5CPJA

Nucleosome containing methylated sat2r dna
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
94
structure length
94
Chain Sequence
YRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Influence of DNA methylation on positioning and DNA flexibility of nucleosomes with pericentric satellite DNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags "structural protein/dna
total genus 30
structure length 94
sequence length 94
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5cpjA00
2HUEB 3KWQD 4YM6A 1HQ3B 5JA4B 5DNMA 3MNNC 1EQZD 4J8WC 4J8VB 4NE3A 5B1MC 3AFAC 4Z5TA 3UTBA 5AV6B 2NQBB 4J8XD 1P34A 5BNXB 4H9QA 5CP6C 2YFVB 1TZYD 1P3AC 1KX3A 4YS3D 4H9RA 1U35D 3TU4A 3O62C 4XZQA 1P3BB 5GXQB 3WTPC 3WKJB 5E5AC 3WAAA 1M1AB 5B1LA 5F99C 1P3MB 3WAAB 3MGSC 1P3FB 3W97D 2NZDD 5CPIC 4R8PB 1AOIB 5GT3A 3W99A 5B2IA 3LZ0A 3REIC 5CPKB 5B0YB 4Z2MG 1M18C 3KUYB 3AYWC 3W99B 5B1MD 3AFAD 5B33A 3LJAC 5AY8B 5C3IB 4Z2MH 4Z66C 5B32A 3A6NC 4KGCA 3AZEC 5B33B 5CP6D 3UTAA 3AV2A 1KX4B 1P3AD 1B6WA 1M19C 3AZNC 2LY8A 3WTPD 3AN2A 5E5AD 5GT0A 5JRGC 5AVCA 3LZ1C 4J8VD 4LD9B 3VH5W 5GT0B 3LELA 3MGSD 5B40B 3X1UC 5AV6D 3MVDA 5CPID 3X1SA 2NQBD 4J8UC 4ZBJB 4G91B 1P3OB 3AZGB 1ZLAA 3REID 1M18D 3MGPC 5AVBB 3REHB 3B0CW 3LJAD 5AV8A 3AZFA 4Z66D 1P3BD 5KDMB 5GXQD 3AZED 3WKJD 4UUZA 1EQZA 4H9NB 4G92B 3KWQB 3NQJA 2HIOA 1EQZB 3NQUB 3X1TC 4J8XA 3AZKC 3AZIC 1F66A 5GSUC 3REJA 4J8XB 5JRGD 2PYOC 2AROA 1KX5B 1TZYA 5CPKD 5B0YD 5BS7C 4JJNC 1U35A 5B24C 1P3IA 5AY8D 4YS3B 4J8UD 5CHLB 5DNNC 1P3LB 4DRBA 1KX4D 4QLCB 3MGPD 5B0ZA 1JFIA 2NZDA 5B31A 4CAYB 3MGRB 2YFWA 3RELB 1B67A 3W97B 5G49A 3AZLC 4ZUXC 3AZJA 1ID3C 2CV5C 5CPJA 3MNNB 5B40D 4J8WB 3C1CC 3UT9A 1BFMA 3AZKD 3AZID 5B1MB 5GSUD 3AFAB 1P3OD 3B6GC 3AZGD 2CWEA 2F8NG 1Q9CA 4JJND 5CP6B 3REHD 2F8NK 5B24D 1S32A 1P3AB 4H9OA 1P3GC 2F8NH 4X23C 4KUDC 5JA4A 3O62B 4H9SC 3WTPB 4J8VA 3REKC 3AV1C 5E5AB 3AZHC 5AV6A 5F99B 2NQBA 5BNXA 4XUJC 3MGSB 3C1BD 4WU9C 5CPIB 5AV5C 3AZLD 4ZUXD 2YFVA 1ID3D 1KX5D 4WU8C 2CV5D 3WA9C 1BH8B 3REIB 3C1CD 1M18B 1P3BA 3AYWB 1P3LD 5GXQA 3WKJA 4E45A 3LJAB 1M1AA 2FJ7C 4Z66B 3AZMC 3A6NB 3W96C 4QLCD 3AZEB 1P3PC 1P3MA 1P3FA 5BNVA 4R8PA 3MGRD 1P3GD 1AOIA 1P3KC 4X23D 4KUDD 1M19B 3X1VC 3RELD 5BNVB 3AZNB 5CPKA 5B0YA 3REKD 3AV1D 3KUYA 5JRGB 3MNND 3LZ1B 4J8WD 1WWIA 5AY8A 1WWSA 4J8UA 3W98C 4WU9D 3MGQC 3X1UB 5AV5D 3KXBC 1KX4A 5B2JC 2BYMB 4WU8D 4J8UB 5B31G 5AV9C 3MGPB 1H3OB 4YM6C 5DNMC 2FJ7D 3O62D 4HGAC 4LD9A 4Z5TC 3UTBC 5B40A 1P34C 5F99D 2L5AA 3AZKA 3X1VD 1BH9A 3X1TB 1P3OA 3AZGA 2BYKB 1KX3C 3AZKB 3AZIB 5GSUB 1BH9B 3TU4C 5AVBA 3REHA 2PYOB 3B0DC 4H9PB 4EO5C 4XZQC 3AYWD 4JJNB 3W98D 5KDMA 5B24B 5B1LC 3KXBD 5B2JD 4H9NA 5DNNB 3A6ND 3KWQA 2F8NB 3B6FC 4WNNB 3NQUA 5GT3C 1KU5A 2RVQC 5B2IC 3LZ0C 3C1BA 1M19D 4YM6D 5DNMD 3AZND 1KX5A 2CV5A 1N1JB 3C1BB 4M6BA 5BO0B 4Z5TD 3AZLB 4ZUXB 3LZ1D 1ID3B 1P34D 2CV5B 5B32C 4CSRB 4YS3A 4KGCC 1P3LA 3AV2C 3UTAC 3X1UD 3C1CB 1KX3D 3KSYA 4QLCA 3B6GB 4CAYA 3MGRA 1P3GA 3AN2C 3RELA 3W97A 5AVCC 1P3GB 4X23B 4KUDB 3LELC 3AV1A 4KHAB 3B6FD 3MVDC 3MNNA 3X1SC 5GT3D 4J8WA 3REKB 3AV1B 3AZHB 2RVQD 5B2ID 3LZ0D 5B1MA 5BT1C 3AFAA 3X1TD 5B32G 1ZLAC 4XUJB 1ULYA 4WU9B 5AV5B 5CP6A 5AV8C 3AZFC 2PYOD 4WU8B 1P3AA 3WA9B 5B32D 3AZFD 4KGCD 4NFTA 3UTAD 1EQZC 5FUGB 3O62A 5DNND 3WTPA 2HIOC 5E5AA 2F8ND 2FJ7B 1TAFB 2IO5C 3AZMB 5F99A 1P3PB 3W96B 1F66C 3REJC 3MGSA 5AVCD 2AROC 3WTPE 5CPIA 1TZYC 1P3KB 3X1VB 3LELD 1U35C 1BH8A 1P3IC 3REIA 1M18A 3AYWA 5BT1D 3LJAA 1ZLAD 4Z66A 3W98B 3A6NA 4AWLC 3R45B 5B0ZC 3MGQB 3AZEA 4NE6A 3KXBB 2NZDC 5B2JB 5AV8D 3B6GD 5B31C 1M19A 5AV9B 3AZJC 3AZNA 5CPJC 2HIOD 4YM6B 5DNMB 5JRGA 4HGAB 3LZ1A 3UT9C 3AZHD 1F66D 1A7WA 4Z5TB 3REJD 3UTBB 1P34B 3X1UA 2AROD 2BYMA 4H9QB 4DRAA 4XUJD 1P3ID 1S32C 1KX3B 4H9RB 3WA9D 3MGPA 3TU4B 4WV4B 1H3OA 2HUEC 3B0DB 1HQ3C 4EO5B 4XZQB 3B0BA 4J8VC 5B0ZD 5B1LB 3B6FA 4E44A 5AV6C 5B31D 2NQBC 3AZMD 1P3PD 3W96D 3B6FB 3VH6T 3AZJD 3X1TA 5GT3B 2BYKA 1P3KD 5CPJD 5B2IB 3LZ0B 3AZIA 5GSUA 2JSSA 2PYOA 3UT9D 4H9PA 1P3BC 5BS7A 5GXQC 3WKJC 4JJNA 5B24A 1M1AC 5B32B 3VH6W 3VH5T 1P3MC 4KGCB 1R4VA 5DNNA 3WAAC 3UTAB 3MGQD 3AV2B 2F8NA 1P3FC 4R8PC 1S32D 4WNNA 1AOIC 1HQ3D 5AV9D 5CPKC 3AN2B 3W99C 5B0YC 1N1JA 3KUYC 3B0CT 5AVCB 5BO0A 3AZLA 4ZUXA 1ID3A 5AY8C 5C3IC 1F1EA 3LELB 4CSRA 5B33C 3UTBD 3MVDB 3X1SB 1KX4C 3C1CA 1ZLAB 3B6GA 1HTAA 3TU4D 5AV8B 3AZFB 1M1AD 4XZQD 1P3MD 4LD9C 4X23A 4KUDA 5GT0C 3WAAD 4KHAA 4UUZB 5B1LD 5B40C 1P3FD 4R8PD 3VH6A 4H9SA 1AOID 3NQJB 2HIOB 3REKA 3AZHA 4ZBJC 4G91C 1P3OC 2IO5B 4NE5A 3AZGC 3V9RA 1F66B 3W99D 4XUJA 3KUYD 5AVBC 3REHC 3REJB 4WU9A 2AROB 5AV5A 3V9RB 1TZYB 4WZSB 4WU8A 3VH5A 3WA9A 1U35B 5B33D 1P3IB 5FUGA 4G92C 3KWQC 3AV2D 2FJ7A 1TAFA 3AZMA 3W96A 4AWLB 5B0ZB 3C1BC 1P3PA 1JFIB 2NZDB 5B31B 4J8XC 2YFWB 1KX5C 3AN2D 1P3KA 4LD9D 5GT0D 5G49B 3X1VA 3AZJB 5CPJB 4YS3C 1P3LC 3MVDD 3UT9B 3X1SD 4QLCC 3W98A 5AVBD 3R45A 3MGQA 3KXBA 5B2JA 3MGRC 3RELC 3W97C 1S32B 4H9OB 1HQ3A 5AV9A
chains in the Genus database with same CATH superfamily
2HUEB 3KWQD 4YM6A 1HQ3B 5JA4B 2XD5A 5DNMA 3MNNC 1EQZD 4J8WC 4J8VB 4NE3A 5B1MC 3AFAC 4Z5TA 3UTBA 5AV6B 2NQBB 4J8XD 1P34A 5BNXB 4H9QA 5CP6C 2YFVB 1TZYD 1P3AC 1KX3A 4YS3D 4H9RA 1U35D 3TU4A 3O62C 4XZQA 1P3BB 5GXQB 3WTPC 3WKJB 5E5AC 3WAAA 1M1AB 5B1LA 5F99C 1T3UA 1P3MB 3WAAB 3MGSC 1P3FB 3W97D 2NZDD 2VQRA 5CPIC 4R8PB 1AOIB 5GT3A 3EPHA 3W99A 5B2IA 3H0RC 3LZ0A 3REIC 5CPKB 5B0YB 4Z2MG 1M18C 3KUYB 3AYWC 3W99B 2G5IC 5B1MD 3AFAD 2Y2MA 5B33A 3LJAC 5AY8B 5C3IB 4Z2MH 4Z66C 5B32A 3A6NC 4KGCA 3AZEC 5B33B 5CP6D 3UTAA 3AV2A 1KX4B 2XD1A 1P3AD 1B6WA 1M19C 3EG5B 3AZNC 2LY8A 3WTPD 3AN2A 5E5AD 5GT0A 5JRGC 5AVCA 3LZ1C 4J8VD 4LD9B 3VH5W 5GT0B 3LELA 3MGSD 5B40B 3X1UC 5AV6D 3MVDA 5CPID 3X1SA 2NQBD 4J8UC 4ZBJB 4G91B 1P3OB 3AZGB 1ZLAA 3REID 1M18D 3MGPC 5AVBB 2ZM5A 3REHB 3B0CW 3LJAD 5AV8A 3AZFA 4Z66D 1P3BD 5KDMB 5GXQD 3AZED 3WKJD 2F2AC 4UUZA 1EQZA 4H9NB 4G92B 3KWQB 3NQJA 2HIOA 1EQZB 3NQUB 3X1TC 3IP4C 4J8XA 3AZKC 3AZIC 1F66A 5GSUC 3REJA 4J8XB 5JRGD 2PYOC 2AROA 1KX5B 2FFFB 1TZYA 5CPKD 5B0YD 5BS7C 4JJNC 1U35A 5B24C 1P3IA 5AY8D 4YS3B 4J8UD 5CHLB 5DNNC 1P3LB 4DRBA 1KX4D 2UWXA 4QLCB 3MGPD 5B0ZA 1JFIA 2NZDA 5B31A 4CAYB 3MGRB 2YFWA 3RELB 1B67A 3W97B 5G49A 3AZLC 4ZUXC 3AZJA 1ID3C 2J8PA 2RIQA 3F6TA 2CV5C 5CPJA 3MNNB 5B40D 2ZY4A 4J8WB 3C1CC 3UT9A 1BFMA 3AZKD 3AZID 5B1MB 5GSUD 3AFAB 4WJ3C 1P3OD 3B6GC 3AZGD 2CWEA 2F8NG 1Q9CA 4JJND 5CP6B 3REHD 2F8NK 5B24D 1S32A 1P3AB 4H9OA 1P3GC 2F8NH 4X23C 4KUDC 1W2EA 5JA4A 3O62B 4H9SC 3WTPB 4J8VA 3REKC 3AV1C 5E5AB 3AZHC 5AV6A 5F99B 2NQBA 5BNXA 4XUJC 3MGSB 3C1BD 4WU9C 5CPIB 5AV5C 3AZLD 4ZUXD 2YFVA 1ID3D 1KX5D 4WU8C 2CV5D 3WA9C 1BH8B 3REIB 3C1CD 1M18B 1P3BA 3AYWB 1P3LD 5GXQA 3WKJA 4E45A 3LJAB 1M1AA 2FJ7C 2JE5A 4Z66B 3AZMC 3A6NB 3W96C 4QLCD 3AZEB 1P3PC 1P3MA 2W8SA 1P3FA 5BNVA 4R8PA 2DQNC 3MGRD 1P3GD 1AOIA 1P3KC 4X23D 4KUDD 1M19B 3X1VC 3RELD 5BNVB 3AZNB 5CPKA 5B0YA 3REKD 3AV1D 3KUYA 5JRGB 3MNND 3LZ1B 4J8WD 1WWIA 5AY8A 1WWSA 4J8UA 3W98C 4WU9D 3MGQC 3X1UB 5AV5D 3KXBC 1KX4A 5B2JC 2BYMB 4DQYB 4WU8D 4J8UB 5B31G 3KFUG 2DF4C 5AV9C 3MGPB 1H3OB 4YM6C 5DNMC 2FJ7D 3O62D 4HGAC 4LD9A 4Z5TC 3UTBC 5B40A 1P34C 5F99D 2Y2PA 2L5AA 3AZKA 3X1VD 1BH9A 3X1TB 1P3OA 3AZGA 2BYKB 1KX3C 3AZKB 3AZIB 5GSUB 1BH9B 3TU4C 5AVBA 3REHA 2PYOB 3B0DC 4H9PB 4EO5C 4XZQC 2ZY5A 3AYWD 4JJNB 3W98D 5KDMA 5B24B 3H0MC 5B1LC 3KXBD 5B2JD 4H9NA 5DNNB 3A6ND 3KWQA 2F8NB 3B6FC 4WNNB 3NQUA 5GT3C 1KU5A 2RVQC 5B2IC 3LZ0C 3C1BA 1M19D 4YM6D 5DNMD 3AZND 1KX5A 2CV5A 1N1JB 3C1BB 4M6BA 5BO0B 4Z5TD 3AZLB 4ZUXB 3LZ1D 1ID3B 1P34D 2CV5B 5B32C 4CSRB 4YS3A 4KGCC 1P3LA 3AV2C 3UTAC 2Y2JA 3X1UD 3C1CB 1KX3D 3KSYA 4QLCA 3B6GB 4CAYA 3MGRA 1P3GA 3AN2C 3RELA 1Z2CB 3W97A 5AVCC 1P3GB 4X23B 4KUDB 2Y2GA 3LELC 3AV1A 4KHAB 3B6FD 3MVDC 3MNNA 3X1SC 5GT3D 4J8WA 3REKB 3AV1B 3AZHB 2RVQD 2Y2LA 5B2ID 3LZ0D 5B1MA 5BT1C 3AFAA 3X1TD 5B32G 1ZLAC 4XUJB 1ULYA 4WU9B 5AV5B 5CP6A 5AV8C 3AZFC 2PYOD 4WU8B 1P3AA 3WA9B 5B32D 3AZFD 4KGCD 4NFTA 3UTAD 1EQZC 2BG1A 5FUGB 3O62A 3A1IA 5DNND 3WTPA 2HIOC 5E5AA 2F8ND 2FJ7B 1TAFB 2IO5C 3AZMB 5F99A 1P3PB 3W96B 1F66C 3REJC 3MGSA 5AVCD 2AROC 3WTPE 5CPIA 1TZYC 1P3KB 3X1VB 3LELD 1U35C 1BH8A 1P3IC 3REIA 3AL0C 1M18A 3AYWA 5BT1D 3LJAA 1ZLAD 3FDDA 4Z66A 3W98B 3A6NA 3H0LC 3R45B 5B0ZC 3MGQB 4AWLC 3AZEA 4NE6A 3KXBB 2NZDC 5B2JB 5AV8D 3EPJA 5B31C 3B6GD 1M19A 5AV9B 3AZJC 3AZNA 2Y2IA 5CPJC 2HIOD 4YM6B 5DNMB 5JRGA 4HGAB 3LZ1A 3UT9C 3AZHD 1F66D 1A7WA 4Z5TB 3REJD 3UTBB 1P34B 3X1UA 2AROD 2BYMA 4H9QB 2Y2OA 4DRAA 4XUJD 3EPLA 1P3ID 1S32C 1KX3B 4H9RB 3WA9D 3MGPA 3TU4B 4WV4B 1H3OA 2HUEC 3B0DB 1HQ3C 4EO5B 4XZQB 3B0BA 4J8VC 5B0ZD 5B1LB 3B6FA 4E44A 5AV6C 5B31D 2NQBC 3AZMD 1P3PD 3W96D 3B6FB 3VH6T 3AZJD 3X1TA 5GT3B 2BYKA 1P3KD 5CPJD 5B2IB 3LZ0B 3AZIA 5GSUA 2JSSA 2PYOA 3UT9D 4H9PA 1P3BC 5BS7A 5GXQC 3WKJC 4JJNA 2ZY2A 5B24A 1M1AC 5B32B 3VH6W 3VH5T 1P3MC 4KGCB 1R4VA 5DNNA 3WAAC 3UTAB 3MGQD 3AV2B 2F8NA 1P3FC 4R8PC 1S32D 4WNNA 1AOIC 2JCHA 1HQ3D 5AV9D 5CPKC 3AN2B 3W99C 5B0YC 1N1JA 3KUYC 3B0CT 5AVCB 5BO0A 3AZLA 4ZUXA 1ID3A 2Y2KA 5AY8C 5C3IC 1F1EA 3LELB 4CSRA 5B33C 3UTBD 3MVDB 3X1SB 1KX4C 3C1CA 1ZLAB 3B6GA 1HTAA 3TU4D 5AV8B 3AZFB 1M1AD 4XZQD 1P3MD 4LD9C 4X23A 4KUDA 5GT0C 3WAAD 4KHAA 4UUZB 5B1LD 5B40C 1P3FD 4R8PD 3VH6A 4H9SA 1AOID 1PZRA 3NQJB 2HIOB 3REKA 3AZHA 4ZBJC 4G91C 1P3OC 2IO5B 4NE5A 3AZGC 3V9RA 2Y2NA 1F66B 3W99D 4XUJA 3KUYD 5AVBC 3REHC 3REJB 4WU9A 2AROB 5AV5A 3V9RB 1TZYB 2G5HC 4WZSB 4WU8A 3VH5A 3WA9A 1U35B 5B33D 1P3IB 5FUGA 4G92C 3KWQC 3A1KA 3AV2D 4UPKA 1TAFA 2FJ7A 3AZMA 3W96A 4AWLB 5B0ZB 3C1BC 1P3PA 1JFIB 2NZDB 5B31B 4J8XC 2YFWB 1KX5C 3AN2D 1P3KA 4LD9D 5GT0D 5G49B 3X1VA 3AZJB 3P5JB 5CPJB 4YS3C 2Y2HA 1P3LC 3MVDD 3UT9B 3X1SD 2Y2QA 4QLCC 3W98A 5AVBD 3R45A 3MGQA 3EPKA 2ZY3A 3KXBA 5B2JA 3MGRC 3RELC 3W97C 1S32B 4H9OB 1HQ3A 5AV9A
chains in the Genus database with same CATH topology
2HUEB 3KWQD 4YM6A 1HQ3B 5JA4B 2XD5A 5DNMA 3MNNC 1EQZD 4J8WC 4J8VB 4NE3A 5B1MC 3AFAC 4Z5TA 3UTBA 5AV6B 2NQBB 4J8XD 1P34A 5BNXB 4H9QA 5CP6C 2YFVB 1TZYD 1P3AC 1KX3A 4YS3D 4H9RA 1U35D 3TU4A 3O62C 4XZQA 1P3BB 5GXQB 3WTPC 3WKJB 5E5AC 3WAAA 1M1AB 5B1LA 5F99C 1T3UA 1P3MB 3WAAB 3MGSC 1P3FB 3W97D 2NZDD 2VQRA 5CPIC 4R8PB 1AOIB 5GT3A 3EPHA 3W99A 5B2IA 3H0RC 3LZ0A 3REIC 5CPKB 5B0YB 4Z2MG 1M18C 3KUYB 3AYWC 3W99B 2G5IC 5B1MD 3AFAD 2Y2MA 5B33A 3LJAC 5AY8B 5C3IB 4Z2MH 4Z66C 5B32A 3A6NC 4KGCA 3AZEC 5B33B 5CP6D 3UTAA 3AV2A 1KX4B 2XD1A 1P3AD 1B6WA 1M19C 3EG5B 3AZNC 2LY8A 3WTPD 3AN2A 5E5AD 5GT0A 5JRGC 5AVCA 3LZ1C 4J8VD 4LD9B 3VH5W 5GT0B 3LELA 3MGSD 5B40B 3X1UC 5AV6D 3MVDA 5CPID 3X1SA 2NQBD 4J8UC 4ZBJB 4G91B 1P3OB 3AZGB 1ZLAA 3REID 1M18D 3MGPC 5AVBB 2ZM5A 3REHB 3B0CW 3LJAD 5AV8A 3AZFA 4Z66D 1P3BD 5KDMB 5GXQD 3AZED 3WKJD 2F2AC 4UUZA 1EQZA 4H9NB 4G92B 3KWQB 3NQJA 2HIOA 1EQZB 3NQUB 3X1TC 3IP4C 4J8XA 3AZKC 3AZIC 1F66A 5GSUC 3REJA 4J8XB 5JRGD 2PYOC 2AROA 1KX5B 2FFFB 1TZYA 5CPKD 5B0YD 5BS7C 4JJNC 1U35A 5B24C 1P3IA 5AY8D 4YS3B 4J8UD 5CHLB 5DNNC 1P3LB 4DRBA 1KX4D 2UWXA 4QLCB 3MGPD 5B0ZA 1JFIA 2NZDA 5B31A 4CAYB 3MGRB 2YFWA 3RELB 1B67A 3W97B 5G49A 3AZLC 4ZUXC 3AZJA 1ID3C 2J8PA 2RIQA 3F6TA 2CV5C 5CPJA 3MNNB 5B40D 2ZY4A 4J8WB 3C1CC 3UT9A 1BFMA 3AZKD 3AZID 5B1MB 5GSUD 3AFAB 4WJ3C 1P3OD 3B6GC 3AZGD 2CWEA 2F8NG 1Q9CA 4JJND 5CP6B 3REHD 2F8NK 5B24D 1S32A 1P3AB 4H9OA 1P3GC 2F8NH 4X23C 4KUDC 1W2EA 5JA4A 3O62B 4H9SC 3WTPB 4J8VA 3REKC 3AV1C 5E5AB 3AZHC 5AV6A 5F99B 2NQBA 5BNXA 4XUJC 3MGSB 3C1BD 4WU9C 5CPIB 5AV5C 3AZLD 4ZUXD 2YFVA 1ID3D 1KX5D 4WU8C 2CV5D 3WA9C 1BH8B 3REIB 3C1CD 1M18B 1P3BA 3AYWB 1P3LD 5GXQA 3WKJA 4E45A 3LJAB 1M1AA 2FJ7C 2JE5A 4Z66B 3AZMC 3A6NB 3W96C 4QLCD 3AZEB 1P3PC 1P3MA 2W8SA 1P3FA 5BNVA 4R8PA 2DQNC 3MGRD 1P3GD 1AOIA 1P3KC 4X23D 4KUDD 1M19B 3X1VC 3RELD 5BNVB 3AZNB 5CPKA 5B0YA 3REKD 3AV1D 3KUYA 5JRGB 3MNND 3LZ1B 4J8WD 1WWIA 5AY8A 1WWSA 4J8UA 3W98C 4WU9D 3MGQC 3X1UB 5AV5D 3KXBC 1KX4A 5B2JC 2BYMB 4DQYB 4WU8D 4J8UB 5B31G 3KFUG 2DF4C 5AV9C 3MGPB 1H3OB 4YM6C 5DNMC 2FJ7D 3O62D 4HGAC 4LD9A 4Z5TC 3UTBC 5B40A 1P34C 5F99D 2Y2PA 2L5AA 3AZKA 3X1VD 1BH9A 3X1TB 1P3OA 3AZGA 2BYKB 1KX3C 3AZKB 3AZIB 5GSUB 1BH9B 3TU4C 5AVBA 3REHA 2PYOB 3B0DC 4H9PB 4EO5C 4XZQC 2ZY5A 3AYWD 4JJNB 3W98D 5KDMA 5B24B 3H0MC 5B1LC 3KXBD 5B2JD 4H9NA 5DNNB 3A6ND 3KWQA 2F8NB 3B6FC 4WNNB 3NQUA 5GT3C 1KU5A 2RVQC 5B2IC 3LZ0C 3C1BA 1M19D 4YM6D 5DNMD 3AZND 1KX5A 2CV5A 1N1JB 3C1BB 4M6BA 5BO0B 4Z5TD 3AZLB 4ZUXB 3LZ1D 1ID3B 1P34D 2CV5B 5B32C 4CSRB 4YS3A 4KGCC 1P3LA 3AV2C 3UTAC 2Y2JA 3X1UD 3C1CB 1KX3D 3KSYA 4QLCA 3B6GB 4CAYA 3MGRA 1P3GA 3AN2C 3RELA 1Z2CB 3W97A 5AVCC 1P3GB 4X23B 4KUDB 2Y2GA 3LELC 3AV1A 4KHAB 3B6FD 3MVDC 3MNNA 3X1SC 5GT3D 4J8WA 3REKB 3AV1B 3AZHB 2RVQD 2Y2LA 5B2ID 3LZ0D 5B1MA 5BT1C 3AFAA 3X1TD 5B32G 1ZLAC 4XUJB 1ULYA 4WU9B 5AV5B 5CP6A 5AV8C 3AZFC 2PYOD 4WU8B 1P3AA 3WA9B 5B32D 3AZFD 4KGCD 4NFTA 3UTAD 1EQZC 2BG1A 5FUGB 3O62A 3A1IA 5DNND 3WTPA 2HIOC 5E5AA 2F8ND 2FJ7B 1TAFB 2IO5C 3AZMB 5F99A 1P3PB 3W96B 1F66C 3REJC 3MGSA 5AVCD 2AROC 3WTPE 5CPIA 1TZYC 1P3KB 3X1VB 3LELD 1U35C 1BH8A 1P3IC 3REIA 3AL0C 1M18A 3AYWA 5BT1D 3LJAA 1ZLAD 3FDDA 4Z66A 3W98B 3A6NA 3H0LC 3R45B 5B0ZC 3MGQB 4AWLC 3AZEA 4NE6A 3KXBB 2NZDC 5B2JB 5AV8D 3EPJA 5B31C 3B6GD 1M19A 5AV9B 3AZJC 3AZNA 2Y2IA 5CPJC 2HIOD 4YM6B 5DNMB 5JRGA 4HGAB 3LZ1A 3UT9C 3AZHD 1F66D 1A7WA 4Z5TB 3REJD 3UTBB 1P34B 3X1UA 2AROD 2BYMA 4H9QB 2Y2OA 4DRAA 4XUJD 3EPLA 1P3ID 1S32C 1KX3B 4H9RB 3WA9D 3MGPA 3TU4B 4WV4B 1H3OA 2HUEC 3B0DB 1HQ3C 4EO5B 4XZQB 3B0BA 4J8VC 5B0ZD 5B1LB 3B6FA 4E44A 5AV6C 5B31D 2NQBC 3AZMD 1P3PD 3W96D 3B6FB 3VH6T 3AZJD 3X1TA 5GT3B 2BYKA 1P3KD 5CPJD 5B2IB 3LZ0B 3AZIA 5GSUA 2JSSA 2PYOA 3UT9D 4H9PA 1P3BC 5BS7A 5GXQC 3WKJC 4JJNA 2ZY2A 5B24A 1M1AC 5B32B 3VH6W 3VH5T 1P3MC 4KGCB 1R4VA 5DNNA 3WAAC 3UTAB 3MGQD 3AV2B 2F8NA 1P3FC 4R8PC 1S32D 4WNNA 1AOIC 2JCHA 1HQ3D 5AV9D 5CPKC 3AN2B 3W99C 5B0YC 1N1JA 3KUYC 3B0CT 5AVCB 5BO0A 3AZLA 4ZUXA 1ID3A 2Y2KA 5AY8C 5C3IC 1F1EA 3LELB 4CSRA 5B33C 3UTBD 3MVDB 3X1SB 1KX4C 3C1CA 1ZLAB 3B6GA 1HTAA 3TU4D 5AV8B 3AZFB 1M1AD 4XZQD 1P3MD 4LD9C 4X23A 4KUDA 5GT0C 3WAAD 4KHAA 4UUZB 5B1LD 5B40C 1P3FD 4R8PD 3VH6A 4H9SA 1AOID 1PZRA 3NQJB 2HIOB 3REKA 3AZHA 4ZBJC 4G91C 1P3OC 2IO5B 4NE5A 3AZGC 3V9RA 2Y2NA 1F66B 3W99D 4XUJA 3KUYD 5AVBC 3REHC 3REJB 4WU9A 2AROB 5AV5A 3V9RB 1TZYB 2G5HC 4WZSB 4WU8A 3VH5A 3WA9A 1U35B 5B33D 1P3IB 5FUGA 4G92C 3KWQC 3A1KA 3AV2D 4UPKA 1TAFA 2FJ7A 3AZMA 3W96A 4AWLB 5B0ZB 3C1BC 1P3PA 1JFIB 2NZDB 5B31B 4J8XC 2YFWB 1KX5C 3AN2D 1P3KA 4LD9D 5GT0D 5G49B 3X1VA 3AZJB 3P5JB 5CPJB 4YS3C 2Y2HA 1P3LC 3MVDD 3UT9B 3X1SD 2Y2QA 4QLCC 3W98A 5AVBD 3R45A 3MGQA 3EPKA 2ZY3A 3KXBA 5B2JA 3MGRC 3RELC 3W97C 1S32B 4H9OB 1HQ3A 5AV9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HUE B;  3KWQ D;  4YM6 A;  1HQ3 B;  5JA4 B;  5DNM A;  3MNN C;  1EQZ D;  4J8W C;  4J8V B;  4NE3 A;  5B1M C;  3AFA C;  4Z5T A;  3UTB A;  5AV6 B;  2NQB B;  4J8X D;  1P34 A;  5BNX B;  4H9Q A;  5CP6 C;  2YFV B;  1TZY D;  1P3A C;  1KX3 A;  4YS3 D;  4H9R A;  1U35 D;  3TU4 A;  3O62 C;  4XZQ A;  1P3B B;  5GXQ B;  3WTP C;  3WKJ B;  5E5A C;  3WAA A;  1M1A B;  5B1L A;  5F99 C;  1P3M B;  3WAA B;  3MGS C;  1P3F B;  3W97 D;  2NZD D;  5CPI C;  4R8P B;  1AOI B;  5GT3 A;  3W99 A;  5B2I A;  3LZ0 A;  3REI C;  5CPK B;  5B0Y B;  4Z2M G;  1M18 C;  3KUY B;  3AYW C;  3W99 B;  5B1M D;  3AFA D;  5B33 A;  3LJA C;  5AY8 B;  5C3I B;  4Z2M H;  4Z66 C;  5B32 A;  3A6N C;  4KGC A;  3AZE C;  5B33 B;  5CP6 D;  3UTA A;  3AV2 A;  1KX4 B;  1P3A D;  1B6W A;  1M19 C;  3AZN C;  2LY8 A;  3WTP D;  3AN2 A;  5E5A D;  5GT0 A;  5JRG C;  5AVC A;  3LZ1 C;  4J8V D;  4LD9 B;  3VH5 W;  5GT0 B;  3LEL A;  3MGS D;  5B40 B;  3X1U C;  5AV6 D;  3MVD A;  5CPI D;  3X1S A;  2NQB D;  4J8U C;  4ZBJ B;  4G91 B;  1P3O B;  3AZG B;  1ZLA A;  3REI D;  1M18 D;  3MGP C;  5AVB B;  3REH B;  3B0C W;  3LJA D;  5AV8 A;  3AZF A;  4Z66 D;  1P3B D;  5KDM B;  5GXQ D;  3AZE D;  3WKJ D;  4UUZ A;  1EQZ A;  4H9N B;  4G92 B;  3KWQ B;  3NQJ A;  2HIO A;  1EQZ B;  3NQU B;  3X1T C;  4J8X A;  3AZK C;  3AZI C;  1F66 A;  5GSU C;  3REJ A;  4J8X B;  5JRG D;  2PYO C;  2ARO A;  1KX5 B;  1TZY A;  5CPK D;  5B0Y D;  5BS7 C;  4JJN C;  1U35 A;  5B24 C;  1P3I A;  5AY8 D;  4YS3 B;  4J8U D;  5CHL B;  5DNN C;  1P3L B;  4DRB A;  1KX4 D;  4QLC B;  3MGP D;  5B0Z A;  1JFI A;  2NZD A;  5B31 A;  4CAY B;  3MGR B;  2YFW A;  3REL B;  1B67 A;  3W97 B;  5G49 A;  3AZL C;  4ZUX C;  3AZJ A;  1ID3 C;  2CV5 C;  5CPJ A;  3MNN B;  5B40 D;  4J8W B;  3C1C C;  3UT9 A;  1BFM A;  3AZK D;  3AZI D;  5B1M B;  5GSU D;  3AFA B;  1P3O D;  3B6G C;  3AZG D;  2CWE A;  2F8N G;  1Q9C A;  4JJN D;  5CP6 B;  3REH D;  2F8N K;  5B24 D;  1S32 A;  1P3A B;  4H9O A;  1P3G C;  2F8N H;  4X23 C;  4KUD C;  5JA4 A;  3O62 B;  4H9S C;  3WTP B;  4J8V A;  3REK C;  3AV1 C;  5E5A B;  3AZH C;  5AV6 A;  5F99 B;  2NQB A;  5BNX A;  4XUJ C;  3MGS B;  3C1B D;  4WU9 C;  5CPI B;  5AV5 C;  3AZL D;  4ZUX D;  2YFV A;  1ID3 D;  1KX5 D;  4WU8 C;  2CV5 D;  3WA9 C;  1BH8 B;  3REI B;  3C1C D;  1M18 B;  1P3B A;  3AYW B;  1P3L D;  5GXQ A;  3WKJ A;  4E45 A;  3LJA B;  1M1A A;  2FJ7 C;  4Z66 B;  3AZM C;  3A6N B;  3W96 C;  4QLC D;  3AZE B;  1P3P C;  1P3M A;  1P3F A;  5BNV A;  4R8P A;  3MGR D;  1P3G D;  1AOI A;  1P3K C;  4X23 D;  4KUD D;  1M19 B;  3X1V C;  3REL D;  5BNV B;  3AZN B;  5CPK A;  5B0Y A;  3REK D;  3AV1 D;  3KUY A;  5JRG B;  3MNN D;  3LZ1 B;  4J8W D;  1WWI A;  5AY8 A;  1WWS A;  4J8U A;  3W98 C;  4WU9 D;  3MGQ C;  3X1U B;  5AV5 D;  3KXB C;  1KX4 A;  5B2J C;  2BYM B;  4WU8 D;  4J8U B;  5B31 G;  5AV9 C;  3MGP B;  1H3O B;  4YM6 C;  5DNM C;  2FJ7 D;  3O62 D;  4HGA C;  4LD9 A;  4Z5T C;  3UTB C;  5B40 A;  1P34 C;  5F99 D;  2L5A A;  3AZK A;  3X1V D;  1BH9 A;  3X1T B;  1P3O A;  3AZG A;  2BYK B;  1KX3 C;  3AZK B;  3AZI B;  5GSU B;  1BH9 B;  3TU4 C;  5AVB A;  3REH A;  2PYO B;  3B0D C;  4H9P B;  4EO5 C;  4XZQ C;  3AYW D;  4JJN B;  3W98 D;  5KDM A;  5B24 B;  5B1L C;  3KXB D;  5B2J D;  4H9N A;  5DNN B;  3A6N D;  3KWQ A;  2F8N B;  3B6F C;  4WNN B;  3NQU A;  5GT3 C;  1KU5 A;  2RVQ C;  5B2I C;  3LZ0 C;  3C1B A;  1M19 D;  4YM6 D;  5DNM D;  3AZN D;  1KX5 A;  2CV5 A;  1N1J B;  3C1B B;  4M6B A;  5BO0 B;  4Z5T D;  3AZL B;  4ZUX B;  3LZ1 D;  1ID3 B;  1P34 D;  2CV5 B;  5B32 C;  4CSR B;  4YS3 A;  4KGC C;  1P3L A;  3AV2 C;  3UTA C;  3X1U D;  3C1C B;  1KX3 D;  3KSY A;  4QLC A;  3B6G B;  4CAY A;  3MGR A;  1P3G A;  3AN2 C;  3REL A;  3W97 A;  5AVC C;  1P3G B;  4X23 B;  4KUD B;  3LEL C;  3AV1 A;  4KHA B;  3B6F D;  3MVD C;  3MNN A;  3X1S C;  5GT3 D;  4J8W A;  3REK B;  3AV1 B;  3AZH B;  2RVQ D;  5B2I D;  3LZ0 D;  5B1M A;  5BT1 C;  3AFA A;  3X1T D;  5B32 G;  1ZLA C;  4XUJ B;  1ULY A;  4WU9 B;  5AV5 B;  5CP6 A;  5AV8 C;  3AZF C;  2PYO D;  4WU8 B;  1P3A A;  3WA9 B;  5B32 D;  3AZF D;  4KGC D;  4NFT A;  3UTA D;  1EQZ C;  5FUG B;  3O62 A;  5DNN D;  3WTP A;  2HIO C;  5E5A A;  2F8N D;  2FJ7 B;  1TAF B;  2IO5 C;  3AZM B;  5F99 A;  1P3P B;  3W96 B;  1F66 C;  3REJ C;  3MGS A;  5AVC D;  2ARO C;  3WTP E;  5CPI A;  1TZY C;  1P3K B;  3X1V B;  3LEL D;  1U35 C;  1BH8 A;  1P3I C;  3REI A;  1M18 A;  3AYW A;  5BT1 D;  3LJA A;  1ZLA D;  4Z66 A;  3W98 B;  3A6N A;  4AWL C;  3R45 B;  5B0Z C;  3MGQ B;  3AZE A;  4NE6 A;  3KXB B;  2NZD C;  5B2J B;  5AV8 D;  3B6G D;  5B31 C;  1M19 A;  5AV9 B;  3AZJ C;  3AZN A;  5CPJ C;  2HIO D;  4YM6 B;  5DNM B;  5JRG A;  4HGA B;  3LZ1 A;  3UT9 C;  3AZH D;  1F66 D;  1A7W A;  4Z5T B;  3REJ D;  3UTB B;  1P34 B;  3X1U A;  2ARO D;  2BYM A;  4H9Q B;  4DRA A;  4XUJ D;  1P3I D;  1S32 C;  1KX3 B;  4H9R B;  3WA9 D;  3MGP A;  3TU4 B;  4WV4 B;  1H3O A;  2HUE C;  3B0D B;  1HQ3 C;  4EO5 B;  4XZQ B;  3B0B A;  4J8V C;  5B0Z D;  5B1L B;  3B6F A;  4E44 A;  5AV6 C;  5B31 D;  2NQB C;  3AZM D;  1P3P D;  3W96 D;  3B6F B;  3VH6 T;  3AZJ D;  3X1T A;  5GT3 B;  2BYK A;  1P3K D;  5CPJ D;  5B2I B;  3LZ0 B;  3AZI A;  5GSU A;  2JSS A;  2PYO A;  3UT9 D;  4H9P A;  1P3B C;  5BS7 A;  5GXQ C;  3WKJ C;  4JJN A;  5B24 A;  1M1A C;  5B32 B;  3VH6 W;  3VH5 T;  1P3M C;  4KGC B;  1R4V A;  5DNN A;  3WAA C;  3UTA B;  3MGQ D;  3AV2 B;  2F8N A;  1P3F C;  4R8P C;  1S32 D;  4WNN A;  1AOI C;  1HQ3 D;  5AV9 D;  5CPK C;  3AN2 B;  3W99 C;  5B0Y C;  1N1J A;  3KUY C;  3B0C T;  5AVC B;  5BO0 A;  3AZL A;  4ZUX A;  1ID3 A;  5AY8 C;  5C3I C;  1F1E A;  3LEL B;  4CSR A;  5B33 C;  3UTB D;  3MVD B;  3X1S B;  1KX4 C;  3C1C A;  1ZLA B;  3B6G A;  1HTA A;  3TU4 D;  5AV8 B;  3AZF B;  1M1A D;  4XZQ D;  1P3M D;  4LD9 C;  4X23 A;  4KUD A;  5GT0 C;  3WAA D;  4KHA A;  4UUZ B;  5B1L D;  5B40 C;  1P3F D;  4R8P D;  3VH6 A;  4H9S A;  1AOI D;  3NQJ B;  2HIO B;  3REK A;  3AZH A;  4ZBJ C;  4G91 C;  1P3O C;  2IO5 B;  4NE5 A;  3AZG C;  3V9R A;  1F66 B;  3W99 D;  4XUJ A;  3KUY D;  5AVB C;  3REH C;  3REJ B;  4WU9 A;  2ARO B;  5AV5 A;  3V9R B;  1TZY B;  4WZS B;  4WU8 A;  3VH5 A;  3WA9 A;  1U35 B;  5B33 D;  1P3I B;  5FUG A;  4G92 C;  3KWQ C;  3AV2 D;  2FJ7 A;  1TAF A;  3AZM A;  3W96 A;  4AWL B;  5B0Z B;  3C1B C;  1P3P A;  1JFI B;  2NZD B;  5B31 B;  4J8X C;  2YFW B;  1KX5 C;  3AN2 D;  1P3K A;  4LD9 D;  5GT0 D;  5G49 B;  3X1V A;  3AZJ B;  5CPJ B;  4YS3 C;  1P3L C;  3MVD D;  3UT9 B;  3X1S D;  4QLC C;  3W98 A;  5AVB D;  3R45 A;  3MGQ A;  3KXB A;  5B2J A;  3MGR C;  3REL C;  3W97 C;  1S32 B;  4H9O B;  1HQ3 A;  5AV9 A; 
#chains in the Genus database with same CATH topology
 2HUE B;  3KWQ D;  4YM6 A;  1HQ3 B;  5JA4 B;  2XD5 A;  5DNM A;  3MNN C;  1EQZ D;  4J8W C;  4J8V B;  4NE3 A;  5B1M C;  3AFA C;  4Z5T A;  3UTB A;  5AV6 B;  2NQB B;  4J8X D;  1P34 A;  5BNX B;  4H9Q A;  5CP6 C;  2YFV B;  1TZY D;  1P3A C;  1KX3 A;  4YS3 D;  4H9R A;  1U35 D;  3TU4 A;  3O62 C;  4XZQ A;  1P3B B;  5GXQ B;  3WTP C;  3WKJ B;  5E5A C;  3WAA A;  1M1A B;  5B1L A;  5F99 C;  1T3U A;  1P3M B;  3WAA B;  3MGS C;  1P3F B;  3W97 D;  2NZD D;  2VQR A;  5CPI C;  4R8P B;  1AOI B;  5GT3 A;  3EPH A;  3W99 A;  5B2I A;  3H0R C;  3LZ0 A;  3REI C;  5CPK B;  5B0Y B;  4Z2M G;  1M18 C;  3KUY B;  3AYW C;  3W99 B;  2G5I C;  5B1M D;  3AFA D;  2Y2M A;  5B33 A;  3LJA C;  5AY8 B;  5C3I B;  4Z2M H;  4Z66 C;  5B32 A;  3A6N C;  4KGC A;  3AZE C;  5B33 B;  5CP6 D;  3UTA A;  3AV2 A;  1KX4 B;  2XD1 A;  1P3A D;  1B6W A;  1M19 C;  3EG5 B;  3AZN C;  2LY8 A;  3WTP D;  3AN2 A;  5E5A D;  5GT0 A;  5JRG C;  5AVC A;  3LZ1 C;  4J8V D;  4LD9 B;  3VH5 W;  5GT0 B;  3LEL A;  3MGS D;  5B40 B;  3X1U C;  5AV6 D;  3MVD A;  5CPI D;  3X1S A;  2NQB D;  4J8U C;  4ZBJ B;  4G91 B;  1P3O B;  3AZG B;  1ZLA A;  3REI D;  1M18 D;  3MGP C;  5AVB B;  2ZM5 A;  3REH B;  3B0C W;  3LJA D;  5AV8 A;  3AZF A;  4Z66 D;  1P3B D;  5KDM B;  5GXQ D;  3AZE D;  3WKJ D;  2F2A C;  4UUZ A;  1EQZ A;  4H9N B;  4G92 B;  3KWQ B;  3NQJ A;  2HIO A;  1EQZ B;  3NQU B;  3X1T C;  3IP4 C;  4J8X A;  3AZK C;  3AZI C;  1F66 A;  5GSU C;  3REJ A;  4J8X B;  5JRG D;  2PYO C;  2ARO A;  1KX5 B;  2FFF B;  1TZY A;  5CPK D;  5B0Y D;  5BS7 C;  4JJN C;  1U35 A;  5B24 C;  1P3I A;  5AY8 D;  4YS3 B;  4J8U D;  5CHL B;  5DNN C;  1P3L B;  4DRB A;  1KX4 D;  2UWX A;  4QLC B;  3MGP D;  5B0Z A;  1JFI A;  2NZD A;  5B31 A;  4CAY B;  3MGR B;  2YFW A;  3REL B;  1B67 A;  3W97 B;  5G49 A;  3AZL C;  4ZUX C;  3AZJ A;  1ID3 C;  2J8P A;  2RIQ A;  3F6T A;  2CV5 C;  5CPJ A;  3MNN B;  5B40 D;  2ZY4 A;  4J8W B;  3C1C C;  3UT9 A;  1BFM A;  3AZK D;  3AZI D;  5B1M B;  5GSU D;  3AFA B;  4WJ3 C;  1P3O D;  3B6G C;  3AZG D;  2CWE A;  2F8N G;  1Q9C A;  4JJN D;  5CP6 B;  3REH D;  2F8N K;  5B24 D;  1S32 A;  1P3A B;  4H9O A;  1P3G C;  2F8N H;  4X23 C;  4KUD C;  1W2E A;  5JA4 A;  3O62 B;  4H9S C;  3WTP B;  4J8V A;  3REK C;  3AV1 C;  5E5A B;  3AZH C;  5AV6 A;  5F99 B;  2NQB A;  5BNX A;  4XUJ C;  3MGS B;  3C1B D;  4WU9 C;  5CPI B;  5AV5 C;  3AZL D;  4ZUX D;  2YFV A;  1ID3 D;  1KX5 D;  4WU8 C;  2CV5 D;  3WA9 C;  1BH8 B;  3REI B;  3C1C D;  1M18 B;  1P3B A;  3AYW B;  1P3L D;  5GXQ A;  3WKJ A;  4E45 A;  3LJA B;  1M1A A;  2FJ7 C;  2JE5 A;  4Z66 B;  3AZM C;  3A6N B;  3W96 C;  4QLC D;  3AZE B;  1P3P C;  1P3M A;  2W8S A;  1P3F A;  5BNV A;  4R8P A;  2DQN C;  3MGR D;  1P3G D;  1AOI A;  1P3K C;  4X23 D;  4KUD D;  1M19 B;  3X1V C;  3REL D;  5BNV B;  3AZN B;  5CPK A;  5B0Y A;  3REK D;  3AV1 D;  3KUY A;  5JRG B;  3MNN D;  3LZ1 B;  4J8W D;  1WWI A;  5AY8 A;  1WWS A;  4J8U A;  3W98 C;  4WU9 D;  3MGQ C;  3X1U B;  5AV5 D;  3KXB C;  1KX4 A;  5B2J C;  2BYM B;  4DQY B;  4WU8 D;  4J8U B;  5B31 G;  3KFU G;  2DF4 C;  5AV9 C;  3MGP B;  1H3O B;  4YM6 C;  5DNM C;  2FJ7 D;  3O62 D;  4HGA C;  4LD9 A;  4Z5T C;  3UTB C;  5B40 A;  1P34 C;  5F99 D;  2Y2P A;  2L5A A;  3AZK A;  3X1V D;  1BH9 A;  3X1T B;  1P3O A;  3AZG A;  2BYK B;  1KX3 C;  3AZK B;  3AZI B;  5GSU B;  1BH9 B;  3TU4 C;  5AVB A;  3REH A;  2PYO B;  3B0D C;  4H9P B;  4EO5 C;  4XZQ C;  2ZY5 A;  3AYW D;  4JJN B;  3W98 D;  5KDM A;  5B24 B;  3H0M C;  5B1L C;  3KXB D;  5B2J D;  4H9N A;  5DNN B;  3A6N D;  3KWQ A;  2F8N B;  3B6F C;  4WNN B;  3NQU A;  5GT3 C;  1KU5 A;  2RVQ C;  5B2I C;  3LZ0 C;  3C1B A;  1M19 D;  4YM6 D;  5DNM D;  3AZN D;  1KX5 A;  2CV5 A;  1N1J B;  3C1B B;  4M6B A;  5BO0 B;  4Z5T D;  3AZL B;  4ZUX B;  3LZ1 D;  1ID3 B;  1P34 D;  2CV5 B;  5B32 C;  4CSR B;  4YS3 A;  4KGC C;  1P3L A;  3AV2 C;  3UTA C;  2Y2J A;  3X1U D;  3C1C B;  1KX3 D;  3KSY A;  4QLC A;  3B6G B;  4CAY A;  3MGR A;  1P3G A;  3AN2 C;  3REL A;  1Z2C B;  3W97 A;  5AVC C;  1P3G B;  4X23 B;  4KUD B;  2Y2G A;  3LEL C;  3AV1 A;  4KHA B;  3B6F D;  3MVD C;  3MNN A;  3X1S C;  5GT3 D;  4J8W A;  3REK B;  3AV1 B;  3AZH B;  2RVQ D;  2Y2L A;  5B2I D;  3LZ0 D;  5B1M A;  5BT1 C;  3AFA A;  3X1T D;  5B32 G;  1ZLA C;  4XUJ B;  1ULY A;  4WU9 B;  5AV5 B;  5CP6 A;  5AV8 C;  3AZF C;  2PYO D;  4WU8 B;  1P3A A;  3WA9 B;  5B32 D;  3AZF D;  4KGC D;  4NFT A;  3UTA D;  1EQZ C;  2BG1 A;  5FUG B;  3O62 A;  3A1I A;  5DNN D;  3WTP A;  2HIO C;  5E5A A;  2F8N D;  2FJ7 B;  1TAF B;  2IO5 C;  3AZM B;  5F99 A;  1P3P B;  3W96 B;  1F66 C;  3REJ C;  3MGS A;  5AVC D;  2ARO C;  3WTP E;  5CPI A;  1TZY C;  1P3K B;  3X1V B;  3LEL D;  1U35 C;  1BH8 A;  1P3I C;  3REI A;  3AL0 C;  1M18 A;  3AYW A;  5BT1 D;  3LJA A;  1ZLA D;  3FDD A;  4Z66 A;  3W98 B;  3A6N A;  3H0L C;  3R45 B;  5B0Z C;  3MGQ B;  4AWL C;  3AZE A;  4NE6 A;  3KXB B;  2NZD C;  5B2J B;  5AV8 D;  3EPJ A;  5B31 C;  3B6G D;  1M19 A;  5AV9 B;  3AZJ C;  3AZN A;  2Y2I A;  5CPJ C;  2HIO D;  4YM6 B;  5DNM B;  5JRG A;  4HGA B;  3LZ1 A;  3UT9 C;  3AZH D;  1F66 D;  1A7W A;  4Z5T B;  3REJ D;  3UTB B;  1P34 B;  3X1U A;  2ARO D;  2BYM A;  4H9Q B;  2Y2O A;  4DRA A;  4XUJ D;  3EPL A;  1P3I D;  1S32 C;  1KX3 B;  4H9R B;  3WA9 D;  3MGP A;  3TU4 B;  4WV4 B;  1H3O A;  2HUE C;  3B0D B;  1HQ3 C;  4EO5 B;  4XZQ B;  3B0B A;  4J8V C;  5B0Z D;  5B1L B;  3B6F A;  4E44 A;  5AV6 C;  5B31 D;  2NQB C;  3AZM D;  1P3P D;  3W96 D;  3B6F B;  3VH6 T;  3AZJ D;  3X1T A;  5GT3 B;  2BYK A;  1P3K D;  5CPJ D;  5B2I B;  3LZ0 B;  3AZI A;  5GSU A;  2JSS A;  2PYO A;  3UT9 D;  4H9P A;  1P3B C;  5BS7 A;  5GXQ C;  3WKJ C;  4JJN A;  2ZY2 A;  5B24 A;  1M1A C;  5B32 B;  3VH6 W;  3VH5 T;  1P3M C;  4KGC B;  1R4V A;  5DNN A;  3WAA C;  3UTA B;  3MGQ D;  3AV2 B;  2F8N A;  1P3F C;  4R8P C;  1S32 D;  4WNN A;  1AOI C;  2JCH A;  1HQ3 D;  5AV9 D;  5CPK C;  3AN2 B;  3W99 C;  5B0Y C;  1N1J A;  3KUY C;  3B0C T;  5AVC B;  5BO0 A;  3AZL A;  4ZUX A;  1ID3 A;  2Y2K A;  5AY8 C;  5C3I C;  1F1E A;  3LEL B;  4CSR A;  5B33 C;  3UTB D;  3MVD B;  3X1S B;  1KX4 C;  3C1C A;  1ZLA B;  3B6G A;  1HTA A;  3TU4 D;  5AV8 B;  3AZF B;  1M1A D;  4XZQ D;  1P3M D;  4LD9 C;  4X23 A;  4KUD A;  5GT0 C;  3WAA D;  4KHA A;  4UUZ B;  5B1L D;  5B40 C;  1P3F D;  4R8P D;  3VH6 A;  4H9S A;  1AOI D;  1PZR A;  3NQJ B;  2HIO B;  3REK A;  3AZH A;  4ZBJ C;  4G91 C;  1P3O C;  2IO5 B;  4NE5 A;  3AZG C;  3V9R A;  2Y2N A;  1F66 B;  3W99 D;  4XUJ A;  3KUY D;  5AVB C;  3REH C;  3REJ B;  4WU9 A;  2ARO B;  5AV5 A;  3V9R B;  1TZY B;  2G5H C;  4WZS B;  4WU8 A;  3VH5 A;  3WA9 A;  1U35 B;  5B33 D;  1P3I B;  5FUG A;  4G92 C;  3KWQ C;  3A1K A;  3AV2 D;  4UPK A;  1TAF A;  2FJ7 A;  3AZM A;  3W96 A;  4AWL B;  5B0Z B;  3C1B C;  1P3P A;  1JFI B;  2NZD B;  5B31 B;  4J8X C;  2YFW B;  1KX5 C;  3AN2 D;  1P3K A;  4LD9 D;  5GT0 D;  5G49 B;  3X1V A;  3AZJ B;  3P5J B;  5CPJ B;  4YS3 C;  2Y2H A;  1P3L C;  3MVD D;  3UT9 B;  3X1S D;  2Y2Q A;  4QLC C;  3W98 A;  5AVB D;  3R45 A;  3MGQ A;  3EPK A;  2ZY3 A;  3KXB A;  5B2J A;  3MGR C;  3REL C;  3W97 C;  1S32 B;  4H9O B;  1HQ3 A;  5AV9 A; 
#chains in the Genus database with same CATH homology
 2HUE B;  3KWQ D;  4YM6 A;  1HQ3 B;  5JA4 B;  2XD5 A;  5DNM A;  3MNN C;  1EQZ D;  4J8W C;  4J8V B;  4NE3 A;  5B1M C;  3AFA C;  4Z5T A;  3UTB A;  5AV6 B;  2NQB B;  4J8X D;  1P34 A;  5BNX B;  4H9Q A;  5CP6 C;  2YFV B;  1TZY D;  1P3A C;  1KX3 A;  4YS3 D;  4H9R A;  1U35 D;  3TU4 A;  3O62 C;  4XZQ A;  1P3B B;  5GXQ B;  3WTP C;  3WKJ B;  5E5A C;  3WAA A;  1M1A B;  5B1L A;  5F99 C;  1T3U A;  1P3M B;  3WAA B;  3MGS C;  1P3F B;  3W97 D;  2NZD D;  2VQR A;  5CPI C;  4R8P B;  1AOI B;  5GT3 A;  3EPH A;  3W99 A;  5B2I A;  3H0R C;  3LZ0 A;  3REI C;  5CPK B;  5B0Y B;  4Z2M G;  1M18 C;  3KUY B;  3AYW C;  3W99 B;  2G5I C;  5B1M D;  3AFA D;  2Y2M A;  5B33 A;  3LJA C;  5AY8 B;  5C3I B;  4Z2M H;  4Z66 C;  5B32 A;  3A6N C;  4KGC A;  3AZE C;  5B33 B;  5CP6 D;  3UTA A;  3AV2 A;  1KX4 B;  2XD1 A;  1P3A D;  1B6W A;  1M19 C;  3EG5 B;  3AZN C;  2LY8 A;  3WTP D;  3AN2 A;  5E5A D;  5GT0 A;  5JRG C;  5AVC A;  3LZ1 C;  4J8V D;  4LD9 B;  3VH5 W;  5GT0 B;  3LEL A;  3MGS D;  5B40 B;  3X1U C;  5AV6 D;  3MVD A;  5CPI D;  3X1S A;  2NQB D;  4J8U C;  4ZBJ B;  4G91 B;  1P3O B;  3AZG B;  1ZLA A;  3REI D;  1M18 D;  3MGP C;  5AVB B;  2ZM5 A;  3REH B;  3B0C W;  3LJA D;  5AV8 A;  3AZF A;  4Z66 D;  1P3B D;  5KDM B;  5GXQ D;  3AZE D;  3WKJ D;  2F2A C;  4UUZ A;  1EQZ A;  4H9N B;  4G92 B;  3KWQ B;  3NQJ A;  2HIO A;  1EQZ B;  3NQU B;  3X1T C;  3IP4 C;  4J8X A;  3AZK C;  3AZI C;  1F66 A;  5GSU C;  3REJ A;  4J8X B;  5JRG D;  2PYO C;  2ARO A;  1KX5 B;  2FFF B;  1TZY A;  5CPK D;  5B0Y D;  5BS7 C;  4JJN C;  1U35 A;  5B24 C;  1P3I A;  5AY8 D;  4YS3 B;  4J8U D;  5CHL B;  5DNN C;  1P3L B;  4DRB A;  1KX4 D;  2UWX A;  4QLC B;  3MGP D;  5B0Z A;  1JFI A;  2NZD A;  5B31 A;  4CAY B;  3MGR B;  2YFW A;  3REL B;  1B67 A;  3W97 B;  5G49 A;  3AZL C;  4ZUX C;  3AZJ A;  1ID3 C;  2J8P A;  2RIQ A;  3F6T A;  2CV5 C;  5CPJ A;  3MNN B;  5B40 D;  2ZY4 A;  4J8W B;  3C1C C;  3UT9 A;  1BFM A;  3AZK D;  3AZI D;  5B1M B;  5GSU D;  3AFA B;  4WJ3 C;  1P3O D;  3B6G C;  3AZG D;  2CWE A;  2F8N G;  1Q9C A;  4JJN D;  5CP6 B;  3REH D;  2F8N K;  5B24 D;  1S32 A;  1P3A B;  4H9O A;  1P3G C;  2F8N H;  4X23 C;  4KUD C;  1W2E A;  5JA4 A;  3O62 B;  4H9S C;  3WTP B;  4J8V A;  3REK C;  3AV1 C;  5E5A B;  3AZH C;  5AV6 A;  5F99 B;  2NQB A;  5BNX A;  4XUJ C;  3MGS B;  3C1B D;  4WU9 C;  5CPI B;  5AV5 C;  3AZL D;  4ZUX D;  2YFV A;  1ID3 D;  1KX5 D;  4WU8 C;  2CV5 D;  3WA9 C;  1BH8 B;  3REI B;  3C1C D;  1M18 B;  1P3B A;  3AYW B;  1P3L D;  5GXQ A;  3WKJ A;  4E45 A;  3LJA B;  1M1A A;  2FJ7 C;  2JE5 A;  4Z66 B;  3AZM C;  3A6N B;  3W96 C;  4QLC D;  3AZE B;  1P3P C;  1P3M A;  2W8S A;  1P3F A;  5BNV A;  4R8P A;  2DQN C;  3MGR D;  1P3G D;  1AOI A;  1P3K C;  4X23 D;  4KUD D;  1M19 B;  3X1V C;  3REL D;  5BNV B;  3AZN B;  5CPK A;  5B0Y A;  3REK D;  3AV1 D;  3KUY A;  5JRG B;  3MNN D;  3LZ1 B;  4J8W D;  1WWI A;  5AY8 A;  1WWS A;  4J8U A;  3W98 C;  4WU9 D;  3MGQ C;  3X1U B;  5AV5 D;  3KXB C;  1KX4 A;  5B2J C;  2BYM B;  4DQY B;  4WU8 D;  4J8U B;  5B31 G;  3KFU G;  2DF4 C;  5AV9 C;  3MGP B;  1H3O B;  4YM6 C;  5DNM C;  2FJ7 D;  3O62 D;  4HGA C;  4LD9 A;  4Z5T C;  3UTB C;  5B40 A;  1P34 C;  5F99 D;  2Y2P A;  2L5A A;  3AZK A;  3X1V D;  1BH9 A;  3X1T B;  1P3O A;  3AZG A;  2BYK B;  1KX3 C;  3AZK B;  3AZI B;  5GSU B;  1BH9 B;  3TU4 C;  5AVB A;  3REH A;  2PYO B;  3B0D C;  4H9P B;  4EO5 C;  4XZQ C;  2ZY5 A;  3AYW D;  4JJN B;  3W98 D;  5KDM A;  5B24 B;  3H0M C;  5B1L C;  3KXB D;  5B2J D;  4H9N A;  5DNN B;  3A6N D;  3KWQ A;  2F8N B;  3B6F C;  4WNN B;  3NQU A;  5GT3 C;  1KU5 A;  2RVQ C;  5B2I C;  3LZ0 C;  3C1B A;  1M19 D;  4YM6 D;  5DNM D;  3AZN D;  1KX5 A;  2CV5 A;  1N1J B;  3C1B B;  4M6B A;  5BO0 B;  4Z5T D;  3AZL B;  4ZUX B;  3LZ1 D;  1ID3 B;  1P34 D;  2CV5 B;  5B32 C;  4CSR B;  4YS3 A;  4KGC C;  1P3L A;  3AV2 C;  3UTA C;  2Y2J A;  3X1U D;  3C1C B;  1KX3 D;  3KSY A;  4QLC A;  3B6G B;  4CAY A;  3MGR A;  1P3G A;  3AN2 C;  3REL A;  1Z2C B;  3W97 A;  5AVC C;  1P3G B;  4X23 B;  4KUD B;  2Y2G A;  3LEL C;  3AV1 A;  4KHA B;  3B6F D;  3MVD C;  3MNN A;  3X1S C;  5GT3 D;  4J8W A;  3REK B;  3AV1 B;  3AZH B;  2RVQ D;  2Y2L A;  5B2I D;  3LZ0 D;  5B1M A;  5BT1 C;  3AFA A;  3X1T D;  5B32 G;  1ZLA C;  4XUJ B;  1ULY A;  4WU9 B;  5AV5 B;  5CP6 A;  5AV8 C;  3AZF C;  2PYO D;  4WU8 B;  1P3A A;  3WA9 B;  5B32 D;  3AZF D;  4KGC D;  4NFT A;  3UTA D;  1EQZ C;  2BG1 A;  5FUG B;  3O62 A;  3A1I A;  5DNN D;  3WTP A;  2HIO C;  5E5A A;  2F8N D;  2FJ7 B;  1TAF B;  2IO5 C;  3AZM B;  5F99 A;  1P3P B;  3W96 B;  1F66 C;  3REJ C;  3MGS A;  5AVC D;  2ARO C;  3WTP E;  5CPI A;  1TZY C;  1P3K B;  3X1V B;  3LEL D;  1U35 C;  1BH8 A;  1P3I C;  3REI A;  3AL0 C;  1M18 A;  3AYW A;  5BT1 D;  3LJA A;  1ZLA D;  3FDD A;  4Z66 A;  3W98 B;  3A6N A;  3H0L C;  3R45 B;  5B0Z C;  3MGQ B;  4AWL C;  3AZE A;  4NE6 A;  3KXB B;  2NZD C;  5B2J B;  5AV8 D;  3EPJ A;  5B31 C;  3B6G D;  1M19 A;  5AV9 B;  3AZJ C;  3AZN A;  2Y2I A;  5CPJ C;  2HIO D;  4YM6 B;  5DNM B;  5JRG A;  4HGA B;  3LZ1 A;  3UT9 C;  3AZH D;  1F66 D;  1A7W A;  4Z5T B;  3REJ D;  3UTB B;  1P34 B;  3X1U A;  2ARO D;  2BYM A;  4H9Q B;  2Y2O A;  4DRA A;  4XUJ D;  3EPL A;  1P3I D;  1S32 C;  1KX3 B;  4H9R B;  3WA9 D;  3MGP A;  3TU4 B;  4WV4 B;  1H3O A;  2HUE C;  3B0D B;  1HQ3 C;  4EO5 B;  4XZQ B;  3B0B A;  4J8V C;  5B0Z D;  5B1L B;  3B6F A;  4E44 A;  5AV6 C;  5B31 D;  2NQB C;  3AZM D;  1P3P D;  3W96 D;  3B6F B;  3VH6 T;  3AZJ D;  3X1T A;  5GT3 B;  2BYK A;  1P3K D;  5CPJ D;  5B2I B;  3LZ0 B;  3AZI A;  5GSU A;  2JSS A;  2PYO A;  3UT9 D;  4H9P A;  1P3B C;  5BS7 A;  5GXQ C;  3WKJ C;  4JJN A;  2ZY2 A;  5B24 A;  1M1A C;  5B32 B;  3VH6 W;  3VH5 T;  1P3M C;  4KGC B;  1R4V A;  5DNN A;  3WAA C;  3UTA B;  3MGQ D;  3AV2 B;  2F8N A;  1P3F C;  4R8P C;  1S32 D;  4WNN A;  1AOI C;  2JCH A;  1HQ3 D;  5AV9 D;  5CPK C;  3AN2 B;  3W99 C;  5B0Y C;  1N1J A;  3KUY C;  3B0C T;  5AVC B;  5BO0 A;  3AZL A;  4ZUX A;  1ID3 A;  2Y2K A;  5AY8 C;  5C3I C;  1F1E A;  3LEL B;  4CSR A;  5B33 C;  3UTB D;  3MVD B;  3X1S B;  1KX4 C;  3C1C A;  1ZLA B;  3B6G A;  1HTA A;  3TU4 D;  5AV8 B;  3AZF B;  1M1A D;  4XZQ D;  1P3M D;  4LD9 C;  4X23 A;  4KUD A;  5GT0 C;  3WAA D;  4KHA A;  4UUZ B;  5B1L D;  5B40 C;  1P3F D;  4R8P D;  3VH6 A;  4H9S A;  1AOI D;  1PZR A;  3NQJ B;  2HIO B;  3REK A;  3AZH A;  4ZBJ C;  4G91 C;  1P3O C;  2IO5 B;  4NE5 A;  3AZG C;  3V9R A;  2Y2N A;  1F66 B;  3W99 D;  4XUJ A;  3KUY D;  5AVB C;  3REH C;  3REJ B;  4WU9 A;  2ARO B;  5AV5 A;  3V9R B;  1TZY B;  2G5H C;  4WZS B;  4WU8 A;  3VH5 A;  3WA9 A;  1U35 B;  5B33 D;  1P3I B;  5FUG A;  4G92 C;  3KWQ C;  3A1K A;  3AV2 D;  4UPK A;  1TAF A;  2FJ7 A;  3AZM A;  3W96 A;  4AWL B;  5B0Z B;  3C1B C;  1P3P A;  1JFI B;  2NZD B;  5B31 B;  4J8X C;  2YFW B;  1KX5 C;  3AN2 D;  1P3K A;  4LD9 D;  5GT0 D;  5G49 B;  3X1V A;  3AZJ B;  3P5J B;  5CPJ B;  4YS3 C;  2Y2H A;  1P3L C;  3MVD D;  3UT9 B;  3X1S D;  2Y2Q A;  4QLC C;  3W98 A;  5AVB D;  3R45 A;  3MGQ A;  3EPK A;  2ZY3 A;  3KXB A;  5B2J A;  3MGR C;  3REL C;  3W97 C;  1S32 B;  4H9O B;  1HQ3 A;  5AV9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...