3MGPC

Binding of cobalt ions to the nucleosome core particle
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
104
structure length
104
Chain Sequence
KTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Perturbations in nucleosome structure from heavy metal association.
pubmed doi rcsb
source organism Xenopus laevis
total genus 32
structure length 104
sequence length 104
chains with identical sequence G
ec nomenclature
pdb deposition date 2010-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3mgpC00
3AZMD 2L5AA 3REHB 3AZGA 3AV1D 4YM6A 4E44A 1M1AC 3W97C 4YM6D 3AV1C 5B31G 5JA4B 4X23A 2HIOB 3AZFB 2FJ7A 4KUDA 1KU5A 4YM6C 4X23D 2FJ7D 5B1MA 4KUDD 1P3IA 4HGAB 5B1MD 3W96C 1P3ID 2F8NG 4M6BA 3MVDA 4Z2MH 3LJAB 5B32A 1HQ3B 4G91C 4H9QA 1S32A 1KX3B 1P3KA 3X1TC 1P3LA 4AWLB 1S32D 1P3KD 5E5AB 1P3LD 4J8WD 3AZNB 3AZIA 4LD9A 1P3LC 4J8WC 3KXBA 4LD9C 3REJB 4JJNA 5AY8A 5FUGB 5AV9A 1P3AD 5CP6B 4LD9D 1B6WA 3KXBD 1F66A 4JJND 5AV9D 3UTBB 1P3AC 1F66D 5GSUA 5AV6D 3AZMB 3R45A 2YFVB 5B33A 3AZIC 3AV2C 3A6ND 5AV6C 3TU4C 5B33D 5BO0A 1ZLAC 3A6NC 4YM6B 5AVCC 1N1JA 3AN2D 3X1SA 4X23B 2FJ7B 4Z66A 4KUDB 3X1SD 3AN2C 3W99A 4DRBA 4J8XC 5B1MB 4Z66D 1P3IB 1P3FC 2NQBA 4QLCD 3REKA 2NQBD 2JSSA 5AV5D 3REKD 3WKJA 4QLCC 3AZHC 3LELD 3WKJD 3X1VC 5AV5C 5B40C 1B67A 1S32B 2F8NK 1P3KB 1ULYA 1P3LB 1KX5C 3LELC 3MGSA 4ZBJC 3MGSD 2CV5D 1P3AB 4LD9B 3V9RA 3KXBB 4JJNB 5AV9B 3UT9A 2CV5C 4ZUXA 1P3OA 1F66B 4Z5TC 4ZUXD 1P3OD 4J8UC 3MGPA 5BT1C 5B31D 3C1CA 3W98B 3MGPD 3A6NB 3MGQD 3R45B 5B33B 3C1CD 5B31C 5GXQA 3MGQC 5GXQD 3AN2B 3B0BA 1N1JB 3AZEC 3X1SB 4Z66B 2NZDA 5B24D 1P34C 3AYWC 3KWQD 3AFAA 2CWEA 4QLCB 3B6GC 2NZDD 1AOIC 5B24C 3AFAD 5AV5B 3KWQC 3REKB 2NQBB 4WU8A 3WTPE 3WKJB 4XUJC 4WU8D 1H3OA 1P3GA 4ZBJB 1TAFA 1P3GD 5CPJD 5CHLB 4H9SA 3MGSB 2CV5B 5B2IA 5CPJC 3B0DB 5GT3C 5BS7C 1BH8B 5B2ID 3MNNA 3V9RB 3UT9B 3MNND 4ZUXB 1P3OB 5AVBD 1M19C 5B31B 4KGCC 3VH6T 5AVBC 3MGPB 3MGQB 2YFVA 3C1CB 3W97A 1M1AA 3AV1A 5GXQB 2RVQD 1M1AD 3W97D 4CAYA 2RVQC 3W96A 5B24B 2PYOC 3KWQB 2IO5C 5G49A 3W96D 2NZDB 3AFAB 3X1TA 5DNNC 3AZLC 4WU8B 3X1TD 3MGRC 3W98C 1H3OB 4WU9C 1P3GB 5CPJB 3KUYC 4J8WA 1TAFB 1P3BC 1P3PC 4NE6A 4R8PC 5B2IB 1P3AA 5BNXB 3MNNB 5AVBB 4H9OA 4CSRA 3AV2A 4EO5C 5AV6A 4KHAA 4G92C 3TU4A 3AV2D 3WAAC 1ZLAA 3A6NA 5F99C 3TU4D 5AVCA 5B0ZC 3VH5A 1ZLAD 1M1AB 3W97B 5C3IC 2AROD 5AVCD 3AV1B 4XZQC 3AN2A 2AROC 4J8XA 4CAYB 3NQJA 1P3FA 4J8XD 1A7WA 1M18D 1P3FD 3W96B 1ID3C 5G49B 4QLCA 1M18C 3RELC 3O62C 3AZHA 3B6FC 4G91B 5AV5A 5B40A 5DNMC 3AZJD 3X1VA 3AZHD 3X1TB 3W99D 3X1VD 3LELA 5B40D 1KX5A 5B1LC 3AZJC 5B2JC 5AV8C 3W99C 1KX5D 1U35C 1F1EA 3LZ1C 4J8WB 5CPKC 2CV5A 3KSYA 2HUEC 1BH8A 3UTAC 4Z5TA 2F8NH 4J8UA 5JRGC 4G92B 4Z5TD 4J8UD 4H9OB 5BT1D 4CSRB 3X1UC 5B31A 3AV2B 5CPIC 4KHAB 5AV6B 3TU4B 3MGQA 1JFIA 1P3MD 1ZLAB 4NE3A 5AVCB 3AZEA 3AZKC 2F8NA 1P3MC 3NQUA 3AZED 2F8ND 1P34A 3AYWA 1TZYC 1KX4A 4J8XB 3VH5W 3B6GA 3NQJB 1M18B 1P3FB 1P34D 4WZSB 3AYWD 5B24A 1AOIA 3KWQA 1KX4D 3B6GD 5B32G 1AOID 3LZ0C 4XUJA 1KX4C 3AZHB 2BYKB 4NE5A 4XUJD 5B40B 3X1VB 5GT0D 1KX5B 3LELB 4H9PA 1BH9B 5CPJA 5GT3A 5BS7A 5GT0C 3REIC 4Z2MG 5GT3D 1EQZC 5BNXA 3WA9A 3REHC 3C1BD 4Z5TB 1M19A 3WA9D 3AZFD 4J8UB 5AVBA 4KGCA 1M19D 3C1BC 4KGCD 3WA9C 3AZFC 2HIOC 1P3MB 1JFIB 3LJAC 3AZEB 2F8NB 1HQ3C 2PYOA 3NQUB 1P34B 3AYWB 1KX3C 2PYOD 1KX4B 3B6GB 1R4VA 4AWLC 1AOIB 5DNNA 5E5AC 3AZLA 3AZNC 5DNND 2YFWA 3MGRA 4XUJB 3AZLD 3W98A 4WU9A 3REJC 3KUYA 5CP6C 5GT0B 3MGRD 3W98D 4WU9D 1P3BA 1P3PA 4YS3D 3KUYD 3UTBC 4H9PB 4R8PA 1P3BD 5B0YD 1P3PD 4YS3C 5GT3B 4R8PD 4NFTA 3AZMC 5B0YC 3C1BB 3AZGD 3WA9B 1Q9CA 1M19B 3AZGC 4KGCB 3WAAA 5F99A 5B0ZA 3WAAD 4X23C 2FJ7C 5F99D 4KUDC 5B0ZD 4XZQA 5B1MC 1P3IC 3MVDD 2AROA 5B32D 4XZQD 3MVDC 5B32C 2PYOB 1ID3A 2IO5B 1S32C 1M18A 3RELA 3O62A 1P3KC 3B6FA 1ID3D 5DNMA 3RELD 3O62D 5DNNB 3AZID 3B6FD 3AZLB 1HTAA 3WTPA 5DNMD 5B1LA 3AZJA 5AY8D 5B2JA 5AV8A 2YFWB 3MGRB 2LY8A 2BYKA 3VH6A 4H9RA 5B1LD 3WTPD 5KDMA 5B2JD 3KXBC 5AY8C 5AV8D 5AV9C 3KUYB 4JJNC 3LZ1A 4WU9B 4YS3B 1U35D 3WTPC 1F66C 5CPKA 1P3BB 5B0YB 1P3PB 1BH9A 5GSUD 3LZ1D 4R8PB 3UTAA 5CPKD 4J8VA 5GSUC 3UTAD 5BNVA 5JRGA 4J8VD 3AZGB 4H9NA 5B33C 5JRGD 2BYMA 4J8VC 3X1UA 4WV4B 4EO5B 5CPIA 3X1UD 3WAAB 5CPID 3B0CW 5F99B 3X1SC 5B0ZB 1U35A 3AZKA 4Z66C 5C3IB 1P3MA 3MVDB 5B32B 3AZKD 4XZQB 1TZYA 2AROB 2NQBC 4H9QB 3REKC 1TZYD 3WKJC 3LZ0A 4UUZA 1ID3B 3LZ0D 3O62B 3RELB 3B6FB 3AZIB 5DNMB 4WNNA 4DRAA 5AY8B 3MGSC 3WTPB 3B0DC 5B1LB 3AZJB 5B2JB 3UT9D 5AV8B 3W99B 5GT0A 3REIA 4H9RB 1U35B 5KDMB 3UT9C 5GSUB 3LZ1B 4ZUXC 3REID 1P3OC 1EQZA 5CPKB 2HUEB 3VH6W 1EQZD 3UTAB 3REHA 3MGPC 4E45A 4J8VB 5BO0B 5BNVB 5JRGB 3C1CC 3REHD 3C1BA 4H9NB 5JA4A 3AZFA 2HIOA 5GXQC 2BYMB 3B0CT 3X1UB 5CPIB 2HIOD 1WWSA 3LJAA 3AZKB 1HQ3A 2NZDC 3AFAC 3LJAD 1HQ3D 4HGAC 1KX3A 1TZYB 1KX3D 4WU8C 3VH5T 5E5AA 3AZNA 3LZ0B 5E5AD 1P3GC 4UUZB 3AZND 3REJA 5FUGA 5CP6A 1BFMA 4WNNB 4H9SC 3REJD 1WWIA 5B2IC 5CP6D 3UTBA 3UTBD 4YS3A 3MNNC 3REIB 3AZMA 5B0YA 1EQZB
chains in the Genus database with same CATH superfamily
3AZMD 2L5AA 3REHB 3AZGA 3AV1D 4YM6A 4E44A 1M1AC 4UPKA 3W97C 4YM6D 3AV1C 5B31G 5JA4B 4X23A 2HIOB 3AZFB 2FJ7A 4KUDA 1KU5A 4YM6C 4X23D 2FJ7D 5B1MA 4KUDD 1P3IA 2G5IC 4HGAB 5B1MD 3W96C 1P3ID 2F8NG 4M6BA 3MVDA 4Z2MH 3LJAB 5B32A 1HQ3B 4G91C 4H9QA 1S32A 1KX3B 1P3KA 3X1TC 1P3LA 4AWLB 1S32D 1P3KD 5E5AB 3EG5B 1P3LD 4J8WD 3AZNB 3AZIA 4LD9A 3AL0C 1P3LC 2BG1A 3KXBA 4J8WC 3REJB 4JJNA 5AY8A 5FUGB 5AV9A 1P3AD 5CP6B 4LD9D 1B6WA 3KXBD 1F66A 4JJND 5AV9D 3UTBB 3H0RC 1P3AC 1F66D 5GSUA 5AV6D 3AZMB 3R45A 2YFVB 5B33A 3AZIC 3AV2C 3A6ND 5AV6C 2XD1A 3TU4C 5B33D 5BO0A 3EPKA 1ZLAC 3A6NC 4YM6B 5AVCC 1N1JA 3AN2D 3X1SA 4LD9C 4X23B 2FJ7B 4Z66A 4KUDB 3X1SD 3AN2C 3W99A 2Y2KA 4DRBA 5B1MB 4Z66D 4J8XC 1P3IB 1P3FC 2Y2HA 2NQBA 4QLCD 3REKA 2NQBD 2JSSA 5AV5D 3REKD 3WKJA 4QLCC 4DQYB 3AZHC 3LELD 3WKJD 3X1VC 5AV5C 5B40C 1B67A 1S32B 2F8NK 1P3KB 2XD5A 1ULYA 2ZY4A 1P3LB 2DQNC 1KX5C 3LELC 3MGSA 4ZBJC 3MGSD 2CV5D 1P3AB 4LD9B 3V9RA 3KXBB 4JJNB 5AV9B 3UT9A 2CV5C 4ZUXA 1P3OA 1F66B 2ZM5A 4Z5TC 4ZUXD 1P3OD 4J8UC 3MGPA 5BT1C 5B31D 3C1CA 3W98B 3MGPD 3A6NB 3EPHA 3MGQD 3R45B 5B33B 3C1CD 5B31C 2RIQA 5GXQA 3MGQC 5GXQD 3AN2B 3B0BA 1N1JB 3AZEC 3X1SB 4Z66B 2NZDA 5B24D 1P34C 3AYWC 3KWQD 3AFAA 2CWEA 4QLCB 3B6GC 2NZDD 1AOIC 5B24C 3AFAD 5AV5B 3KWQC 3REKB 2NQBB 4WU8A 3WTPE 3WKJB 4XUJC 4WU8D 1H3OA 1P3GA 4ZBJB 1TAFA 1P3GD 5CPJD 4WJ3C 5CHLB 4H9SA 3MGSB 2CV5B 5B2IA 5CPJC 3B0DB 5GT3C 5BS7C 1BH8B 5B2ID 3MNNA 3V9RB 3UT9B 3MNND 4ZUXB 1P3OB 5AVBD 1M19C 3A1KA 5B31B 4KGCC 3VH6T 5AVBC 3MGPB 3MGQB 2YFVA 3C1CB 3W97A 1M1AA 3AV1A 1W2EA 5GXQB 2RVQD 1M1AD 3W97D 4CAYA 2RVQC 3W96A 5B24B 2PYOC 3KWQB 2IO5C 5G49A 3W96D 2NZDB 3P5JB 3AFAB 3X1TA 5DNNC 3AZLC 2Y2JA 4WU8B 3X1TD 3MGRC 3W98C 1H3OB 4WU9C 1P3GB 5CPJB 3KUYC 4J8WA 1Z2CB 1TAFB 1P3BC 1P3PC 4NE6A 4R8PC 5B2IB 3MGRB 1P3AA 5BNXB 3MNNB 5AVBB 4H9OA 4CSRA 3IP4C 2ZY5A 3AV2A 4EO5C 5AV6A 4KHAA 4G92C 3TU4A 2DF4C 3WAAC 3AV2D 1ZLAA 3A6NA 5F99C 3TU4D 2F2AC 5AVCA 5B0ZC 1PZRA 3VH5A 1ZLAD 1M1AB 3W97B 5C3IC 2AROD 5AVCD 3AV1B 1T3UA 4XZQC 3AN2A 2AROC 4J8XA 4CAYB 3NQJA 1P3FA 2JE5A 4J8XD 1A7WA 1M18D 1P3FD 3W96B 1ID3C 5G49B 4QLCA 2UWXA 1M18C 3RELC 3O62C 3AZHA 3B6FC 4G91B 5AV5A 5B40A 5DNMC 3AZJD 3X1VA 3AZHD 3A1IA 3X1TB 3W99D 3X1VD 3LELA 5B40D 1KX5A 5B1LC 3AZJC 5B2JC 5AV8C 3W99C 1KX5D 1U35C 1F1EA 3F6TA 3LZ1C 4J8WB 5CPKC 2CV5A 3KSYA 2HUEC 1BH8A 3UTAC 4Z5TA 2F8NH 4J8UA 5JRGC 4G92B 4Z5TD 4J8UD 4H9OB 5BT1D 4CSRB 3X1UC 5B31A 3AV2B 5AV6B 4KHAB 5CPIC 3TU4B 3MGQA 1JFIA 1P3MD 1ZLAB 3H0LC 4NE3A 5AVCB 3AZEA 3AZKC 2F8NA 2Y2GA 1P3MC 3NQUA 3AZED 2F8ND 1P34A 3AYWA 1TZYC 1KX4A 4J8XB 3VH5W 3B6GA 3NQJB 2Y2NA 3EPJA 1P34D 4WZSB 3AYWD 5B24A 1P3FB 1M18B 1AOIA 3KWQA 1KX4D 3B6GD 5B32G 1AOID 3LZ0C 4XUJA 1KX4C 3AZHB 2BYKB 4NE5A 4XUJD 5B40B 3X1VB 5GT0D 1KX5B 3LELB 4H9PA 1BH9B 5CPJA 5GT3A 5BS7A 5GT0C 3REIC 4Z2MG 5GT3D 1EQZC 5BNXA 3WA9A 3REHC 3C1BD 4Z5TB 1M19A 3WA9D 3AZFD 4J8UB 5AVBA 4KGCA 1M19D 3C1BC 4KGCD 3WA9C 3AZFC 2HIOC 1P3MB 1JFIB 3LJAC 3AZEB 2F8NB 1HQ3C 2PYOA 3NQUB 1P34B 3AYWB 1KX3C 2PYOD 1KX4B 3B6GB 1R4VA 4AWLC 1AOIB 2Y2MA 5DNNA 5E5AC 3AZLA 2Y2OA 3AZNC 5DNND 2YFWA 3MGRA 4XUJB 3AZLD 3W98A 4WU9A 3REJC 3KUYA 5CP6C 5GT0B 3MGRD 3W98D 4WU9D 1P3BA 1P3PA 4YS3D 3KUYD 3UTBC 4H9PB 4R8PA 1P3BD 5B0YD 1P3PD 4YS3C 5GT3B 4R8PD 4NFTA 3AZMC 5B0YC 2G5HC 3C1BB 3AZGD 3WA9B 1Q9CA 1M19B 3AZGC 4KGCB 3WAAA 5F99A 5B0ZA 3WAAD 3FDDA 4X23C 5F99D 2FJ7C 4KUDC 5B0ZD 4XZQA 5B1MC 1P3IC 3MVDD 2AROA 2Y2LA 5B32D 4XZQD 3MVDC 5B32C 2PYOB 1ID3A 2IO5B 1S32C 1M18A 2W8SA 3RELA 3O62A 1P3KC 3B6FA 1ID3D 5DNMA 3RELD 3O62D 5DNNB 3AZID 3B6FD 3AZLB 1HTAA 3WTPA 5DNMD 3EPLA 5B1LA 3AZJA 5AY8D 5B2JA 5AV8A 2YFWB 3H0MC 2LY8A 2BYKA 3VH6A 4H9RA 5B1LD 3WTPD 5KDMA 5B2JD 3KXBC 5AY8C 5AV8D 5AV9C 3KUYB 4JJNC 3LZ1A 4WU9B 4YS3B 1U35D 3WTPC 1F66C 5CPKA 1P3BB 5B0YB 1P3PB 1BH9A 5GSUD 3LZ1D 4R8PB 3UTAA 5CPKD 4J8VA 2VQRA 5GSUC 3UTAD 5BNVA 5JRGA 4J8VD 3AZGB 4H9NA 5B33C 2FFFB 5JRGD 2BYMA 4J8VC 3X1UA 4WV4B 4EO5B 5CPIA 3X1UD 3WAAB 5CPID 3B0CW 5F99B 3X1SC 5B0ZB 1U35A 3AZKA 4Z66C 5C3IB 1P3MA 3MVDB 5B32B 3AZKD 4XZQB 1TZYA 2AROB 2NQBC 4H9QB 3REKC 1TZYD 3WKJC 3LZ0A 4UUZA 1ID3B 3LZ0D 3O62B 3RELB 3B6FB 3AZIB 5DNMB 4WNNA 4DRAA 5AY8B 3MGSC 3WTPB 3B0DC 5B1LB 3AZJB 5B2JB 3UT9D 2ZY2A 5AV8B 3W99B 5GT0A 3REIA 4H9RB 1U35B 5KDMB 3UT9C 5GSUB 3LZ1B 4ZUXC 3REID 1P3OC 1EQZA 5CPKB 3KFUG 2HUEB 3VH6W 1EQZD 3UTAB 3REHA 2JCHA 3MGPC 4E45A 2ZY3A 4J8VB 5BO0B 5BNVB 5JRGB 3C1CC 3REHD 3C1BA 4H9NB 5JA4A 3AZFA 2HIOA 5GXQC 2BYMB 3B0CT 3X1UB 5CPIB 2HIOD 1WWSA 3LJAA 3AZKB 1HQ3A 2Y2IA 2NZDC 3AFAC 3LJAD 1HQ3D 4HGAC 1KX3A 1TZYB 1KX3D 4WU8C 3VH5T 5E5AA 2J8PA 3AZNA 3LZ0B 5E5AD 1P3GC 4UUZB 3AZND 3REJA 5FUGA 5CP6A 1BFMA 4WNNB 4H9SC 3REJD 1WWIA 2Y2PA 5B2IC 5CP6D 3UTBA 3UTBD 4YS3A 2Y2QA 3MNNC 3REIB 3AZMA 5B0YA 1EQZB
chains in the Genus database with same CATH topology
3AZMD 2L5AA 3REHB 3AZGA 3AV1D 4YM6A 4E44A 1M1AC 4UPKA 3W97C 4YM6D 3AV1C 5B31G 5JA4B 4X23A 2HIOB 3AZFB 2FJ7A 4KUDA 1KU5A 4YM6C 4X23D 2FJ7D 5B1MA 4KUDD 1P3IA 2G5IC 4HGAB 5B1MD 3W96C 1P3ID 2F8NG 4M6BA 3MVDA 4Z2MH 3LJAB 5B32A 1HQ3B 4G91C 4H9QA 1S32A 1KX3B 1P3KA 3X1TC 1P3LA 4AWLB 1S32D 1P3KD 5E5AB 3EG5B 1P3LD 4J8WD 3AZNB 3AZIA 4LD9A 3AL0C 1P3LC 2BG1A 3KXBA 4J8WC 3REJB 4JJNA 5AY8A 5FUGB 5AV9A 1P3AD 5CP6B 4LD9D 1B6WA 3KXBD 1F66A 4JJND 5AV9D 3UTBB 3H0RC 1P3AC 1F66D 5GSUA 5AV6D 3AZMB 3R45A 2YFVB 5B33A 3AZIC 3AV2C 3A6ND 5AV6C 2XD1A 3TU4C 5B33D 5BO0A 3EPKA 1ZLAC 3A6NC 4YM6B 5AVCC 1N1JA 3AN2D 3X1SA 4LD9C 4X23B 2FJ7B 4Z66A 4KUDB 3X1SD 3AN2C 3W99A 2Y2KA 4DRBA 5B1MB 4Z66D 4J8XC 1P3IB 1P3FC 2Y2HA 2NQBA 4QLCD 3REKA 2NQBD 2JSSA 5AV5D 3REKD 3WKJA 4QLCC 4DQYB 3AZHC 3LELD 3WKJD 3X1VC 5AV5C 5B40C 1B67A 1S32B 2F8NK 1P3KB 2XD5A 1ULYA 2ZY4A 1P3LB 2DQNC 1KX5C 3LELC 3MGSA 4ZBJC 3MGSD 2CV5D 1P3AB 4LD9B 3V9RA 3KXBB 4JJNB 5AV9B 3UT9A 2CV5C 4ZUXA 1P3OA 1F66B 2ZM5A 4Z5TC 4ZUXD 1P3OD 4J8UC 3MGPA 5BT1C 5B31D 3C1CA 3W98B 3MGPD 3A6NB 3EPHA 3MGQD 3R45B 5B33B 3C1CD 5B31C 2RIQA 5GXQA 3MGQC 5GXQD 3AN2B 3B0BA 1N1JB 3AZEC 3X1SB 4Z66B 2NZDA 5B24D 1P34C 3AYWC 3KWQD 3AFAA 2CWEA 4QLCB 3B6GC 2NZDD 1AOIC 5B24C 3AFAD 5AV5B 3KWQC 3REKB 2NQBB 4WU8A 3WTPE 3WKJB 4XUJC 4WU8D 1H3OA 1P3GA 4ZBJB 1TAFA 1P3GD 5CPJD 4WJ3C 5CHLB 4H9SA 3MGSB 2CV5B 5B2IA 5CPJC 3B0DB 5GT3C 5BS7C 1BH8B 5B2ID 3MNNA 3V9RB 3UT9B 3MNND 4ZUXB 1P3OB 5AVBD 1M19C 3A1KA 5B31B 4KGCC 3VH6T 5AVBC 3MGPB 3MGQB 2YFVA 3C1CB 3W97A 1M1AA 3AV1A 1W2EA 5GXQB 2RVQD 1M1AD 3W97D 4CAYA 2RVQC 3W96A 5B24B 2PYOC 3KWQB 2IO5C 5G49A 3W96D 2NZDB 3P5JB 3AFAB 3X1TA 5DNNC 3AZLC 2Y2JA 4WU8B 3X1TD 3MGRC 3W98C 1H3OB 4WU9C 1P3GB 5CPJB 3KUYC 4J8WA 1Z2CB 1TAFB 1P3BC 1P3PC 4NE6A 4R8PC 5B2IB 3MGRB 1P3AA 5BNXB 3MNNB 5AVBB 4H9OA 4CSRA 3IP4C 2ZY5A 3AV2A 4EO5C 5AV6A 4KHAA 4G92C 3TU4A 2DF4C 3WAAC 3AV2D 1ZLAA 3A6NA 5F99C 3TU4D 2F2AC 5AVCA 5B0ZC 1PZRA 3VH5A 1ZLAD 1M1AB 3W97B 5C3IC 2AROD 5AVCD 3AV1B 1T3UA 4XZQC 3AN2A 2AROC 4J8XA 4CAYB 3NQJA 1P3FA 2JE5A 4J8XD 1A7WA 1M18D 1P3FD 3W96B 1ID3C 5G49B 4QLCA 2UWXA 1M18C 3RELC 3O62C 3AZHA 3B6FC 4G91B 5AV5A 5B40A 5DNMC 3AZJD 3X1VA 3AZHD 3A1IA 3X1TB 3W99D 3X1VD 3LELA 5B40D 1KX5A 5B1LC 3AZJC 5B2JC 5AV8C 3W99C 1KX5D 1U35C 1F1EA 3F6TA 3LZ1C 4J8WB 5CPKC 2CV5A 3KSYA 2HUEC 1BH8A 3UTAC 4Z5TA 2F8NH 4J8UA 5JRGC 4G92B 4Z5TD 4J8UD 4H9OB 5BT1D 4CSRB 3X1UC 5B31A 3AV2B 5AV6B 4KHAB 5CPIC 3TU4B 3MGQA 1JFIA 1P3MD 1ZLAB 3H0LC 4NE3A 5AVCB 3AZEA 3AZKC 2F8NA 2Y2GA 1P3MC 3NQUA 3AZED 2F8ND 1P34A 3AYWA 1TZYC 1KX4A 4J8XB 3VH5W 3B6GA 3NQJB 2Y2NA 3EPJA 1P34D 4WZSB 3AYWD 5B24A 1P3FB 1M18B 1AOIA 3KWQA 1KX4D 3B6GD 5B32G 1AOID 3LZ0C 4XUJA 1KX4C 3AZHB 2BYKB 4NE5A 4XUJD 5B40B 3X1VB 5GT0D 1KX5B 3LELB 4H9PA 1BH9B 5CPJA 5GT3A 5BS7A 5GT0C 3REIC 4Z2MG 5GT3D 1EQZC 5BNXA 3WA9A 3REHC 3C1BD 4Z5TB 1M19A 3WA9D 3AZFD 4J8UB 5AVBA 4KGCA 1M19D 3C1BC 4KGCD 3WA9C 3AZFC 2HIOC 1P3MB 1JFIB 3LJAC 3AZEB 2F8NB 1HQ3C 2PYOA 3NQUB 1P34B 3AYWB 1KX3C 2PYOD 1KX4B 3B6GB 1R4VA 4AWLC 1AOIB 2Y2MA 5DNNA 5E5AC 3AZLA 2Y2OA 3AZNC 5DNND 2YFWA 3MGRA 4XUJB 3AZLD 3W98A 4WU9A 3REJC 3KUYA 5CP6C 5GT0B 3MGRD 3W98D 4WU9D 1P3BA 1P3PA 4YS3D 3KUYD 3UTBC 4H9PB 4R8PA 1P3BD 5B0YD 1P3PD 4YS3C 5GT3B 4R8PD 4NFTA 3AZMC 5B0YC 2G5HC 3C1BB 3AZGD 3WA9B 1Q9CA 1M19B 3AZGC 4KGCB 3WAAA 5F99A 5B0ZA 3WAAD 3FDDA 4X23C 5F99D 2FJ7C 4KUDC 5B0ZD 4XZQA 5B1MC 1P3IC 3MVDD 2AROA 2Y2LA 5B32D 4XZQD 3MVDC 5B32C 2PYOB 1ID3A 2IO5B 1S32C 1M18A 2W8SA 3RELA 3O62A 1P3KC 3B6FA 1ID3D 5DNMA 3RELD 3O62D 5DNNB 3AZID 3B6FD 3AZLB 1HTAA 3WTPA 5DNMD 3EPLA 5B1LA 3AZJA 5AY8D 5B2JA 5AV8A 2YFWB 3H0MC 2LY8A 2BYKA 3VH6A 4H9RA 5B1LD 3WTPD 5KDMA 5B2JD 3KXBC 5AY8C 5AV8D 5AV9C 3KUYB 4JJNC 3LZ1A 4WU9B 4YS3B 1U35D 3WTPC 1F66C 5CPKA 1P3BB 5B0YB 1P3PB 1BH9A 5GSUD 3LZ1D 4R8PB 3UTAA 5CPKD 4J8VA 2VQRA 5GSUC 3UTAD 5BNVA 5JRGA 4J8VD 3AZGB 4H9NA 5B33C 2FFFB 5JRGD 2BYMA 4J8VC 3X1UA 4WV4B 4EO5B 5CPIA 3X1UD 3WAAB 5CPID 3B0CW 5F99B 3X1SC 5B0ZB 1U35A 3AZKA 4Z66C 5C3IB 1P3MA 3MVDB 5B32B 3AZKD 4XZQB 1TZYA 2AROB 2NQBC 4H9QB 3REKC 1TZYD 3WKJC 3LZ0A 4UUZA 1ID3B 3LZ0D 3O62B 3RELB 3B6FB 3AZIB 5DNMB 4WNNA 4DRAA 5AY8B 3MGSC 3WTPB 3B0DC 5B1LB 3AZJB 5B2JB 3UT9D 2ZY2A 5AV8B 3W99B 5GT0A 3REIA 4H9RB 1U35B 5KDMB 3UT9C 5GSUB 3LZ1B 4ZUXC 3REID 1P3OC 1EQZA 5CPKB 3KFUG 2HUEB 3VH6W 1EQZD 3UTAB 3REHA 2JCHA 3MGPC 4E45A 2ZY3A 4J8VB 5BO0B 5BNVB 5JRGB 3C1CC 3REHD 3C1BA 4H9NB 5JA4A 3AZFA 2HIOA 5GXQC 2BYMB 3B0CT 3X1UB 5CPIB 2HIOD 1WWSA 3LJAA 3AZKB 1HQ3A 2Y2IA 2NZDC 3AFAC 3LJAD 1HQ3D 4HGAC 1KX3A 1TZYB 1KX3D 4WU8C 3VH5T 5E5AA 2J8PA 3AZNA 3LZ0B 5E5AD 1P3GC 4UUZB 3AZND 3REJA 5FUGA 5CP6A 1BFMA 4WNNB 4H9SC 3REJD 1WWIA 2Y2PA 5B2IC 5CP6D 3UTBA 3UTBD 4YS3A 2Y2QA 3MNNC 3REIB 3AZMA 5B0YA 1EQZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZM D;  2L5A A;  3REH B;  3AZG A;  3AV1 D;  4YM6 A;  4E44 A;  1M1A C;  3W97 C;  4YM6 D;  3AV1 C;  5B31 G;  5JA4 B;  4X23 A;  2HIO B;  3AZF B;  2FJ7 A;  4KUD A;  1KU5 A;  4YM6 C;  4X23 D;  2FJ7 D;  5B1M A;  4KUD D;  1P3I A;  4HGA B;  5B1M D;  3W96 C;  1P3I D;  2F8N G;  4M6B A;  3MVD A;  4Z2M H;  3LJA B;  5B32 A;  1HQ3 B;  4G91 C;  4H9Q A;  1S32 A;  1KX3 B;  1P3K A;  3X1T C;  1P3L A;  4AWL B;  1S32 D;  1P3K D;  5E5A B;  1P3L D;  4J8W D;  3AZN B;  3AZI A;  4LD9 A;  1P3L C;  4J8W C;  3KXB A;  4LD9 C;  3REJ B;  4JJN A;  5AY8 A;  5FUG B;  5AV9 A;  1P3A D;  5CP6 B;  4LD9 D;  1B6W A;  3KXB D;  1F66 A;  4JJN D;  5AV9 D;  3UTB B;  1P3A C;  1F66 D;  5GSU A;  5AV6 D;  3AZM B;  3R45 A;  2YFV B;  5B33 A;  3AZI C;  3AV2 C;  3A6N D;  5AV6 C;  3TU4 C;  5B33 D;  5BO0 A;  1ZLA C;  3A6N C;  4YM6 B;  5AVC C;  1N1J A;  3AN2 D;  3X1S A;  4X23 B;  2FJ7 B;  4Z66 A;  4KUD B;  3X1S D;  3AN2 C;  3W99 A;  4DRB A;  4J8X C;  5B1M B;  4Z66 D;  1P3I B;  1P3F C;  2NQB A;  4QLC D;  3REK A;  2NQB D;  2JSS A;  5AV5 D;  3REK D;  3WKJ A;  4QLC C;  3AZH C;  3LEL D;  3WKJ D;  3X1V C;  5AV5 C;  5B40 C;  1B67 A;  1S32 B;  2F8N K;  1P3K B;  1ULY A;  1P3L B;  1KX5 C;  3LEL C;  3MGS A;  4ZBJ C;  3MGS D;  2CV5 D;  1P3A B;  4LD9 B;  3V9R A;  3KXB B;  4JJN B;  5AV9 B;  3UT9 A;  2CV5 C;  4ZUX A;  1P3O A;  1F66 B;  4Z5T C;  4ZUX D;  1P3O D;  4J8U C;  3MGP A;  5BT1 C;  5B31 D;  3C1C A;  3W98 B;  3MGP D;  3A6N B;  3MGQ D;  3R45 B;  5B33 B;  3C1C D;  5B31 C;  5GXQ A;  3MGQ C;  5GXQ D;  3AN2 B;  3B0B A;  1N1J B;  3AZE C;  3X1S B;  4Z66 B;  2NZD A;  5B24 D;  1P34 C;  3AYW C;  3KWQ D;  3AFA A;  2CWE A;  4QLC B;  3B6G C;  2NZD D;  1AOI C;  5B24 C;  3AFA D;  5AV5 B;  3KWQ C;  3REK B;  2NQB B;  4WU8 A;  3WTP E;  3WKJ B;  4XUJ C;  4WU8 D;  1H3O A;  1P3G A;  4ZBJ B;  1TAF A;  1P3G D;  5CPJ D;  5CHL B;  4H9S A;  3MGS B;  2CV5 B;  5B2I A;  5CPJ C;  3B0D B;  5GT3 C;  5BS7 C;  1BH8 B;  5B2I D;  3MNN A;  3V9R B;  3UT9 B;  3MNN D;  4ZUX B;  1P3O B;  5AVB D;  1M19 C;  5B31 B;  4KGC C;  3VH6 T;  5AVB C;  3MGP B;  3MGQ B;  2YFV A;  3C1C B;  3W97 A;  1M1A A;  3AV1 A;  5GXQ B;  2RVQ D;  1M1A D;  3W97 D;  4CAY A;  2RVQ C;  3W96 A;  5B24 B;  2PYO C;  3KWQ B;  2IO5 C;  5G49 A;  3W96 D;  2NZD B;  3AFA B;  3X1T A;  5DNN C;  3AZL C;  4WU8 B;  3X1T D;  3MGR C;  3W98 C;  1H3O B;  4WU9 C;  1P3G B;  5CPJ B;  3KUY C;  4J8W A;  1TAF B;  1P3B C;  1P3P C;  4NE6 A;  4R8P C;  5B2I B;  1P3A A;  5BNX B;  3MNN B;  5AVB B;  4H9O A;  4CSR A;  3AV2 A;  4EO5 C;  5AV6 A;  4KHA A;  4G92 C;  3TU4 A;  3AV2 D;  3WAA C;  1ZLA A;  3A6N A;  5F99 C;  3TU4 D;  5AVC A;  5B0Z C;  3VH5 A;  1ZLA D;  1M1A B;  3W97 B;  5C3I C;  2ARO D;  5AVC D;  3AV1 B;  4XZQ C;  3AN2 A;  2ARO C;  4J8X A;  4CAY B;  3NQJ A;  1P3F A;  4J8X D;  1A7W A;  1M18 D;  1P3F D;  3W96 B;  1ID3 C;  5G49 B;  4QLC A;  1M18 C;  3REL C;  3O62 C;  3AZH A;  3B6F C;  4G91 B;  5AV5 A;  5B40 A;  5DNM C;  3AZJ D;  3X1V A;  3AZH D;  3X1T B;  3W99 D;  3X1V D;  3LEL A;  5B40 D;  1KX5 A;  5B1L C;  3AZJ C;  5B2J C;  5AV8 C;  3W99 C;  1KX5 D;  1U35 C;  1F1E A;  3LZ1 C;  4J8W B;  5CPK C;  2CV5 A;  3KSY A;  2HUE C;  1BH8 A;  3UTA C;  4Z5T A;  2F8N H;  4J8U A;  5JRG C;  4G92 B;  4Z5T D;  4J8U D;  4H9O B;  5BT1 D;  4CSR B;  3X1U C;  5B31 A;  3AV2 B;  5CPI C;  4KHA B;  5AV6 B;  3TU4 B;  3MGQ A;  1JFI A;  1P3M D;  1ZLA B;  4NE3 A;  5AVC B;  3AZE A;  3AZK C;  2F8N A;  1P3M C;  3NQU A;  3AZE D;  2F8N D;  1P34 A;  3AYW A;  1TZY C;  1KX4 A;  4J8X B;  3VH5 W;  3B6G A;  3NQJ B;  1M18 B;  1P3F B;  1P34 D;  4WZS B;  3AYW D;  5B24 A;  1AOI A;  3KWQ A;  1KX4 D;  3B6G D;  5B32 G;  1AOI D;  3LZ0 C;  4XUJ A;  1KX4 C;  3AZH B;  2BYK B;  4NE5 A;  4XUJ D;  5B40 B;  3X1V B;  5GT0 D;  1KX5 B;  3LEL B;  4H9P A;  1BH9 B;  5CPJ A;  5GT3 A;  5BS7 A;  5GT0 C;  3REI C;  4Z2M G;  5GT3 D;  1EQZ C;  5BNX A;  3WA9 A;  3REH C;  3C1B D;  4Z5T B;  1M19 A;  3WA9 D;  3AZF D;  4J8U B;  5AVB A;  4KGC A;  1M19 D;  3C1B C;  4KGC D;  3WA9 C;  3AZF C;  2HIO C;  1P3M B;  1JFI B;  3LJA C;  3AZE B;  2F8N B;  1HQ3 C;  2PYO A;  3NQU B;  1P34 B;  3AYW B;  1KX3 C;  2PYO D;  1KX4 B;  3B6G B;  1R4V A;  4AWL C;  1AOI B;  5DNN A;  5E5A C;  3AZL A;  3AZN C;  5DNN D;  2YFW A;  3MGR A;  4XUJ B;  3AZL D;  3W98 A;  4WU9 A;  3REJ C;  3KUY A;  5CP6 C;  5GT0 B;  3MGR D;  3W98 D;  4WU9 D;  1P3B A;  1P3P A;  4YS3 D;  3KUY D;  3UTB C;  4H9P B;  4R8P A;  1P3B D;  5B0Y D;  1P3P D;  4YS3 C;  5GT3 B;  4R8P D;  4NFT A;  3AZM C;  5B0Y C;  3C1B B;  3AZG D;  3WA9 B;  1Q9C A;  1M19 B;  3AZG C;  4KGC B;  3WAA A;  5F99 A;  5B0Z A;  3WAA D;  4X23 C;  2FJ7 C;  5F99 D;  4KUD C;  5B0Z D;  4XZQ A;  5B1M C;  1P3I C;  3MVD D;  2ARO A;  5B32 D;  4XZQ D;  3MVD C;  5B32 C;  2PYO B;  1ID3 A;  2IO5 B;  1S32 C;  1M18 A;  3REL A;  3O62 A;  1P3K C;  3B6F A;  1ID3 D;  5DNM A;  3REL D;  3O62 D;  5DNN B;  3AZI D;  3B6F D;  3AZL B;  1HTA A;  3WTP A;  5DNM D;  5B1L A;  3AZJ A;  5AY8 D;  5B2J A;  5AV8 A;  2YFW B;  3MGR B;  2LY8 A;  2BYK A;  3VH6 A;  4H9R A;  5B1L D;  3WTP D;  5KDM A;  5B2J D;  3KXB C;  5AY8 C;  5AV8 D;  5AV9 C;  3KUY B;  4JJN C;  3LZ1 A;  4WU9 B;  4YS3 B;  1U35 D;  3WTP C;  1F66 C;  5CPK A;  1P3B B;  5B0Y B;  1P3P B;  1BH9 A;  5GSU D;  3LZ1 D;  4R8P B;  3UTA A;  5CPK D;  4J8V A;  5GSU C;  3UTA D;  5BNV A;  5JRG A;  4J8V D;  3AZG B;  4H9N A;  5B33 C;  5JRG D;  2BYM A;  4J8V C;  3X1U A;  4WV4 B;  4EO5 B;  5CPI A;  3X1U D;  3WAA B;  5CPI D;  3B0C W;  5F99 B;  3X1S C;  5B0Z B;  1U35 A;  3AZK A;  4Z66 C;  5C3I B;  1P3M A;  3MVD B;  5B32 B;  3AZK D;  4XZQ B;  1TZY A;  2ARO B;  2NQB C;  4H9Q B;  3REK C;  1TZY D;  3WKJ C;  3LZ0 A;  4UUZ A;  1ID3 B;  3LZ0 D;  3O62 B;  3REL B;  3B6F B;  3AZI B;  5DNM B;  4WNN A;  4DRA A;  5AY8 B;  3MGS C;  3WTP B;  3B0D C;  5B1L B;  3AZJ B;  5B2J B;  3UT9 D;  5AV8 B;  3W99 B;  5GT0 A;  3REI A;  4H9R B;  1U35 B;  5KDM B;  3UT9 C;  5GSU B;  3LZ1 B;  4ZUX C;  3REI D;  1P3O C;  1EQZ A;  5CPK B;  2HUE B;  3VH6 W;  1EQZ D;  3UTA B;  3REH A;  3MGP C;  4E45 A;  4J8V B;  5BO0 B;  5BNV B;  5JRG B;  3C1C C;  3REH D;  3C1B A;  4H9N B;  5JA4 A;  3AZF A;  2HIO A;  5GXQ C;  2BYM B;  3B0C T;  3X1U B;  5CPI B;  2HIO D;  1WWS A;  3LJA A;  3AZK B;  1HQ3 A;  2NZD C;  3AFA C;  3LJA D;  1HQ3 D;  4HGA C;  1KX3 A;  1TZY B;  1KX3 D;  4WU8 C;  3VH5 T;  5E5A A;  3AZN A;  3LZ0 B;  5E5A D;  1P3G C;  4UUZ B;  3AZN D;  3REJ A;  5FUG A;  5CP6 A;  1BFM A;  4WNN B;  4H9S C;  3REJ D;  1WWI A;  5B2I C;  5CP6 D;  3UTB A;  3UTB D;  4YS3 A;  3MNN C;  3REI B;  3AZM A;  5B0Y A;  1EQZ B; 
#chains in the Genus database with same CATH topology
 3AZM D;  2L5A A;  3REH B;  3AZG A;  3AV1 D;  4YM6 A;  4E44 A;  1M1A C;  4UPK A;  3W97 C;  4YM6 D;  3AV1 C;  5B31 G;  5JA4 B;  4X23 A;  2HIO B;  3AZF B;  2FJ7 A;  4KUD A;  1KU5 A;  4YM6 C;  4X23 D;  2FJ7 D;  5B1M A;  4KUD D;  1P3I A;  2G5I C;  4HGA B;  5B1M D;  3W96 C;  1P3I D;  2F8N G;  4M6B A;  3MVD A;  4Z2M H;  3LJA B;  5B32 A;  1HQ3 B;  4G91 C;  4H9Q A;  1S32 A;  1KX3 B;  1P3K A;  3X1T C;  1P3L A;  4AWL B;  1S32 D;  1P3K D;  5E5A B;  3EG5 B;  1P3L D;  4J8W D;  3AZN B;  3AZI A;  4LD9 A;  3AL0 C;  1P3L C;  2BG1 A;  3KXB A;  4J8W C;  3REJ B;  4JJN A;  5AY8 A;  5FUG B;  5AV9 A;  1P3A D;  5CP6 B;  4LD9 D;  1B6W A;  3KXB D;  1F66 A;  4JJN D;  5AV9 D;  3UTB B;  3H0R C;  1P3A C;  1F66 D;  5GSU A;  5AV6 D;  3AZM B;  3R45 A;  2YFV B;  5B33 A;  3AZI C;  3AV2 C;  3A6N D;  5AV6 C;  2XD1 A;  3TU4 C;  5B33 D;  5BO0 A;  3EPK A;  1ZLA C;  3A6N C;  4YM6 B;  5AVC C;  1N1J A;  3AN2 D;  3X1S A;  4LD9 C;  4X23 B;  2FJ7 B;  4Z66 A;  4KUD B;  3X1S D;  3AN2 C;  3W99 A;  2Y2K A;  4DRB A;  5B1M B;  4Z66 D;  4J8X C;  1P3I B;  1P3F C;  2Y2H A;  2NQB A;  4QLC D;  3REK A;  2NQB D;  2JSS A;  5AV5 D;  3REK D;  3WKJ A;  4QLC C;  4DQY B;  3AZH C;  3LEL D;  3WKJ D;  3X1V C;  5AV5 C;  5B40 C;  1B67 A;  1S32 B;  2F8N K;  1P3K B;  2XD5 A;  1ULY A;  2ZY4 A;  1P3L B;  2DQN C;  1KX5 C;  3LEL C;  3MGS A;  4ZBJ C;  3MGS D;  2CV5 D;  1P3A B;  4LD9 B;  3V9R A;  3KXB B;  4JJN B;  5AV9 B;  3UT9 A;  2CV5 C;  4ZUX A;  1P3O A;  1F66 B;  2ZM5 A;  4Z5T C;  4ZUX D;  1P3O D;  4J8U C;  3MGP A;  5BT1 C;  5B31 D;  3C1C A;  3W98 B;  3MGP D;  3A6N B;  3EPH A;  3MGQ D;  3R45 B;  5B33 B;  3C1C D;  5B31 C;  2RIQ A;  5GXQ A;  3MGQ C;  5GXQ D;  3AN2 B;  3B0B A;  1N1J B;  3AZE C;  3X1S B;  4Z66 B;  2NZD A;  5B24 D;  1P34 C;  3AYW C;  3KWQ D;  3AFA A;  2CWE A;  4QLC B;  3B6G C;  2NZD D;  1AOI C;  5B24 C;  3AFA D;  5AV5 B;  3KWQ C;  3REK B;  2NQB B;  4WU8 A;  3WTP E;  3WKJ B;  4XUJ C;  4WU8 D;  1H3O A;  1P3G A;  4ZBJ B;  1TAF A;  1P3G D;  5CPJ D;  4WJ3 C;  5CHL B;  4H9S A;  3MGS B;  2CV5 B;  5B2I A;  5CPJ C;  3B0D B;  5GT3 C;  5BS7 C;  1BH8 B;  5B2I D;  3MNN A;  3V9R B;  3UT9 B;  3MNN D;  4ZUX B;  1P3O B;  5AVB D;  1M19 C;  3A1K A;  5B31 B;  4KGC C;  3VH6 T;  5AVB C;  3MGP B;  3MGQ B;  2YFV A;  3C1C B;  3W97 A;  1M1A A;  3AV1 A;  1W2E A;  5GXQ B;  2RVQ D;  1M1A D;  3W97 D;  4CAY A;  2RVQ C;  3W96 A;  5B24 B;  2PYO C;  3KWQ B;  2IO5 C;  5G49 A;  3W96 D;  2NZD B;  3P5J B;  3AFA B;  3X1T A;  5DNN C;  3AZL C;  2Y2J A;  4WU8 B;  3X1T D;  3MGR C;  3W98 C;  1H3O B;  4WU9 C;  1P3G B;  5CPJ B;  3KUY C;  4J8W A;  1Z2C B;  1TAF B;  1P3B C;  1P3P C;  4NE6 A;  4R8P C;  5B2I B;  3MGR B;  1P3A A;  5BNX B;  3MNN B;  5AVB B;  4H9O A;  4CSR A;  3IP4 C;  2ZY5 A;  3AV2 A;  4EO5 C;  5AV6 A;  4KHA A;  4G92 C;  3TU4 A;  2DF4 C;  3WAA C;  3AV2 D;  1ZLA A;  3A6N A;  5F99 C;  3TU4 D;  2F2A C;  5AVC A;  5B0Z C;  1PZR A;  3VH5 A;  1ZLA D;  1M1A B;  3W97 B;  5C3I C;  2ARO D;  5AVC D;  3AV1 B;  1T3U A;  4XZQ C;  3AN2 A;  2ARO C;  4J8X A;  4CAY B;  3NQJ A;  1P3F A;  2JE5 A;  4J8X D;  1A7W A;  1M18 D;  1P3F D;  3W96 B;  1ID3 C;  5G49 B;  4QLC A;  2UWX A;  1M18 C;  3REL C;  3O62 C;  3AZH A;  3B6F C;  4G91 B;  5AV5 A;  5B40 A;  5DNM C;  3AZJ D;  3X1V A;  3AZH D;  3A1I A;  3X1T B;  3W99 D;  3X1V D;  3LEL A;  5B40 D;  1KX5 A;  5B1L C;  3AZJ C;  5B2J C;  5AV8 C;  3W99 C;  1KX5 D;  1U35 C;  1F1E A;  3F6T A;  3LZ1 C;  4J8W B;  5CPK C;  2CV5 A;  3KSY A;  2HUE C;  1BH8 A;  3UTA C;  4Z5T A;  2F8N H;  4J8U A;  5JRG C;  4G92 B;  4Z5T D;  4J8U D;  4H9O B;  5BT1 D;  4CSR B;  3X1U C;  5B31 A;  3AV2 B;  5AV6 B;  4KHA B;  5CPI C;  3TU4 B;  3MGQ A;  1JFI A;  1P3M D;  1ZLA B;  3H0L C;  4NE3 A;  5AVC B;  3AZE A;  3AZK C;  2F8N A;  2Y2G A;  1P3M C;  3NQU A;  3AZE D;  2F8N D;  1P34 A;  3AYW A;  1TZY C;  1KX4 A;  4J8X B;  3VH5 W;  3B6G A;  3NQJ B;  2Y2N A;  3EPJ A;  1P34 D;  4WZS B;  3AYW D;  5B24 A;  1P3F B;  1M18 B;  1AOI A;  3KWQ A;  1KX4 D;  3B6G D;  5B32 G;  1AOI D;  3LZ0 C;  4XUJ A;  1KX4 C;  3AZH B;  2BYK B;  4NE5 A;  4XUJ D;  5B40 B;  3X1V B;  5GT0 D;  1KX5 B;  3LEL B;  4H9P A;  1BH9 B;  5CPJ A;  5GT3 A;  5BS7 A;  5GT0 C;  3REI C;  4Z2M G;  5GT3 D;  1EQZ C;  5BNX A;  3WA9 A;  3REH C;  3C1B D;  4Z5T B;  1M19 A;  3WA9 D;  3AZF D;  4J8U B;  5AVB A;  4KGC A;  1M19 D;  3C1B C;  4KGC D;  3WA9 C;  3AZF C;  2HIO C;  1P3M B;  1JFI B;  3LJA C;  3AZE B;  2F8N B;  1HQ3 C;  2PYO A;  3NQU B;  1P34 B;  3AYW B;  1KX3 C;  2PYO D;  1KX4 B;  3B6G B;  1R4V A;  4AWL C;  1AOI B;  2Y2M A;  5DNN A;  5E5A C;  3AZL A;  2Y2O A;  3AZN C;  5DNN D;  2YFW A;  3MGR A;  4XUJ B;  3AZL D;  3W98 A;  4WU9 A;  3REJ C;  3KUY A;  5CP6 C;  5GT0 B;  3MGR D;  3W98 D;  4WU9 D;  1P3B A;  1P3P A;  4YS3 D;  3KUY D;  3UTB C;  4H9P B;  4R8P A;  1P3B D;  5B0Y D;  1P3P D;  4YS3 C;  5GT3 B;  4R8P D;  4NFT A;  3AZM C;  5B0Y C;  2G5H C;  3C1B B;  3AZG D;  3WA9 B;  1Q9C A;  1M19 B;  3AZG C;  4KGC B;  3WAA A;  5F99 A;  5B0Z A;  3WAA D;  3FDD A;  4X23 C;  5F99 D;  2FJ7 C;  4KUD C;  5B0Z D;  4XZQ A;  5B1M C;  1P3I C;  3MVD D;  2ARO A;  2Y2L A;  5B32 D;  4XZQ D;  3MVD C;  5B32 C;  2PYO B;  1ID3 A;  2IO5 B;  1S32 C;  1M18 A;  2W8S A;  3REL A;  3O62 A;  1P3K C;  3B6F A;  1ID3 D;  5DNM A;  3REL D;  3O62 D;  5DNN B;  3AZI D;  3B6F D;  3AZL B;  1HTA A;  3WTP A;  5DNM D;  3EPL A;  5B1L A;  3AZJ A;  5AY8 D;  5B2J A;  5AV8 A;  2YFW B;  3H0M C;  2LY8 A;  2BYK A;  3VH6 A;  4H9R A;  5B1L D;  3WTP D;  5KDM A;  5B2J D;  3KXB C;  5AY8 C;  5AV8 D;  5AV9 C;  3KUY B;  4JJN C;  3LZ1 A;  4WU9 B;  4YS3 B;  1U35 D;  3WTP C;  1F66 C;  5CPK A;  1P3B B;  5B0Y B;  1P3P B;  1BH9 A;  5GSU D;  3LZ1 D;  4R8P B;  3UTA A;  5CPK D;  4J8V A;  2VQR A;  5GSU C;  3UTA D;  5BNV A;  5JRG A;  4J8V D;  3AZG B;  4H9N A;  5B33 C;  2FFF B;  5JRG D;  2BYM A;  4J8V C;  3X1U A;  4WV4 B;  4EO5 B;  5CPI A;  3X1U D;  3WAA B;  5CPI D;  3B0C W;  5F99 B;  3X1S C;  5B0Z B;  1U35 A;  3AZK A;  4Z66 C;  5C3I B;  1P3M A;  3MVD B;  5B32 B;  3AZK D;  4XZQ B;  1TZY A;  2ARO B;  2NQB C;  4H9Q B;  3REK C;  1TZY D;  3WKJ C;  3LZ0 A;  4UUZ A;  1ID3 B;  3LZ0 D;  3O62 B;  3REL B;  3B6F B;  3AZI B;  5DNM B;  4WNN A;  4DRA A;  5AY8 B;  3MGS C;  3WTP B;  3B0D C;  5B1L B;  3AZJ B;  5B2J B;  3UT9 D;  2ZY2 A;  5AV8 B;  3W99 B;  5GT0 A;  3REI A;  4H9R B;  1U35 B;  5KDM B;  3UT9 C;  5GSU B;  3LZ1 B;  4ZUX C;  3REI D;  1P3O C;  1EQZ A;  5CPK B;  3KFU G;  2HUE B;  3VH6 W;  1EQZ D;  3UTA B;  3REH A;  2JCH A;  3MGP C;  4E45 A;  2ZY3 A;  4J8V B;  5BO0 B;  5BNV B;  5JRG B;  3C1C C;  3REH D;  3C1B A;  4H9N B;  5JA4 A;  3AZF A;  2HIO A;  5GXQ C;  2BYM B;  3B0C T;  3X1U B;  5CPI B;  2HIO D;  1WWS A;  3LJA A;  3AZK B;  1HQ3 A;  2Y2I A;  2NZD C;  3AFA C;  3LJA D;  1HQ3 D;  4HGA C;  1KX3 A;  1TZY B;  1KX3 D;  4WU8 C;  3VH5 T;  5E5A A;  2J8P A;  3AZN A;  3LZ0 B;  5E5A D;  1P3G C;  4UUZ B;  3AZN D;  3REJ A;  5FUG A;  5CP6 A;  1BFM A;  4WNN B;  4H9S C;  3REJ D;  1WWI A;  2Y2P A;  5B2I C;  5CP6 D;  3UTB A;  3UTB D;  4YS3 A;  2Y2Q A;  3MNN C;  3REI B;  3AZM A;  5B0Y A;  1EQZ B; 
#chains in the Genus database with same CATH homology
 3AZM D;  2L5A A;  3REH B;  3AZG A;  3AV1 D;  4YM6 A;  4E44 A;  1M1A C;  4UPK A;  3W97 C;  4YM6 D;  3AV1 C;  5B31 G;  5JA4 B;  4X23 A;  2HIO B;  3AZF B;  2FJ7 A;  4KUD A;  1KU5 A;  4YM6 C;  4X23 D;  2FJ7 D;  5B1M A;  4KUD D;  1P3I A;  2G5I C;  4HGA B;  5B1M D;  3W96 C;  1P3I D;  2F8N G;  4M6B A;  3MVD A;  4Z2M H;  3LJA B;  5B32 A;  1HQ3 B;  4G91 C;  4H9Q A;  1S32 A;  1KX3 B;  1P3K A;  3X1T C;  1P3L A;  4AWL B;  1S32 D;  1P3K D;  5E5A B;  3EG5 B;  1P3L D;  4J8W D;  3AZN B;  3AZI A;  4LD9 A;  3AL0 C;  1P3L C;  2BG1 A;  3KXB A;  4J8W C;  3REJ B;  4JJN A;  5AY8 A;  5FUG B;  5AV9 A;  1P3A D;  5CP6 B;  4LD9 D;  1B6W A;  3KXB D;  1F66 A;  4JJN D;  5AV9 D;  3UTB B;  3H0R C;  1P3A C;  1F66 D;  5GSU A;  5AV6 D;  3AZM B;  3R45 A;  2YFV B;  5B33 A;  3AZI C;  3AV2 C;  3A6N D;  5AV6 C;  2XD1 A;  3TU4 C;  5B33 D;  5BO0 A;  3EPK A;  1ZLA C;  3A6N C;  4YM6 B;  5AVC C;  1N1J A;  3AN2 D;  3X1S A;  4LD9 C;  4X23 B;  2FJ7 B;  4Z66 A;  4KUD B;  3X1S D;  3AN2 C;  3W99 A;  2Y2K A;  4DRB A;  5B1M B;  4Z66 D;  4J8X C;  1P3I B;  1P3F C;  2Y2H A;  2NQB A;  4QLC D;  3REK A;  2NQB D;  2JSS A;  5AV5 D;  3REK D;  3WKJ A;  4QLC C;  4DQY B;  3AZH C;  3LEL D;  3WKJ D;  3X1V C;  5AV5 C;  5B40 C;  1B67 A;  1S32 B;  2F8N K;  1P3K B;  2XD5 A;  1ULY A;  2ZY4 A;  1P3L B;  2DQN C;  1KX5 C;  3LEL C;  3MGS A;  4ZBJ C;  3MGS D;  2CV5 D;  1P3A B;  4LD9 B;  3V9R A;  3KXB B;  4JJN B;  5AV9 B;  3UT9 A;  2CV5 C;  4ZUX A;  1P3O A;  1F66 B;  2ZM5 A;  4Z5T C;  4ZUX D;  1P3O D;  4J8U C;  3MGP A;  5BT1 C;  5B31 D;  3C1C A;  3W98 B;  3MGP D;  3A6N B;  3EPH A;  3MGQ D;  3R45 B;  5B33 B;  3C1C D;  5B31 C;  2RIQ A;  5GXQ A;  3MGQ C;  5GXQ D;  3AN2 B;  3B0B A;  1N1J B;  3AZE C;  3X1S B;  4Z66 B;  2NZD A;  5B24 D;  1P34 C;  3AYW C;  3KWQ D;  3AFA A;  2CWE A;  4QLC B;  3B6G C;  2NZD D;  1AOI C;  5B24 C;  3AFA D;  5AV5 B;  3KWQ C;  3REK B;  2NQB B;  4WU8 A;  3WTP E;  3WKJ B;  4XUJ C;  4WU8 D;  1H3O A;  1P3G A;  4ZBJ B;  1TAF A;  1P3G D;  5CPJ D;  4WJ3 C;  5CHL B;  4H9S A;  3MGS B;  2CV5 B;  5B2I A;  5CPJ C;  3B0D B;  5GT3 C;  5BS7 C;  1BH8 B;  5B2I D;  3MNN A;  3V9R B;  3UT9 B;  3MNN D;  4ZUX B;  1P3O B;  5AVB D;  1M19 C;  3A1K A;  5B31 B;  4KGC C;  3VH6 T;  5AVB C;  3MGP B;  3MGQ B;  2YFV A;  3C1C B;  3W97 A;  1M1A A;  3AV1 A;  1W2E A;  5GXQ B;  2RVQ D;  1M1A D;  3W97 D;  4CAY A;  2RVQ C;  3W96 A;  5B24 B;  2PYO C;  3KWQ B;  2IO5 C;  5G49 A;  3W96 D;  2NZD B;  3P5J B;  3AFA B;  3X1T A;  5DNN C;  3AZL C;  2Y2J A;  4WU8 B;  3X1T D;  3MGR C;  3W98 C;  1H3O B;  4WU9 C;  1P3G B;  5CPJ B;  3KUY C;  4J8W A;  1Z2C B;  1TAF B;  1P3B C;  1P3P C;  4NE6 A;  4R8P C;  5B2I B;  3MGR B;  1P3A A;  5BNX B;  3MNN B;  5AVB B;  4H9O A;  4CSR A;  3IP4 C;  2ZY5 A;  3AV2 A;  4EO5 C;  5AV6 A;  4KHA A;  4G92 C;  3TU4 A;  2DF4 C;  3WAA C;  3AV2 D;  1ZLA A;  3A6N A;  5F99 C;  3TU4 D;  2F2A C;  5AVC A;  5B0Z C;  1PZR A;  3VH5 A;  1ZLA D;  1M1A B;  3W97 B;  5C3I C;  2ARO D;  5AVC D;  3AV1 B;  1T3U A;  4XZQ C;  3AN2 A;  2ARO C;  4J8X A;  4CAY B;  3NQJ A;  1P3F A;  2JE5 A;  4J8X D;  1A7W A;  1M18 D;  1P3F D;  3W96 B;  1ID3 C;  5G49 B;  4QLC A;  2UWX A;  1M18 C;  3REL C;  3O62 C;  3AZH A;  3B6F C;  4G91 B;  5AV5 A;  5B40 A;  5DNM C;  3AZJ D;  3X1V A;  3AZH D;  3A1I A;  3X1T B;  3W99 D;  3X1V D;  3LEL A;  5B40 D;  1KX5 A;  5B1L C;  3AZJ C;  5B2J C;  5AV8 C;  3W99 C;  1KX5 D;  1U35 C;  1F1E A;  3F6T A;  3LZ1 C;  4J8W B;  5CPK C;  2CV5 A;  3KSY A;  2HUE C;  1BH8 A;  3UTA C;  4Z5T A;  2F8N H;  4J8U A;  5JRG C;  4G92 B;  4Z5T D;  4J8U D;  4H9O B;  5BT1 D;  4CSR B;  3X1U C;  5B31 A;  3AV2 B;  5AV6 B;  4KHA B;  5CPI C;  3TU4 B;  3MGQ A;  1JFI A;  1P3M D;  1ZLA B;  3H0L C;  4NE3 A;  5AVC B;  3AZE A;  3AZK C;  2F8N A;  2Y2G A;  1P3M C;  3NQU A;  3AZE D;  2F8N D;  1P34 A;  3AYW A;  1TZY C;  1KX4 A;  4J8X B;  3VH5 W;  3B6G A;  3NQJ B;  2Y2N A;  3EPJ A;  1P34 D;  4WZS B;  3AYW D;  5B24 A;  1P3F B;  1M18 B;  1AOI A;  3KWQ A;  1KX4 D;  3B6G D;  5B32 G;  1AOI D;  3LZ0 C;  4XUJ A;  1KX4 C;  3AZH B;  2BYK B;  4NE5 A;  4XUJ D;  5B40 B;  3X1V B;  5GT0 D;  1KX5 B;  3LEL B;  4H9P A;  1BH9 B;  5CPJ A;  5GT3 A;  5BS7 A;  5GT0 C;  3REI C;  4Z2M G;  5GT3 D;  1EQZ C;  5BNX A;  3WA9 A;  3REH C;  3C1B D;  4Z5T B;  1M19 A;  3WA9 D;  3AZF D;  4J8U B;  5AVB A;  4KGC A;  1M19 D;  3C1B C;  4KGC D;  3WA9 C;  3AZF C;  2HIO C;  1P3M B;  1JFI B;  3LJA C;  3AZE B;  2F8N B;  1HQ3 C;  2PYO A;  3NQU B;  1P34 B;  3AYW B;  1KX3 C;  2PYO D;  1KX4 B;  3B6G B;  1R4V A;  4AWL C;  1AOI B;  2Y2M A;  5DNN A;  5E5A C;  3AZL A;  2Y2O A;  3AZN C;  5DNN D;  2YFW A;  3MGR A;  4XUJ B;  3AZL D;  3W98 A;  4WU9 A;  3REJ C;  3KUY A;  5CP6 C;  5GT0 B;  3MGR D;  3W98 D;  4WU9 D;  1P3B A;  1P3P A;  4YS3 D;  3KUY D;  3UTB C;  4H9P B;  4R8P A;  1P3B D;  5B0Y D;  1P3P D;  4YS3 C;  5GT3 B;  4R8P D;  4NFT A;  3AZM C;  5B0Y C;  2G5H C;  3C1B B;  3AZG D;  3WA9 B;  1Q9C A;  1M19 B;  3AZG C;  4KGC B;  3WAA A;  5F99 A;  5B0Z A;  3WAA D;  3FDD A;  4X23 C;  5F99 D;  2FJ7 C;  4KUD C;  5B0Z D;  4XZQ A;  5B1M C;  1P3I C;  3MVD D;  2ARO A;  2Y2L A;  5B32 D;  4XZQ D;  3MVD C;  5B32 C;  2PYO B;  1ID3 A;  2IO5 B;  1S32 C;  1M18 A;  2W8S A;  3REL A;  3O62 A;  1P3K C;  3B6F A;  1ID3 D;  5DNM A;  3REL D;  3O62 D;  5DNN B;  3AZI D;  3B6F D;  3AZL B;  1HTA A;  3WTP A;  5DNM D;  3EPL A;  5B1L A;  3AZJ A;  5AY8 D;  5B2J A;  5AV8 A;  2YFW B;  3H0M C;  2LY8 A;  2BYK A;  3VH6 A;  4H9R A;  5B1L D;  3WTP D;  5KDM A;  5B2J D;  3KXB C;  5AY8 C;  5AV8 D;  5AV9 C;  3KUY B;  4JJN C;  3LZ1 A;  4WU9 B;  4YS3 B;  1U35 D;  3WTP C;  1F66 C;  5CPK A;  1P3B B;  5B0Y B;  1P3P B;  1BH9 A;  5GSU D;  3LZ1 D;  4R8P B;  3UTA A;  5CPK D;  4J8V A;  2VQR A;  5GSU C;  3UTA D;  5BNV A;  5JRG A;  4J8V D;  3AZG B;  4H9N A;  5B33 C;  2FFF B;  5JRG D;  2BYM A;  4J8V C;  3X1U A;  4WV4 B;  4EO5 B;  5CPI A;  3X1U D;  3WAA B;  5CPI D;  3B0C W;  5F99 B;  3X1S C;  5B0Z B;  1U35 A;  3AZK A;  4Z66 C;  5C3I B;  1P3M A;  3MVD B;  5B32 B;  3AZK D;  4XZQ B;  1TZY A;  2ARO B;  2NQB C;  4H9Q B;  3REK C;  1TZY D;  3WKJ C;  3LZ0 A;  4UUZ A;  1ID3 B;  3LZ0 D;  3O62 B;  3REL B;  3B6F B;  3AZI B;  5DNM B;  4WNN A;  4DRA A;  5AY8 B;  3MGS C;  3WTP B;  3B0D C;  5B1L B;  3AZJ B;  5B2J B;  3UT9 D;  2ZY2 A;  5AV8 B;  3W99 B;  5GT0 A;  3REI A;  4H9R B;  1U35 B;  5KDM B;  3UT9 C;  5GSU B;  3LZ1 B;  4ZUX C;  3REI D;  1P3O C;  1EQZ A;  5CPK B;  3KFU G;  2HUE B;  3VH6 W;  1EQZ D;  3UTA B;  3REH A;  2JCH A;  3MGP C;  4E45 A;  2ZY3 A;  4J8V B;  5BO0 B;  5BNV B;  5JRG B;  3C1C C;  3REH D;  3C1B A;  4H9N B;  5JA4 A;  3AZF A;  2HIO A;  5GXQ C;  2BYM B;  3B0C T;  3X1U B;  5CPI B;  2HIO D;  1WWS A;  3LJA A;  3AZK B;  1HQ3 A;  2Y2I A;  2NZD C;  3AFA C;  3LJA D;  1HQ3 D;  4HGA C;  1KX3 A;  1TZY B;  1KX3 D;  4WU8 C;  3VH5 T;  5E5A A;  2J8P A;  3AZN A;  3LZ0 B;  5E5A D;  1P3G C;  4UUZ B;  3AZN D;  3REJ A;  5FUG A;  5CP6 A;  1BFM A;  4WNN B;  4H9S C;  3REJ D;  1WWI A;  2Y2P A;  5B2I C;  5CP6 D;  3UTB A;  3UTB D;  4YS3 A;  2Y2Q A;  3MNN C;  3REI B;  3AZM A;  5B0Y A;  1EQZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...