;  4YM6 B;  3O62 D;  4KUD A;  1B67 A;  1ZLA D;  1P3O B;  3X1U B;  4LD9 D;  5BNV B;  5BS7 C;  5B33 A;  3AZN A;  3REL D;  1P3F B;  3AZH B;  1AOI C;  1U35 D;  1M18 B;  5B2I D;  1P3O C;  3X1U C;  3X1S C;  1Q9C A;  1P3P C;  4H9S A;  1AOI D;  1P3F C;  4KGC A;  3LZ1 B;  5CPK A;  5DNN B;  4YM6 D;  3MVD C;  1P3O D;  3X1U D;  3W97 A;  3AZI B;  1P3F D;  3AZH D;  4R8P A;  3MVD D;  4H9N A;  5B1M C;  5JRG A;  5BT1 D;  1M18 D;  5DNN C;  2F8N H;  2NQB B;  5AY8 B;  3AZI C;  4NFT A;  3B0C W;  1P3M A;  3LZ1 D;  5DNN D;  4E45 A;  2HIO B;  3WKJ A;  3AZI D;  5AVB C;  3AZM C;  4ZBJ B;  3AZJ A;  2YFW A;  3AZG C;  3AZM D;  2HIO C;  1M19 B;  5AY8 D;  2NQB D;  5CHL B;  1P3G A;  4XUJ C;  4KUD B;  4ZBJ C;  5B33 B;  3AZN B;  4CSR B;  2HIO D;  5DNM C;  3VH6 A;  4H9P B;  4KUD C;  3A6N A;  2BYK A;  4KHA A;  3W99 A;  4KGC B;  5CPK B;  3B6G A;  4KUD D;  3UTA C;  2NZD A;  3LJA A;  3W97 B;  1P3K A;  5B33 D;  3AZN D;  5AV6 A;  5B2J C;  5E5A B;  2IO5 B;  4R8P B;  4H9N B;  3REJ A;  1S32 A;  5F99 A;  5CPK C;  3MGS A;  3KUY A;  3W97 C;  1KX5 C;  4KGC D;  5E5A C;  4Z66 C;  5CPK D;  4NE6 A;  1KX3 A;  3KWQ A;  3X1T C;  3WKJ B;  3LZ0 A;  1B6W A;  3W97 D;  3MGQ C;  1F66 A;  3AZK A;  4QLC A;  5JA4 B;  2ARO A;  5E5A D;  5B24 A;  2JSS A;  4R8P D;  3MGR A;  1P3B C;  3VH5 A;  5B0Z A;  2YFW B;  4Z5T A;  3WKJ C;  1P3G B;  2HUE B;  5GSU A;  3WKJ D;  3REH A;  4WU9 C;  5GT3 B;  3C1C A;  2HUE C;  3A6N B;  4J8V A;  4KHA B;  3W99 B;  5FUG A;  3R45 A;  1P34 A;  5BNX A;  1P3G D;  1U35 C;  2NZD B;  3LJA B;  1P3K B;  4WNN A;  5AV6 B;  5B2I C;  3WTP A;  2PYO A;  5GT3 C;  2L5A A;  4CAY A;  3A6N C;  3W99 C;  3REJ B;  1HQ3 A;  1S32 B;  5F99 B;  5B0Y A;  5B32 A;  3MGS B;  3KUY B;  4YM6 C;  5GT3 D;  5CP6 A;  4J8W A;  3V9R A;  3LJA C;  4G91 B;  3A6N D;  3X1V A;  5AV6 C;  3W99 D;  3AZE B;  3AZF A;  1TZY A;  3AZH C;  1KX3 B;  4UUZ A;  3KWQ B;  3REJ C;  2NZD D;  1S32 C;  3LZ0 B;  3LJA D;  1P3K D;  1M18 C;  5BT1 C;  5AV6 D;  5C3I B;  1F66 B;  3AZK B;  3AZL A;  4QLC B;  2ARO B;  1P3L A;  3AFA A;  5B24 B;  3MGR B;  5AV8 B;  3AZE C;  3REJ D;  5B0Z B;  5AV5 A;  1S32 D;  3MGS D;  3KUY D;  3LZ1 C;  4JJN B;  1KX3 C;  4Z5T B;  2YFV A;  4ZUX A;  3KWQ C;  4NE3 A;  3LZ0 C;  4G92 B;  1P3I A;  3AZE D;  3AZK C;  2ARO C;  4AWL B;  5GSU B;  5B24 C;  1KX3 D;  1M1A A;  5AV8 C;  3KWQ D;  3AYW A;  3LZ0 D;  1KU5 A;  3KXB B;  1R4V A;  3REH B;  4JJN C;  1F66 D;  3AZK D;  4QLC D;  5AY8 C;  2NQB C;  2ARO D;  4G92 C;  5B24 D;  2CV5 A;  3W98 A;  1H3O A;  4WV4 B;  5AV8 D;  3C1C B;  5B0Z D;  3VH6 W;  4J8X B;  4J8V B;  4AWL C;  5FUG B;  4JJN D;  2F8N K;  3R45 B;  1P34 B;  3KXB C;  5BNX B;  5AVC A;  3REH C;  4J8U A;  4X23 A;  5GSU D;  3WTP B;  4YS3 A;  1N1J A;  3C1C C;  3WA9 A;  4J8X C;  3KXB D;  3REH D;  4H9O A;  1HQ3 B;  5B0Y B;  5B32 B;  1M19 C;  1P34 C;  3B6F A;  5CP6 B;  4J8W B;  3V9R B;  3C1C D;  2FJ7 A;  3X1V B;  4J8V D;  4J8X D;  5B33 C;  3AZN C;  5AV9 A;  1EQZ A;  3AZF B;  1TZY B;  3W96 A;  1M19 D;  1P34 D;  4UUZ B;  1HQ3 C;  1ID3 A;  3AZL B;  1ZLA A;  1P3L B;  3AFA B;  3X1V C;  3B0C T;  4H9S C;  3REL A;  1HQ3 D;  4KGC C;  3WAA A;  5B0Y D;  5JRG B;  5B31 A;  5B32 D;  2YFV B;  3NQJ A;  5CP6 D;  4J8W D;  3X1V D;  1P3I B;  5BO0 A;  3VH5 W;  3AZL C;  3AZF D;  3UTB A;  1TZY D;  1P3L C;  3WTP E;  3AFA C;  1P3M B;  2IO5 C;  4R8P C;  1M1A B;  5JRG C;  1TAF A;  3AZL D;  3X1S A;  1P3L D;  3AFA D;  1P3P A;  2CV5 B;  3W98 B;  1H3O B;  3AZJ B;  5JRG D;  1P3M C;  2LY8 A;  1M1A C;  3MNN A;  3MVD A;  5AVC B;  1P3I D;  4J8U B;  4X23 B;  5B32 G;  3MGP A;  1P3M D;  2CV5 C;  1M1A D;  1N1J B; 
#chains in the Genus database with same CATH topology
 3A1K A;  5B1M A;  3AZJ C;  3WA9 B;  5DNN A;  3C1B A;  4H9O B;  4DRB A;  3REI A;  5AVC C;  4WZS B;  2CV5 D;  3B6F B;  4J8U C;  3W98 D;  1P3G C;  2FJ7 B;  3AZJ D;  2F8N A;  5AV9 B;  1EQZ B;  2BYK B;  3AV2 A;  3W96 B;  5AVB A;  5AVC D;  3AZM A;  3B6G B;  4J8U D;  4X23 D;  2Y2H A;  5CPI A;  3B6F C;  3W98 C;  1BH8 A;  2W8S A;  3WA9 D;  3AZG A;  3EG5 B;  5AV9 C;  1EQZ C;  2CWE A;  3W96 C;  3WAA B;  5B31 B;  3B6F D;  3NQJ B;  4XUJ A;  3B6G C;  2FJ7 D;  2NZD C;  1P3K C;  5BO0 B;  5AV9 D;  1EQZ D;  3UTB B;  5CPJ A;  3LEL A;  3W96 D;  5DNM A;  5B40 A;  1BH9 A;  3B6G D;  1JFI A;  5KDM A;  5GT0 A;  5F99 C;  3MGS C;  3KUY C;  1TAF B;  5GXQ A;  3UT9 A;  3X1S B;  3TU4 A;  1P3P B;  4G91 C;  4CSR A;  4XZQ A;  3UTB C;  3WAA D;  5B31 D;  5F99 D;  3B0D B;  4Z2M G;  3MNN B;  3MVD B;  2ZY3 A;  3UTA A;  3REK A;  4H9P A;  1T3U A;  5C3I C;  5B2J A;  3UTB D;  1F66 C;  3MGP B;  4QLC C;  4H9R A;  3MGR C;  5B1M B;  3AV1 A;  5B0Z C;  3C1B B;  3B0D C;  3MNN C;  3KSY A;  4Z5T C;  3REI B;  3X1S D;  1P3A A;  1P3P D;  1KX5 A;  3MGR D;  2F8N B;  5E5A A;  4Z66 A;  3MGP C;  3EPK A;  5GSU C;  3AV2 B;  3MNN D;  3X1T A;  4Z5T D;  5AVB B;  3MGQ A;  3C1B C;  3AZM B;  2ZY5 A;  3REI C;  1F1E A;  5B31 G;  3MGP D;  5CPI B;  4WNN B;  1P3B A;  1BH8 B;  2PYO B;  5B1M D;  4CAY B;  3AZG B;  3C1B D;  1WWS A;  4J8V C;  3AV2 C;  3REI D;  1WWI A;  4XUJ B;  5JA4 A;  2F8N D;  5B1L A;  5CPI C;  2RVQ C;  3AV2 D;  3WTP C;  5CPJ B;  3LEL B;  2PYO C;  4M6B A;  2BYM A;  5DNM B;  5B40 B;  5AVB D;  1BH9 B;  1JFI B;  1HTA A;  5KDM B;  3AN2 A;  5GT0 B;  5B0Y C;  5B32 C;  4WU9 A;  5CPI D;  2RVQ D;  4WU8 A;  1KX4 A;  5GXQ B;  3O62 A;  3UT9 B;  3WTP D;  2PYO D;  5CP6 C;  4J8W C;  3TU4 B;  4LD9 A;  3NQU A;  3AZG D;  4XZQ B;  4H9Q A;  5CPJ C;  3LEL C;  3AZF C;  5AV5 B;  1TZY C;  5B40 C;  2Y2N A;  4XUJ D;  3UTA B;  4E44 A;  1U35 A;  4ZUX B;  5G49 A;  5GT0 C;  3REK B;  1Z2C B;  5BS7 A;  5B2I A;  5GXQ C;  5GT3 A;  5B2J B;  3UT9 C;  5CPJ D;  3LEL D;  3TU4 C;  1BFM A;  3B0B A;  4H9R B;  5B40 D;  5DNM D;  3VH6 T;  4XZQ C;  1AOI A;  3AV1 B;  5GT0 D;  5AV5 C;  3AYW B;  2F8N G;  4YM6 A;  5GXQ D;  3UT9 D;  4ZUX C;  3TU4 D;  3REK C;  1P3O A;  3X1U A;  1ULY A;  5BNV A;  1P3A B;  1KX5 B;  4XZQ D;  1P3I C;  1P3F A;  4Z66 B;  4DRA A;  5AV5 D;  3AZH A;  3X1T B;  3UTA D;  3AV1 C;  4ZUX D;  4NE5 A;  3MGQ B;  3REK D;  3AYW C;  1M18 A;  5B2J D;  1P3A C;  1P3B B;  3AZE A;  4YS3 B;  3AV1 D;  3AYW D;  3LZ1 A;  2G5I C;  4Z2M H;  2FFF B;  1P3A D;  4HGA B;  3AZI A;  1KX5 D;  4X23 C;  5B1L B;  4Z66 D;  5AV8 A;  4YS3 C;  4EO5 B;  3X1T D;  2BYM B;  3MGQ D;  3WA9 C;  4JJN A;  2Y2M A;  3AN2 B;  2NQB A;  5AY8 A;  1ID3 B;  3H0M C;  4WU9 B;  1KX4 B;  4WU8 B;  4HGA C;  1P3B D;  3O62 B;  4YS3 D;  1ZLA B;  3F6T A;  4LD9 B;  3VH5 T;  2FJ7 C;  5B1L C;  3NQU B;  4H9Q B;  1A7W A;  3REL B;  4EO5 C;  2HIO A;  3KXB A;  1U35 B;  5G49 B;  3AN2 C;  1ID3 C;  5B1L D;  1KX4 C;  5B2I B;  4WU8 C;  3O62 C;  1ZLA C;  4LD9 C;  4J8X A;  1AOI B;  3REL C;  3AN2 D;  1M19 A;  1ID3 D;  3WAA C;  4WU9 D;  5B31 C;  1KX4 D;  4WU8 D;  4YM6 B;  3O62 D;  4KUD A;  1B67 A;  1ZLA D;  1P3O B;  3X1U B;  4LD9 D;  5BNV B;  5BS7 C;  5B33 A;  3AZN A;  3REL D;  1P3F B;  3AZH B;  1AOI C;  1U35 D;  1M18 B;  5B2I D;  1P3O C;  3X1U C;  3X1S C;  1Q9C A;  1P3P C;  4H9S A;  1AOI D;  1P3F C;  4KGC A;  3H0L C;  3LZ1 B;  5CPK A;  5DNN B;  2Y2K A;  4YM6 D;  3MVD C;  1P3O D;  3X1U D;  3W97 A;  3AZI B;  1P3F D;  3AZH D;  4R8P A;  3MVD D;  4H9N A;  5B1M C;  5JRG A;  5BT1 D;  1M18 D;  5DNN C;  2F8N H;  2NQB B;  5AY8 B;  1PZR A;  3AZI C;  4NFT A;  3B0C W;  1P3M A;  3LZ1 D;  5DNN D;  4E45 A;  2HIO B;  3WKJ A;  3AZI D;  5AVB C;  3AZM C;  4ZBJ B;  3AZJ A;  2YFW A;  3AZG C;  3AZM D;  2HIO C;  1M19 B;  5AY8 D;  2NQB D;  5CHL B;  1P3G A;  4XUJ C;  4KUD B;  4ZBJ C;  5B33 B;  3AZN B;  4CSR B;  2HIO D;  3FDD A;  5DNM C;  3VH6 A;  4H9P B;  4KUD C;  3EPH A;  2DF4 C;  3A6N A;  2BYK A;  4KHA A;  3W99 A;  4KGC B;  5CPK B;  3B6G A;  4KUD D;  3UTA C;  2ZM5 A;  2NZD A;  3LJA A;  3W97 B;  1P3K A;  5B33 D;  3AZN D;  5AV6 A;  5B2J C;  5E5A B;  3P5J B;  2IO5 B;  4R8P B;  4H9N B;  3REJ A;  4UPK A;  1S32 A;  5F99 A;  5CPK C;  3MGS A;  3KUY A;  3W97 C;  1W2E A;  1KX5 C;  4KGC D;  5E5A C;  4Z66 C;  5CPK D;  2ZY4 A;  4NE6 A;  1KX3 A;  3KWQ A;  3X1T C;  3WKJ B;  3LZ0 A;  1B6W A;  3W97 D;  3MGQ C;  1F66 A;  3AZK A;  4QLC A;  5JA4 B;  2ARO A;  5E5A D;  5B24 A;  2JSS A;  4R8P D;  3MGR A;  1P3B C;  3VH5 A;  5B0Z A;  2YFW B;  4Z5T A;  3WKJ C;  1P3G B;  2HUE B;  5GSU A;  3WKJ D;  3REH A;  2RIQ A;  4WU9 C;  3EPL A;  5GT3 B;  3C1C A;  2HUE C;  3A6N B;  2Y2J A;  4KHA B;  4J8V A;  2J8P A;  4DQY B;  3W99 B;  5FUG A;  3R45 A;  1P34 A;  5BNX A;  1P3G D;  3AL0 C;  1U35 C;  2NZD B;  3LJA B;  1P3K B;  4WNN A;  5AV6 B;  5B2I C;  3WTP A;  2PYO A;  5GT3 C;  2L5A A;  4CAY A;  3A6N C;  3W99 C;  3REJ B;  1HQ3 A;  1S32 B;  5B0Y A;  5B32 A;  5F99 B;  3MGS B;  3KUY B;  4YM6 C;  5GT3 D;  5CP6 A;  4J8W A;  3V9R A;  3LJA C;  4G91 B;  3A6N D;  3X1V A;  5AV6 C;  3W99 D;  3AZE B;  3AZF A;  1TZY A;  2BG1 A;  3AZH C;  1KX3 B;  4UUZ A;  3KWQ B;  3REJ C;  2Y2O A;  2NZD D;  1S32 C;  3LZ0 B;  3LJA D;  1P3K D;  1M18 C;  5BT1 C;  5AV6 D;  5C3I B;  1F66 B;  3AZK B;  3AZL A;  4QLC B;  2ARO B;  1P3L A;  3AFA A;  5B24 B;  3MGR B;  3KFU G;  2DQN C;  5AV8 B;  3AZE C;  3REJ D;  5B0Z B;  5AV5 A;  1S32 D;  3MGS D;  2Y2I A;  3LZ1 C;  3KUY D;  4JJN B;  4Z5T B;  2YFV A;  1KX3 C;  2ZY2 A;  4ZUX A;  3KWQ C;  4NE3 A;  3LZ0 C;  4G92 B;  1P3I A;  2JE5 A;  3AZE D;  3AZK C;  2XD5 A;  2ARO C;  4AWL B;  5GSU B;  5B24 C;  1KX3 D;  4WJ3 C;  1M1A A;  5AV8 C;  3KWQ D;  3AYW A;  3LZ0 D;  1KU5 A;  3KXB B;  1R4V A;  3REH B;  4JJN C;  1F66 D;  3AZK D;  4QLC D;  5AY8 C;  2NQB C;  2ARO D;  2F2A C;  4G92 C;  2JCH A;  5B24 D;  2CV5 A;  3W98 A;  1H3O A;  4WV4 B;  5AV8 D;  3C1C B;  5B0Z D;  3VH6 W;  4J8X B;  4J8V B;  4AWL C;  5FUG B;  4JJN D;  2F8N K;  3R45 B;  1P34 B;  3KXB C;  5BNX B;  5AVC A;  3REH C;  4J8U A;  4X23 A;  3A1I A;  2Y2L A;  5GSU D;  3WTP B;  4YS3 A;  1N1J A;  3C1C C;  3WA9 A;  4J8X C;  3KXB D;  3REH D;  4H9O A;  1HQ3 B;  5B0Y B;  5B32 B;  1M19 C;  1P34 C;  3B6F A;  2Y2Q A;  5CP6 B;  4J8W B;  3V9R B;  3C1C D;  2FJ7 A;  2VQR A;  3X1V B;  4J8V D;  4J8X D;  5B33 C;  3AZN C;  5AV9 A;  1EQZ A;  3AZF B;  1TZY B;  3W96 A;  1M19 D;  1P34 D;  4UUZ B;  1HQ3 C;  2UWX A;  1ID3 A;  2XD1 A;  3AZL B;  1ZLA A;  1P3L B;  3AFA B;  3X1V C;  3B0C T;  3H0R C;  4H9S C;  3REL A;  1HQ3 D;  4KGC C;  3WAA A;  5B0Y D;  5JRG B;  5B31 A;  5B32 D;  3EPJ A;  2YFV B;  3NQJ A;  2Y2G A;  5CP6 D;  4J8W D;  3X1V D;  1P3I B;  5BO0 A;  3VH5 W;  3AZL C;  3AZF D;  3UTB A;  1TZY D;  1P3L C;  3WTP E;  3AFA C;  1P3M B;  2IO5 C;  4R8P C;  1M1A B;  5JRG C;  1TAF A;  3IP4 C;  3AZL D;  3X1S A;  2G5H C;  1P3L D;  3AFA D;  1P3P A;  2CV5 B;  3W98 B;  1H3O B;  2Y2P A;  3AZJ B;  5JRG D;  1P3M C;  2LY8 A;  1M1A C;  3MNN A;  3MVD A;  5AVC B;  1P3I D;  4J8U B;  4X23 B;  5B32 G;  3MGP A;  1P3M D;  2CV5 C;  1M1A D;  1N1J B; 
#chains in the Genus database with same CATH homology
 3A1K A;  5B1M A;  3AZJ C;  3WA9 B;  5DNN A;  3C1B A;  4H9O B;  4DRB A;  3REI A;  5AVC C;  4WZS B;  2CV5 D;  3B6F B;  4J8U C;  3W98 D;  1P3G C;  2FJ7 B;  3AZJ D;  2F8N A;  5AV9 B;  1EQZ B;  2BYK B;  3AV2 A;  3W96 B;  5AVB A;  5AVC D;  3AZM A;  3B6G B;  4J8U D;  4X23 D;  2Y2H A;  5CPI A;  3B6F C;  3W98 C;  1BH8 A;  2W8S A;  3WA9 D;  3AZG A;  3EG5 B;  5AV9 C;  1EQZ C;  2CWE A;  3W96 C;  3WAA B;  5B31 B;  3B6F D;  3NQJ B;  4XUJ A;  3B6G C;  2FJ7 D;  2NZD C;  1P3K C;  5BO0 B;  5AV9 D;  1EQZ D;  3UTB B;  5CPJ A;  3LEL A;  3W96 D;  5DNM A;  5B40 A;  1BH9 A;  3B6G D;  1JFI A;  5KDM A;  5GT0 A;  5F99 C;  3MGS C;  3KUY C;  1TAF B;  5GXQ A;  3UT9 A;  3X1S B;  3TU4 A;  1P3P B;  4G91 C;  4CSR A;  4XZQ A;  3UTB C;  3WAA D;  5B31 D;  5F99 D;  3B0D B;  4Z2M G;  3MNN B;  3MVD B;  2ZY3 A;  3UTA A;  3REK A;  4H9P A;  1T3U A;  5C3I C;  5B2J A;  3UTB D;  1F66 C;  3MGP B;  4QLC C;  4H9R A;  3MGR C;  5B1M B;  3AV1 A;  5B0Z C;  3C1B B;  3B0D C;  3MNN C;  3KSY A;  4Z5T C;  3REI B;  3X1S D;  1P3A A;  1P3P D;  1KX5 A;  3MGR D;  2F8N B;  5E5A A;  4Z66 A;  3MGP C;  3EPK A;  5GSU C;  3AV2 B;  3MNN D;  3X1T A;  4Z5T D;  5AVB B;  3MGQ A;  3C1B C;  3AZM B;  2ZY5 A;  3REI C;  1F1E A;  5B31 G;  3MGP D;  5CPI B;  4WNN B;  1P3B A;  1BH8 B;  2PYO B;  5B1M D;  4CAY B;  3AZG B;  3C1B D;  1WWS A;  4J8V C;  3AV2 C;  3REI D;  1WWI A;  4XUJ B;  5JA4 A;  2F8N D;  5B1L A;  5CPI C;  2RVQ C;  3AV2 D;  3WTP C;  5CPJ B;  3LEL B;  2PYO C;  4M6B A;  2BYM A;  5DNM B;  5B40 B;  5AVB D;  1BH9 B;  1JFI B;  1HTA A;  5KDM B;  3AN2 A;  5GT0 B;  5B0Y C;  5B32 C;  4WU9 A;  5CPI D;  2RVQ D;  4WU8 A;  1KX4 A;  5GXQ B;  3O62 A;  3UT9 B;  3WTP D;  2PYO D;  5CP6 C;  4J8W C;  3TU4 B;  4LD9 A;  3NQU A;  3AZG D;  4XZQ B;  4H9Q A;  5CPJ C;  3LEL C;  3AZF C;  5AV5 B;  1TZY C;  5B40 C;  2Y2N A;  4XUJ D;  3UTA B;  4E44 A;  1U35 A;  4ZUX B;  5G49 A;  5GT0 C;  3REK B;  1Z2C B;  5BS7 A;  5B2I A;  5GXQ C;  5GT3 A;  5B2J B;  3UT9 C;  5CPJ D;  3LEL D;  3TU4 C;  1BFM A;  3B0B A;  4H9R B;  5B40 D;  5DNM D;  3VH6 T;  4XZQ C;  1AOI A;  3AV1 B;  5GT0 D;  5AV5 C;  3AYW B;  2F8N G;  4YM6 A;  5GXQ D;  3UT9 D;  4ZUX C;  3TU4 D;  3REK C;  1P3O A;  3X1U A;  1ULY A;  5BNV A;  1P3A B;  1KX5 B;  4XZQ D;  1P3I C;  1P3F A;  4Z66 B;  4DRA A;  5AV5 D;  3AZH A;  3X1T B;  3UTA D;  3AV1 C;  4ZUX D;  4NE5 A;  3MGQ B;  3REK D;  3AYW C;  1M18 A;  5B2J D;  1P3A C;  1P3B B;  3AZE A;  4YS3 B;  3AV1 D;  3AYW D;  3LZ1 A;  2G5I C;  4Z2M H;  2FFF B;  1P3A D;  4HGA B;  3AZI A;  1KX5 D;  4X23 C;  5B1L B;  4Z66 D;  5AV8 A;  4YS3 C;  4EO5 B;  3X1T D;  2BYM B;  3MGQ D;  3WA9 C;  4JJN A;  2Y2M A;  3AN2 B;  2NQB A;  5AY8 A;  1ID3 B;  3H0M C;  4WU9 B;  1KX4 B;  4WU8 B;  4HGA C;  1P3B D;  3O62 B;  4YS3 D;  1ZLA B;  3F6T A;  4LD9 B;  3VH5 T;  2FJ7 C;  5B1L C;  3NQU B;  4H9Q B;  1A7W A;  3REL B;  4EO5 C;  2HIO A;  3KXB A;  1U35 B;  5G49 B;  3AN2 C;  1ID3 C;  5B1L D;  1KX4 C;  5B2I B;  4WU8 C;  3O62 C;  1ZLA C;  4LD9 C;  4J8X A;  1AOI B;  3REL C;  3AN2 D;  1M19 A;  1ID3 D;  3WAA C;  4WU9 D;  5B31 C;  1KX4 D;  4WU8 D;  4YM6 B;  3O62 D;  4KUD A;  1B67 A;  1ZLA D;  1P3O B;  3X1U B;  4LD9 D;  5BNV B;  5BS7 C;  5B33 A;  3AZN A;  3REL D;  1P3F B;  3AZH B;  1AOI C;  1U35 D;  1M18 B;  5B2I D;  1P3O C;  3X1U C;  3X1S C;  1Q9C A;  1P3P C;  4H9S A;  1AOI D;  1P3F C;  4KGC A;  3H0L C;  3LZ1 B;  5CPK A;  5DNN B;  2Y2K A;  4YM6 D;  3MVD C;  1P3O D;  3X1U D;  3W97 A;  3AZI B;  1P3F D;  3AZH D;  4R8P A;  3MVD D;  4H9N A;  5B1M C;  5JRG A;  5BT1 D;  1M18 D;  5DNN C;  2F8N H;  2NQB B;  5AY8 B;  1PZR A;  3AZI C;  4NFT A;  3B0C W;  1P3M A;  3LZ1 D;  5DNN D;  4E45 A;  2HIO B;  3WKJ A;  3AZI D;  5AVB C;  3AZM C;  4ZBJ B;  3AZJ A;  2YFW A;  3AZG C;  3AZM D;  2HIO C;  1M19 B;  5AY8 D;  2NQB D;  5CHL B;  1P3G A;  4XUJ C;  4KUD B;  4ZBJ C;  5B33 B;  3AZN B;  4CSR B;  2HIO D;  3FDD A;  5DNM C;  3VH6 A;  4H9P B;  4KUD C;  3EPH A;  2DF4 C;  3A6N A;  2BYK A;  4KHA A;  3W99 A;  4KGC B;  5CPK B;  3B6G A;  4KUD D;  3UTA C;  2ZM5 A;  2NZD A;  3LJA A;  3W97 B;  1P3K A;  5B33 D;  3AZN D;  5AV6 A;  5B2J C;  5E5A B;  3P5J B;  2IO5 B;  4R8P B;  4H9N B;  3REJ A;  4UPK A;  1S32 A;  5F99 A;  5CPK C;  3MGS A;  3KUY A;  3W97 C;  1W2E A;  1KX5 C;  4KGC D;  5E5A C;  4Z66 C;  5CPK D;  2ZY4 A;  4NE6 A;  1KX3 A;  3KWQ A;  3X1T C;  3WKJ B;  3LZ0 A;  1B6W A;  3W97 D;  3MGQ C;  1F66 A;  3AZK A;  4QLC A;  5JA4 B;  2ARO A;  5E5A D;  5B24 A;  2JSS A;  4R8P D;  3MGR A;  1P3B C;  3VH5 A;  5B0Z A;  2YFW B;  4Z5T A;  3WKJ C;  1P3G B;  2HUE B;  5GSU A;  3WKJ D;  3REH A;  2RIQ A;  4WU9 C;  3EPL A;  5GT3 B;  3C1C A;  2HUE C;  3A6N B;  2Y2J A;  4KHA B;  4J8V A;  2J8P A;  4DQY B;  3W99 B;  5FUG A;  3R45 A;  1P34 A;  5BNX A;  1P3G D;  3AL0 C;  1U35 C;  2NZD B;  3LJA B;  1P3K B;  4WNN A;  5AV6 B;  5B2I C;  3WTP A;  2PYO A;  5GT3 C;  2L5A A;  4CAY A;  3A6N C;  3W99 C;  3REJ B;  1HQ3 A;  1S32 B;  5B0Y A;  5B32 A;  5F99 B;  3MGS B;  3KUY B;  4YM6 C;  5GT3 D;  5CP6 A;  4J8W A;  3V9R A;  3LJA C;  4G91 B;  3A6N D;  3X1V A;  5AV6 C;  3W99 D;  3AZE B;  3AZF A;  1TZY A;  2BG1 A;  3AZH C;  1KX3 B;  4UUZ A;  3KWQ B;  3REJ C;  2Y2O A;  2NZD D;  1S32 C;  3LZ0 B;  3LJA D;  1P3K D;  1M18 C;  5BT1 C;  5AV6 D;  5C3I B;  1F66 B;  3AZK B;  3AZL A;  4QLC B;  2ARO B;  1P3L A;  3AFA A;  5B24 B;  3MGR B;  3KFU G;  2DQN C;  5AV8 B;  3AZE C;  3REJ D;  5B0Z B;  5AV5 A;  1S32 D;  3MGS D;  2Y2I A;  3LZ1 C;  3KUY D;  4JJN B;  4Z5T B;  2YFV A;  1KX3 C;  2ZY2 A;  4ZUX A;  3KWQ C;  4NE3 A;  3LZ0 C;  4G92 B;  1P3I A;  2JE5 A;  3AZE D;  3AZK C;  2XD5 A;  2ARO C;  4AWL B;  5GSU B;  5B24 C;  1KX3 D;  4WJ3 C;  1M1A A;  5AV8 C;  3KWQ D;  3AYW A;  3LZ0 D;  1KU5 A;  3KXB B;  1R4V A;  3REH B;  4JJN C;  1F66 D;  3AZK D;  4QLC D;  5AY8 C;  2NQB C;  2ARO D;  2F2A C;  4G92 C;  2JCH A;  5B24 D;  2CV5 A;  3W98 A;  1H3O A;  4WV4 B;  5AV8 D;  3C1C B;  5B0Z D;  3VH6 W;  4J8X B;  4J8V B;  4AWL C;  5FUG B;  4JJN D;  2F8N K;  3R45 B;  1P34 B;  3KXB C;  5BNX B;  5AVC A;  3REH C;  4J8U A;  4X23 A;  3A1I A;  2Y2L A;  5GSU D;  3WTP B;  4YS3 A;  1N1J A;  3C1C C;  3WA9 A;  4J8X C;  3KXB D;  3REH D;  4H9O A;  1HQ3 B;  5B0Y B;  5B32 B;  1M19 C;  1P34 C;  3B6F A;  2Y2Q A;  5CP6 B;  4J8W B;  3V9R B;  3C1C D;  2FJ7 A;  2VQR A;  3X1V B;  4J8V D;  4J8X D;  5B33 C;  3AZN C;  5AV9 A;  1EQZ A;  3AZF B;  1TZY B;  3W96 A;  1M19 D;  1P34 D;  4UUZ B;  1HQ3 C;  2UWX A;  1ID3 A;  2XD1 A;  3AZL B;  1ZLA A;  1P3L B;  3AFA B;  3X1V C;  3B0C T;  3H0R C;  4H9S C;  3REL A;  1HQ3 D;  4KGC C;  3WAA A;  5B0Y D;  5JRG B;  5B31 A;  5B32 D;  3EPJ A;  2YFV B;  3NQJ A;  2Y2G A;  5CP6 D;  4J8W D;  3X1V D;  1P3I B;  5BO0 A;  3VH5 W;  3AZL C;  3AZF D;  3UTB A;  1TZY D;  1P3L C;  3WTP E;  3AFA C;  1P3M B;  2IO5 C;  4R8P C;  1M1A B;  5JRG C;  1TAF A;  3IP4 C;  3AZL D;  3X1S A;  2G5H C;  1P3L D;  3AFA D;  1P3P A;  2CV5 B;  3W98 B;  1H3O B;  2Y2P A;  3AZJ B;  5JRG D;  1P3M C;  2LY8 A;  1M1A C;  3MNN A;  3MVD A;  5AVC B;  1P3I D;  4J8U B;  4X23 B;  5B32 G;  3MGP A;  1P3M D;  2CV5 C;  1M1A D;  1N1J B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...