3MGPC

Binding of cobalt ions to the nucleosome core particle
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
104
structure length
104
Chain Sequence
KTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Perturbations in nucleosome structure from heavy metal association.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 32
structure length 104
sequence length 104
chains with identical sequence G
ec nomenclature
pdb deposition date 2010-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3mgpC00
1F66C 5G49B 3VH6T 4XZQC 3VH6W 4CSRA 3X1VA 3WA9B 4WU9C 5FUGA 2PYOC 1TZYC 3AZIA 1KX5B 5B24B 5GT0C 5B32C 5BNVB 4H9OA 4Z5TB 1F66B 5CPJD 4XZQB 5AV6A 1KX4C 4WU9B 2PYOB 5B2IC 1TZYB 3W98A 4LD9C 3VH5T 5GT0B 3VH5W 5B32B 3WTPA 5B0ZD 5B1LC 4J8VC 4ZUXC 1P3BC 4WV4B 3X1UD 3LELD 4JJNC 5CP6D 3KSYA 1KX4B 5B2IB 5B40D 3LJAB 5E5AA 5B33C 2BYMB 5B1LB 4H9PB 4J8VB 1P3ID 1P3BB 3A6NC 3MGRC 1P3OA 4JJNB 5B0ZB 3REID 1U35C 3AZGC 5CPKA 5JA4B 1P3GA 1P3MD 5B33B 5JRGD 1P3FC 1P3AA 4AWLB 2CV5A 3B6FC 3AZMD 4QLCB 3MGRB 1P34C 5BS7A 1P3LC 1U35B 5AV5C 3AZGB 1P3IB 1JFIB 2NZDC 3AZED 4XUJD 5B0YD 5DNNA 3KWQA 5AVCC 3AN2D 3AYWA 1P3FB 5AVBD 3MGPC 3AV1C 5CPIC 3REHC 2L5AA 4R8PC 4H9RB 5B40A 1P3LB 3AZHA 5BO0A 1M18C 5AVCB 3AZKC 5B2JC 5GSUD 5GT3A 3AV1B 4YS3D 5F99A 5B0YB 4J8XD 5CPIB 3WAAA 4R8PB 3MVDD 3W99A 5AV8B 2YFVB 4Z2MH 4NE6A 3W97C 1M18B 3AZFA 2FJ7D 3AFAC 5KDMB 3AZKB 5B2JB 3AV2C 3KUYD 3REKD 3B0CT 5GXQA 5GSUB 4YS3B 1HQ3A 3UT9C 3UTAA 3W97B 1AOID 3O62C 3AFAB 4Z66A 3AV2B 4CAYA 1P3KC 3X1SA 3REKB 3UT9B 4H9NB 3O62B 4J8XA 3B0DC 1S32C 1BH8B 3X1TC 1N1JA 4E44A 3WTPE 1ZLAD 5B1MD 4KHAB 1P3KB 5B31C 3AZJD 3LZ0A 5BNXB 3C1CC 3LZ1A 3TU4A 1S32B 3R45A 4KUDC 3X1TB 4J8WC 1ID3C 3X1VD 3RELB 5B31B 4KGCD 1M1AC 5DNMA 3C1CB 4X23C 2NQBA 5AY8C 3AZLA 4KUDB 4J8WB 3REJA 1ID3B 5AV6D 3MGQC 1TAFB 3V9RA 3KXBC 4CSRB 3X1VB 1M1AB 2NZDA 3NQUA 4YM6A 3WTPD 1P3PA 1ZLAA 5FUGB 4X23B 3W98C 3AZIB 5AY8B 4UUZB 4WU8A 3B6GA 3MGQB 1EQZC 3UTBC 4H9QB 3KXBB 1KX3C 1WWIA 5E5AD 5AV9C 3W98B 3WKJA 1P3OD 4KGCA 1HTAA 4H9SA 1EQZB 3W96A 3MGSA 3UTBB 1M19A 5CPKD 1KX3B 1P3GD 5AV9B 5BT1D 1KU5A 1P3AD 2CV5D 5E5AB 2YFWA 5CPJC 3LJAC 2LY8A 4NE5A 3AZNA 5DNND 3KWQD 3C1BD 3AYWD 5B0ZC 2BYKA 1P3GB 3X1UC 3LELC 5CPJB 5CP6C 3AZHD 2HIOA 4AWLC 4QLCC 4J8UA 5GT3D 5F99D 1P3IC 1H3OB 3WAAD 3X1UB 3W99D 3AYWB 3LELB 5CP6B 3REIC 4ZUXD 3WA9A 1B67A 1KX5A 3MNNA 3AZFD 5BNVA 5B40B 1P3MC 5JRGC 4Z5TA 1F66A 3AZMC 4XZQA 5GXQD 5GT3B 3REIB 3C1BA 2PYOA 1HQ3D 3UTAD 4XUJC 5B0YC 3AZEC 5GT0A 5B32A 3AN2C 3W99B 1P3MB 5JRGB 5AVBC 5AV8C 4Z66D 2CWEA 3AZMB 1KX4A 3X1SD 5B2IA 3AZEB 4XUJB 4LD9A 5AV5D 3AN2B 1ULYA 5B1LA 5AVBB 5GSUC 2AROD 4J8VA 4ZUXA 4YS3C 4J8XC 1P3BA 3MVDC 4JJNA 3LZ0D 2FJ7C 3LZ1D 3TU4D 5B33A 3B0CW 4J8XB 3A6NA 3MGRA 4WNNB 3KUYC 3REKC 3MVDB 1U35A 1JFIA 3AZGA 5DNMD 2RVQD 1AOIC 1BFMA 1WWSA 2FJ7B 2NQBD 3AZLD 3B6FA 3REJD 1P34A 5B32G 3KUYB 3TU4B 1P3LA 3R45B 5AV5A 2F8ND 2NZDD 4YM6D 2AROA 1AOIB 5AVCA 1P3PD 3RELC 3MGPA 3AV1A 4WU8D 3B6GD 3REHA 4R8PA 5B1MC 1M18A 3AZJC 3NQJB 5KDMA 3AZKA 5B2JA 3WKJD 1Q9CA 4NFTA 3X1VC 1ZLAB 5B1MB 3W96D 3MGSD 2JSSA 4WU8B 3B6GB 1M19D 4KGCC 3AZIC 3W97A 3B0BA 3AZJB 3AFAA 1F1EA 4NE3A 3AV2A 2F8NA 5AV6C 2HUEC 3AZND 4KGCB 3UT9A 4H9NA 3O62A 4H9OB 3WTPC 3MGSB 1BH8A 4G91C 4DRBA 5CHLB 5AV6B 2HUEB 4KHAA 1P3KA 2HIOD 5E5AC 4J8UD 5BNXA 3WTPB 1S32A 4G91B 3X1TA 1P3OC 4Z2MG 3WA9D 5B31A 1KX5D 3MNND 5B24D 5CPKC 1P3GC 3C1CA 1BH9A 1R4VA 4Z5TD 5BT1C 1P3AC 1F66D 4KUDA 2CV5C 1P3OB 4J8WA 5BS7C 4XZQD 1ID3A 4EO5B 1TAFA 4WU9D 2PYOD 1TZYD 2F8NG 5CPKB 5GT0D 5DNNC 5B32D 3KWQC 3C1BC 1M1AA 3AYWC 4X23A 1P3AB 3MNNB 5AY8A 4UUZA 2CV5B 3MGQA 5B40C 3AZHC 1KX4D 5B2ID 4H9QA 4DRAA 4E45A 3KXBA 3LJAD 4LD9D 5DNNB 3KWQB 3C1BB 5G49A 5B1LD 5GT3C 4J8VD 5F99C 3WAAC 1P3BD 4JJND 3W99C 5B24A 3AZHB 1EQZA 5BO0B 3UTBA 2F8NK 1KX3A 3AZFC 5AV9A 5B33D 5B31G 5F99B 1A7WA 4M6BA 4QLCD 3A6ND 3VH6A 3MGRD 4WU9A 3WAAB 1TZYA 4LD9B 1U35D 5GXQC 3AZGD 4ZUXB 1HQ3C 3UTAC 3AZFB 5C3IC 1P3FD 4Z66C 3B6FD 1P34D 5CPJA 3LJAA 1P3LD 5GXQB 3A6NB 2BYMA 3X1SC 1HQ3B 4H9PA 3VH5A 3UTAB 5AVCD 5C3IB 5B0ZA 3MGPD 4Z66B 3AV1D 2AROC 1H3OA 3REHD 5CPID 4R8PD 3X1UA 4CAYB 5AV8D 3LELA 5CP6A 5JA4A 3B6FB 1P34B 3X1SB 1M18D 3LZ0C 5AV5B 4QLCA 3LZ1C 3TU4C 3AZKD 5B2JD 1P3IA 2AROB 1N1JB 3MGPB 3REIA 3REHB 1P3FA 3W97D 5DNMC 2RVQC 3LZ0B 1P3MA 4H9RA 4HGAC 4WZSB 5JRGA 3LZ1B 3AFAD 2NQBC 3AZLC 3AV2D 3REJC 3AZMA 3UT9D 3AZEA 4XUJA 5B0YA 4YM6C 3O62D 5DNMB 3AN2A 5CPIA 1P3PC 1ZLAC 4HGAB 5AV8A 2YFVA 5AVBA 2NQBB 3AZLB 4WU8C 3B6GC 3REJB 2F8NH 1P3KD 2F8NB 3V9RB 2NZDB 3NQUB 4YM6B 1P3PB 1S32D 3WKJC 5GSUA 3X1TD 4YS3A 4WNNA 3MVDA 3RELD 4H9SC 3W96C 3MGSC 5B31D 1M19C 2FJ7A 3C1CD 4KUDD 3WKJB 4J8WD 1ID3D 3KUYA 3B0DB 3REKA 3W96B 1M19B 3AZNC 1M1AD 1AOIA 1B6WA 4X23D 4G92C 3AZID 5AY8D 2YFWB 4ZBJC 1BH9B 3MGQD 2HIOC 3KXBD 3AZNB 2IO5C 4J8UC 3NQJA 2BYKB 4G92B 4EO5C 3RELA 3W98D 4ZBJB 5B1MA 1EQZD 3WA9C 3UTBD 2HIOB 1KX5C 3MNNC 5B24C 1KX3D 2IO5B 5AV9D 4J8UB 3AZJA 4Z5TC
chains in the Genus database with same CATH superfamily
1F66C 3H0RC 5G49B 3VH6T 4XZQC 3VH6W 4CSRA 3X1VA 2JCHA 3WA9B 4WU9C 5FUGA 2PYOC 1TZYC 3AZIA 1KX5B 5B24B 5GT0C 5B32C 5BNVB 4H9OA 4Z5TB 1F66B 5CPJD 4DQYB 4XZQB 5AV6A 1KX4C 4WU9B 2PYOB 5B2IC 1TZYB 3W98A 4LD9C 3VH5T 5GT0B 3VH5W 5B32B 3WTPA 5B0ZD 2ZY3A 5B1LC 2ZM5A 2Y2LA 4J8VC 4ZUXC 3EPLA 1P3BC 4WV4B 3X1UD 3LELD 4JJNC 5CP6D 3KSYA 1KX4B 5B2IB 5B40D 3LJAB 3AL0C 5E5AA 5B33C 2BYMB 5B1LB 4H9PB 4J8VB 1P3ID 1P3BB 3A6NC 3MGRC 1P3OA 4JJNB 5B0ZB 3REID 1U35C 3AZGC 5CPKA 5JA4B 1P3GA 1P3MD 3F6TA 5B33B 5JRGD 1P3FC 1P3AA 4AWLB 2CV5A 3B6FC 3AZMD 4QLCB 3MGRB 1P34C 5BS7A 1P3LC 1U35B 5AV5C 3AZGB 1P3IB 1JFIB 2XD1A 2NZDC 3AZED 4XUJD 5B0YD 5DNNA 3KWQA 5AVCC 3AN2D 3AYWA 1P3FB 5AVBD 3MGPC 3AV1C 5CPIC 3REHC 2L5AA 4R8PC 4H9RB 5B40A 1P3LB 3AZHA 5BO0A 1M18C 5AVCB 3AZKC 5B2JC 5GSUD 5GT3A 3AV1B 5F99A 5B0YB 4YS3D 4J8XD 5CPIB 3WAAA 4R8PB 3MVDD 3W99A 5AV8B 2YFVB 4Z2MH 4NE6A 3W97C 1M18B 3AZFA 2FJ7D 3AFAC 5KDMB 3AZKB 5B2JB 3AV2C 3KUYD 3REKD 3B0CT 5GXQA 5GSUB 4YS3B 1HQ3A 3UT9C 3UTAA 3W97B 1AOID 3O62C 3AFAB 4Z66A 3AV2B 4CAYA 1P3KC 3X1SA 3REKB 3UT9B 4H9NB 3O62B 4J8XA 3B0DC 1S32C 1BH8B 3X1TC 1N1JA 2Y2IA 4E44A 3WTPE 1ZLAD 5B1MD 4KHAB 1P3KB 5B31C 2G5IC 3AZJD 3LZ0A 5BNXB 3C1CC 3LZ1A 3TU4A 1S32B 2DF4C 3R45A 4KUDC 3X1TB 4J8WC 1ID3C 3X1VD 2Y2JA 3RELB 3H0LC 5B31B 4KGCD 1M1AC 5DNMA 1W2EA 3C1CB 2Y2OA 4X23C 2NQBA 5AY8C 3AZLA 4KUDB 4J8WB 3REJA 1ID3B 5AV6D 3MGQC 1TAFB 3V9RA 3KXBC 4CSRB 3X1VB 1M1AB 2NZDA 3NQUA 4YM6A 3WTPD 1P3PA 1ZLAA 5FUGB 4X23B 3W98C 3AZIB 5AY8B 4UUZB 4WU8A 3B6GA 3MGQB 1EQZC 3UTBC 4H9QB 3KXBB 1KX3C 1WWIA 3H0MC 5E5AD 5AV9C 3W98B 3WKJA 1P3OD 4KGCA 1HTAA 4H9SA 1EQZB 3W96A 3MGSA 3UTBB 1M19A 5CPKD 1KX3B 1P3GD 5AV9B 5BT1D 1KU5A 1P3AD 2CV5D 5E5AB 2YFWA 5CPJC 3LJAC 2LY8A 4NE5A 3AZNA 5DNND 3KWQD 3C1BD 3AYWD 1PZRA 5B0ZC 2BYKA 1P3GB 3X1UC 3LELC 5CPJB 5CP6C 3AZHD 2HIOA 4AWLC 4QLCC 4J8UA 3EPJA 5GT3D 5F99D 1P3IC 1H3OB 3WAAD 3X1UB 3W99D 3AYWB 3LELB 5CP6B 3REIC 4ZUXD 3WA9A 1B67A 1KX5A 3MNNA 3AZFD 5BNVA 5B40B 1P3MC 5JRGC 4Z5TA 1F66A 3AZMC 4XZQA 5GXQD 5GT3B 3REIB 3C1BA 2PYOA 1HQ3D 3UTAD 4XUJC 5B0YC 3AZEC 5GT0A 5B32A 3AN2C 3W99B 1P3MB 5JRGB 5AVBC 5AV8C 4Z66D 2CWEA 3AZMB 4WJ3C 2FFFB 1KX4A 3X1SD 5B2IA 3AZEB 4XUJB 4LD9A 5AV5D 3AN2B 1ULYA 3EPKA 5B1LA 5AVBB 5GSUC 2AROD 4J8VA 4ZUXA 4YS3C 4J8XC 1P3BA 3MVDC 4JJNA 2DQNC 2BG1A 3LZ0D 2FJ7C 3LZ1D 3TU4D 5B33A 3B0CW 4J8XB 3A6NA 3MGRA 4WNNB 3KUYC 3REKC 3MVDB 1U35A 1JFIA 3AZGA 5DNMD 2RVQD 1AOIC 1BFMA 1WWSA 2FJ7B 2NQBD 3AZLD 3B6FA 3REJD 1P34A 5B32G 3KUYB 3TU4B 1P3LA 3R45B 5AV5A 2F8ND 2NZDD 2AROA 4YM6D 2Y2NA 5AVCA 1P3PD 1AOIB 2Y2GA 3RELC 3MGPA 3AV1A 4WU8D 3B6GD 3REHA 4R8PA 5B1MC 1M18A 3AZJC 2Y2PA 3NQJB 5KDMA 3AZKA 5B2JA 3WKJD 1Q9CA 4NFTA 3X1VC 1ZLAB 5B1MB 3W96D 3MGSD 2JSSA 4WU8B 3B6GB 1M19D 4KGCC 3AZIC 3W97A 3B0BA 3AZJB 3AFAA 1F1EA 4NE3A 3AV2A 2F8NA 5AV6C 2HUEC 3AZND 4KGCB 3UT9A 2J8PA 4H9NA 3O62A 4H9OB 3WTPC 3MGSB 1BH8A 4G91C 4DRBA 5CHLB 5AV6B 2HUEB 4KHAA 1P3KA 2HIOD 2RIQA 5E5AC 4J8UD 5BNXA 3WTPB 1S32A 2XD5A 4G91B 3X1TA 1P3OC 4Z2MG 3WA9D 5B31A 1KX5D 3MNND 5B24D 5CPKC 1P3GC 3C1CA 1BH9A 1R4VA 4Z5TD 5BT1C 1P3AC 1F66D 4KUDA 2CV5C 3FDDA 1P3OB 4J8WA 5BS7C 4XZQD 1ID3A 4EO5B 1TAFA 4WU9D 2PYOD 1TZYD 2F8NG 5CPKB 5GT0D 5DNNC 5B32D 3KWQC 3C1BC 1M1AA 3AYWC 4X23A 3P5JB 1P3AB 3MNNB 3KFUG 5AY8A 4UUZA 2CV5B 3EG5B 3MGQA 5B40C 3AZHC 1KX4D 5B2ID 2JE5A 4H9QA 4DRAA 4E45A 3KXBA 3LJAD 4LD9D 5DNNB 3KWQB 3EPHA 3C1BB 5G49A 5B1LD 5GT3C 4J8VD 5F99C 2Y2KA 3WAAC 1P3BD 4JJND 3W99C 5B24A 3AZHB 1EQZA 5BO0B 3UTBA 2F8NK 1KX3A 3AZFC 5AV9A 5B33D 5B31G 5F99B 1A7WA 4M6BA 4QLCD 3A6ND 3VH6A 3MGRD 4WU9A 3WAAB 1TZYA 4LD9B 1U35D 2VQRA 5GXQC 3AZGD 4ZUXB 2ZY5A 1HQ3C 3UTAC 3AZFB 5C3IC 2F2AC 1P3FD 4Z66C 3B6FD 1P34D 2G5HC 5CPJA 3LJAA 1P3LD 5GXQB 2Y2HA 3A6NB 2BYMA 3X1SC 1HQ3B 4H9PA 3VH5A 3UTAB 5AVCD 5C3IB 2Y2QA 5B0ZA 4Z66B 3MGPD 3AV1D 2AROC 1H3OA 2Y2MA 3REHD 5CPID 4R8PD 3X1UA 4CAYB 5AV8D 4UPKA 5CP6A 3LELA 5JA4A 3B6FB 1P34B 3X1SB 1M18D 3LZ0C 5AV5B 4QLCA 3LZ1C 1T3UA 3TU4C 3AZKD 5B2JD 1P3IA 2AROB 1N1JB 3A1KA 3MGPB 3REIA 3REHB 1P3FA 3W97D 5DNMC 2RVQC 3LZ0B 1P3MA 4H9RA 4HGAC 4WZSB 5JRGA 3LZ1B 3AFAD 2NQBC 3AZLC 3AV2D 3REJC 3AZMA 3A1IA 3UT9D 3AZEA 4XUJA 5B0YA 4YM6C 3O62D 5DNMB 3AN2A 5CPIA 1P3PC 1ZLAC 4HGAB 5AV8A 2YFVA 5AVBA 2NQBB 3AZLB 4WU8C 3B6GC 3REJB 2F8NH 1P3KD 2F8NB 3V9RB 2ZY4A 2NZDB 3NQUB 4YM6B 1P3PB 1S32D 3WKJC 1Z2CB 5GSUA 3X1TD 4YS3A 4WNNA 3MVDA 3RELD 4H9SC 3W96C 3MGSC 5B31D 1M19C 2FJ7A 3C1CD 2UWXA 4KUDD 3WKJB 2W8SA 4J8WD 1ID3D 3KUYA 3B0DB 3REKA 3W96B 1M19B 3AZNC 1M1AD 1AOIA 1B6WA 4X23D 4G92C 3AZID 5AY8D 2YFWB 4ZBJC 1BH9B 3MGQD 2HIOC 3KXBD 3AZNB 2IO5C 3IP4C 4J8UC 3NQJA 2BYKB 4G92B 4EO5C 3RELA 3W98D 2ZY2A 4ZBJB 5B1MA 1EQZD 3WA9C 3UTBD 2HIOB 1KX5C 3MNNC 5B24C 1KX3D 2IO5B 5AV9D 4J8UB 3AZJA 4Z5TC
chains in the Genus database with same CATH topology
1F66C 3H0RC 5G49B 3VH6T 4XZQC 3VH6W 4CSRA 3X1VA 2JCHA 3WA9B 4WU9C 5FUGA 2PYOC 1TZYC 3AZIA 1KX5B 5B24B 5GT0C 5B32C 5BNVB 4H9OA 4Z5TB 1F66B 5CPJD 4DQYB 4XZQB 5AV6A 1KX4C 4WU9B 2PYOB 5B2IC 1TZYB 3W98A 4LD9C 3VH5T 5GT0B 3VH5W 5B32B 3WTPA 5B0ZD 2ZY3A 5B1LC 2ZM5A 2Y2LA 4J8VC 4ZUXC 3EPLA 1P3BC 4WV4B 3X1UD 3LELD 4JJNC 5CP6D 3KSYA 1KX4B 5B2IB 5B40D 3LJAB 3AL0C 5E5AA 5B33C 2BYMB 5B1LB 4H9PB 4J8VB 1P3ID 1P3BB 3A6NC 3MGRC 1P3OA 4JJNB 5B0ZB 3REID 1U35C 3AZGC 5CPKA 5JA4B 1P3GA 1P3MD 3F6TA 5B33B 5JRGD 1P3FC 1P3AA 4AWLB 2CV5A 3B6FC 3AZMD 4QLCB 3MGRB 1P34C 5BS7A 1P3LC 1U35B 5AV5C 3AZGB 1P3IB 1JFIB 2XD1A 2NZDC 3AZED 4XUJD 5B0YD 5DNNA 3KWQA 5AVCC 3AN2D 3AYWA 1P3FB 5AVBD 3MGPC 3AV1C 5CPIC 3REHC 2L5AA 4R8PC 4H9RB 5B40A 1P3LB 3AZHA 5BO0A 1M18C 5AVCB 3AZKC 5B2JC 5GSUD 5GT3A 3AV1B 5F99A 5B0YB 4YS3D 4J8XD 5CPIB 3WAAA 4R8PB 3MVDD 3W99A 5AV8B 2YFVB 4Z2MH 4NE6A 3W97C 1M18B 3AZFA 2FJ7D 3AFAC 5KDMB 3AZKB 5B2JB 3AV2C 3KUYD 3REKD 3B0CT 5GXQA 5GSUB 4YS3B 1HQ3A 3UT9C 3UTAA 3W97B 1AOID 3O62C 3AFAB 4Z66A 3AV2B 4CAYA 1P3KC 3X1SA 3REKB 3UT9B 4H9NB 3O62B 4J8XA 3B0DC 1S32C 1BH8B 3X1TC 1N1JA 2Y2IA 4E44A 3WTPE 1ZLAD 5B1MD 4KHAB 1P3KB 5B31C 2G5IC 3AZJD 3LZ0A 5BNXB 3C1CC 3LZ1A 3TU4A 1S32B 2DF4C 3R45A 4KUDC 3X1TB 4J8WC 1ID3C 3X1VD 2Y2JA 3RELB 3H0LC 5B31B 4KGCD 1M1AC 5DNMA 1W2EA 3C1CB 2Y2OA 4X23C 2NQBA 5AY8C 3AZLA 4KUDB 4J8WB 3REJA 1ID3B 5AV6D 3MGQC 1TAFB 3V9RA 3KXBC 4CSRB 3X1VB 1M1AB 2NZDA 3NQUA 4YM6A 3WTPD 1P3PA 1ZLAA 5FUGB 4X23B 3W98C 3AZIB 5AY8B 4UUZB 4WU8A 3B6GA 3MGQB 1EQZC 3UTBC 4H9QB 3KXBB 1KX3C 1WWIA 3H0MC 5E5AD 5AV9C 3W98B 3WKJA 1P3OD 4KGCA 1HTAA 4H9SA 1EQZB 3W96A 3MGSA 3UTBB 1M19A 5CPKD 1KX3B 1P3GD 5AV9B 5BT1D 1KU5A 1P3AD 2CV5D 5E5AB 2YFWA 5CPJC 3LJAC 2LY8A 4NE5A 3AZNA 5DNND 3KWQD 3C1BD 3AYWD 1PZRA 5B0ZC 2BYKA 1P3GB 3X1UC 3LELC 5CPJB 5CP6C 3AZHD 2HIOA 4AWLC 4QLCC 4J8UA 3EPJA 5GT3D 5F99D 1P3IC 1H3OB 3WAAD 3X1UB 3W99D 3AYWB 3LELB 5CP6B 3REIC 4ZUXD 3WA9A 1B67A 1KX5A 3MNNA 3AZFD 5BNVA 5B40B 1P3MC 5JRGC 4Z5TA 1F66A 3AZMC 4XZQA 5GXQD 5GT3B 3REIB 3C1BA 2PYOA 1HQ3D 3UTAD 4XUJC 5B0YC 3AZEC 5GT0A 5B32A 3AN2C 3W99B 1P3MB 5JRGB 5AVBC 5AV8C 4Z66D 2CWEA 3AZMB 4WJ3C 2FFFB 1KX4A 3X1SD 5B2IA 3AZEB 4XUJB 4LD9A 5AV5D 3AN2B 1ULYA 3EPKA 5B1LA 5AVBB 5GSUC 2AROD 4J8VA 4ZUXA 4YS3C 4J8XC 1P3BA 3MVDC 4JJNA 2DQNC 2BG1A 3LZ0D 2FJ7C 3LZ1D 3TU4D 5B33A 3B0CW 4J8XB 3A6NA 3MGRA 4WNNB 3KUYC 3REKC 3MVDB 1U35A 1JFIA 3AZGA 5DNMD 2RVQD 1AOIC 1BFMA 1WWSA 2FJ7B 2NQBD 3AZLD 3B6FA 3REJD 1P34A 5B32G 3KUYB 3TU4B 1P3LA 3R45B 5AV5A 2F8ND 2NZDD 2AROA 4YM6D 2Y2NA 5AVCA 1P3PD 1AOIB 2Y2GA 3RELC 3MGPA 3AV1A 4WU8D 3B6GD 3REHA 4R8PA 5B1MC 1M18A 3AZJC 2Y2PA 3NQJB 5KDMA 3AZKA 5B2JA 3WKJD 1Q9CA 4NFTA 3X1VC 1ZLAB 5B1MB 3W96D 3MGSD 2JSSA 4WU8B 3B6GB 1M19D 4KGCC 3AZIC 3W97A 3B0BA 3AZJB 3AFAA 1F1EA 4NE3A 3AV2A 2F8NA 5AV6C 2HUEC 3AZND 4KGCB 3UT9A 2J8PA 4H9NA 3O62A 4H9OB 3WTPC 3MGSB 1BH8A 4G91C 4DRBA 5CHLB 5AV6B 2HUEB 4KHAA 1P3KA 2HIOD 2RIQA 5E5AC 4J8UD 5BNXA 3WTPB 1S32A 2XD5A 4G91B 3X1TA 1P3OC 4Z2MG 3WA9D 5B31A 1KX5D 3MNND 5B24D 5CPKC 1P3GC 3C1CA 1BH9A 1R4VA 4Z5TD 5BT1C 1P3AC 1F66D 4KUDA 2CV5C 3FDDA 1P3OB 4J8WA 5BS7C 4XZQD 1ID3A 4EO5B 1TAFA 4WU9D 2PYOD 1TZYD 2F8NG 5CPKB 5GT0D 5DNNC 5B32D 3KWQC 3C1BC 1M1AA 3AYWC 4X23A 3P5JB 1P3AB 3MNNB 3KFUG 5AY8A 4UUZA 2CV5B 3EG5B 3MGQA 5B40C 3AZHC 1KX4D 5B2ID 2JE5A 4H9QA 4DRAA 4E45A 3KXBA 3LJAD 4LD9D 5DNNB 3KWQB 3EPHA 3C1BB 5G49A 5B1LD 5GT3C 4J8VD 5F99C 2Y2KA 3WAAC 1P3BD 4JJND 3W99C 5B24A 3AZHB 1EQZA 5BO0B 3UTBA 2F8NK 1KX3A 3AZFC 5AV9A 5B33D 5B31G 5F99B 1A7WA 4M6BA 4QLCD 3A6ND 3VH6A 3MGRD 4WU9A 3WAAB 1TZYA 4LD9B 1U35D 2VQRA 5GXQC 3AZGD 4ZUXB 2ZY5A 1HQ3C 3UTAC 3AZFB 5C3IC 2F2AC 1P3FD 4Z66C 3B6FD 1P34D 2G5HC 5CPJA 3LJAA 1P3LD 5GXQB 2Y2HA 3A6NB 2BYMA 3X1SC 1HQ3B 4H9PA 3VH5A 3UTAB 5AVCD 5C3IB 2Y2QA 5B0ZA 4Z66B 3MGPD 3AV1D 2AROC 1H3OA 2Y2MA 3REHD 5CPID 4R8PD 3X1UA 4CAYB 5AV8D 4UPKA 5CP6A 3LELA 5JA4A 3B6FB 1P34B 3X1SB 1M18D 3LZ0C 5AV5B 4QLCA 3LZ1C 1T3UA 3TU4C 3AZKD 5B2JD 1P3IA 2AROB 1N1JB 3A1KA 3MGPB 3REIA 3REHB 1P3FA 3W97D 5DNMC 2RVQC 3LZ0B 1P3MA 4H9RA 4HGAC 4WZSB 5JRGA 3LZ1B 3AFAD 2NQBC 3AZLC 3AV2D 3REJC 3AZMA 3A1IA 3UT9D 3AZEA 4XUJA 5B0YA 4YM6C 3O62D 5DNMB 3AN2A 5CPIA 1P3PC 1ZLAC 4HGAB 5AV8A 2YFVA 5AVBA 2NQBB 3AZLB 4WU8C 3B6GC 3REJB 2F8NH 1P3KD 2F8NB 3V9RB 2ZY4A 2NZDB 3NQUB 4YM6B 1P3PB 1S32D 3WKJC 1Z2CB 5GSUA 3X1TD 4YS3A 4WNNA 3MVDA 3RELD 4H9SC 3W96C 3MGSC 5B31D 1M19C 2FJ7A 3C1CD 2UWXA 4KUDD 3WKJB 2W8SA 4J8WD 1ID3D 3KUYA 3B0DB 3REKA 3W96B 1M19B 3AZNC 1M1AD 1AOIA 1B6WA 4X23D 4G92C 3AZID 5AY8D 2YFWB 4ZBJC 1BH9B 3MGQD 2HIOC 3KXBD 3AZNB 2IO5C 3IP4C 4J8UC 3NQJA 2BYKB 4G92B 4EO5C 3RELA 3W98D 2ZY2A 4ZBJB 5B1MA 1EQZD 3WA9C 3UTBD 2HIOB 1KX5C 3MNNC 5B24C 1KX3D 2IO5B 5AV9D 4J8UB 3AZJA 4Z5TC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F66 C;  5G49 B;  3VH6 T;  4XZQ C;  3VH6 W;  4CSR A;  3X1V A;  3WA9 B;  4WU9 C;  5FUG A;  2PYO C;  1TZY C;  3AZI A;  1KX5 B;  5B24 B;  5GT0 C;  5B32 C;  5BNV B;  4H9O A;  4Z5T B;  1F66 B;  5CPJ D;  4XZQ B;  5AV6 A;  1KX4 C;  4WU9 B;  2PYO B;  5B2I C;  1TZY B;  3W98 A;  4LD9 C;  3VH5 T;  5GT0 B;  3VH5 W;  5B32 B;  3WTP A;  5B0Z D;  5B1L C;  4J8V C;  4ZUX C;  1P3B C;  4WV4 B;  3X1U D;  3LEL D;  4JJN C;  5CP6 D;  3KSY A;  1KX4 B;  5B2I B;  5B40 D;  3LJA B;  5E5A A;  5B33 C;  2BYM B;  5B1L B;  4H9P B;  4J8V B;  1P3I D;  1P3B B;  3A6N C;  3MGR C;  1P3O A;  4JJN B;  5B0Z B;  3REI D;  1U35 C;  3AZG C;  5CPK A;  5JA4 B;  1P3G A;  1P3M D;  5B33 B;  5JRG D;  1P3F C;  1P3A A;  4AWL B;  2CV5 A;  3B6F C;  3AZM D;  4QLC B;  3MGR B;  1P34 C;  5BS7 A;  1P3L C;  1U35 B;  5AV5 C;  3AZG B;  1P3I B;  1JFI B;  2NZD C;  3AZE D;  4XUJ D;  5B0Y D;  5DNN A;  3KWQ A;  5AVC C;  3AN2 D;  3AYW A;  1P3F B;  5AVB D;  3MGP C;  3AV1 C;  5CPI C;  3REH C;  2L5A A;  4R8P C;  4H9R B;  5B40 A;  1P3L B;  3AZH A;  5BO0 A;  1M18 C;  5AVC B;  3AZK C;  5B2J C;  5GSU D;  5GT3 A;  3AV1 B;  4YS3 D;  5F99 A;  5B0Y B;  4J8X D;  5CPI B;  3WAA A;  4R8P B;  3MVD D;  3W99 A;  5AV8 B;  2YFV B;  4Z2M H;  4NE6 A;  3W97 C;  1M18 B;  3AZF A;  2FJ7 D;  3AFA C;  5KDM B;  3AZK B;  5B2J B;  3AV2 C;  3KUY D;  3REK D;  3B0C T;  5GXQ A;  5GSU B;  4YS3 B;  1HQ3 A;  3UT9 C;  3UTA A;  3W97 B;  1AOI D;  3O62 C;  3AFA B;  4Z66 A;  3AV2 B;  4CAY A;  1P3K C;  3X1S A;  3REK B;  3UT9 B;  4H9N B;  3O62 B;  4J8X A;  3B0D C;  1S32 C;  1BH8 B;  3X1T C;  1N1J A;  4E44 A;  3WTP E;  1ZLA D;  5B1M D;  4KHA B;  1P3K B;  5B31 C;  3AZJ D;  3LZ0 A;  5BNX B;  3C1C C;  3LZ1 A;  3TU4 A;  1S32 B;  3R45 A;  4KUD C;  3X1T B;  4J8W C;  1ID3 C;  3X1V D;  3REL B;  5B31 B;  4KGC D;  1M1A C;  5DNM A;  3C1C B;  4X23 C;  2NQB A;  5AY8 C;  3AZL A;  4KUD B;  4J8W B;  3REJ A;  1ID3 B;  5AV6 D;  3MGQ C;  1TAF B;  3V9R A;  3KXB C;  4CSR B;  3X1V B;  1M1A B;  2NZD A;  3NQU A;  4YM6 A;  3WTP D;  1P3P A;  1ZLA A;  5FUG B;  4X23 B;  3W98 C;  3AZI B;  5AY8 B;  4UUZ B;  4WU8 A;  3B6G A;  3MGQ B;  1EQZ C;  3UTB C;  4H9Q B;  3KXB B;  1KX3 C;  1WWI A;  5E5A D;  5AV9 C;  3W98 B;  3WKJ A;  1P3O D;  4KGC A;  1HTA A;  4H9S A;  1EQZ B;  3W96 A;  3MGS A;  3UTB B;  1M19 A;  5CPK D;  1KX3 B;  1P3G D;  5AV9 B;  5BT1 D;  1KU5 A;  1P3A D;  2CV5 D;  5E5A B;  2YFW A;  5CPJ C;  3LJA C;  2LY8 A;  4NE5 A;  3AZN A;  5DNN D;  3KWQ D;  3C1B D;  3AYW D;  5B0Z C;  2BYK A;  1P3G B;  3X1U C;  3LEL C;  5CPJ B;  5CP6 C;  3AZH D;  2HIO A;  4AWL C;  4QLC C;  4J8U A;  5GT3 D;  5F99 D;  1P3I C;  1H3O B;  3WAA D;  3X1U B;  3W99 D;  3AYW B;  3LEL B;  5CP6 B;  3REI C;  4ZUX D;  3WA9 A;  1B67 A;  1KX5 A;  3MNN A;  3AZF D;  5BNV A;  5B40 B;  1P3M C;  5JRG C;  4Z5T A;  1F66 A;  3AZM C;  4XZQ A;  5GXQ D;  5GT3 B;  3REI B;  3C1B A;  2PYO A;  1HQ3 D;  3UTA D;  4XUJ C;  5B0Y C;  3AZE C;  5GT0 A;  5B32 A;  3AN2 C;  3W99 B;  1P3M B;  5JRG B;  5AVB C;  5AV8 C;  4Z66 D;  2CWE A;  3AZM B;  1KX4 A;  3X1S D;  5B2I A;  3AZE B;  4XUJ B;  4LD9 A;  5AV5 D;  3AN2 B;  1ULY A;  5B1L A;  5AVB B;  5GSU C;  2ARO D;  4J8V A;  4ZUX A;  4YS3 C;  4J8X C;  1P3B A;  3MVD C;  4JJN A;  3LZ0 D;  2FJ7 C;  3LZ1 D;  3TU4 D;  5B33 A;  3B0C W;  4J8X B;  3A6N A;  3MGR A;  4WNN B;  3KUY C;  3REK C;  3MVD B;  1U35 A;  1JFI A;  3AZG A;  5DNM D;  2RVQ D;  1AOI C;  1BFM A;  1WWS A;  2FJ7 B;  2NQB D;  3AZL D;  3B6F A;  3REJ D;  1P34 A;  5B32 G;  3KUY B;  3TU4 B;  1P3L A;  3R45 B;  5AV5 A;  2F8N D;  2NZD D;  4YM6 D;  2ARO A;  1AOI B;  5AVC A;  1P3P D;  3REL C;  3MGP A;  3AV1 A;  4WU8 D;  3B6G D;  3REH A;  4R8P A;  5B1M C;  1M18 A;  3AZJ C;  3NQJ B;  5KDM A;  3AZK A;  5B2J A;  3WKJ D;  1Q9C A;  4NFT A;  3X1V C;  1ZLA B;  5B1M B;  3W96 D;  3MGS D;  2JSS A;  4WU8 B;  3B6G B;  1M19 D;  4KGC C;  3AZI C;  3W97 A;  3B0B A;  3AZJ B;  3AFA A;  1F1E A;  4NE3 A;  3AV2 A;  2F8N A;  5AV6 C;  2HUE C;  3AZN D;  4KGC B;  3UT9 A;  4H9N A;  3O62 A;  4H9O B;  3WTP C;  3MGS B;  1BH8 A;  4G91 C;  4DRB A;  5CHL B;  5AV6 B;  2HUE B;  4KHA A;  1P3K A;  2HIO D;  5E5A C;  4J8U D;  5BNX A;  3WTP B;  1S32 A;  4G91 B;  3X1T A;  1P3O C;  4Z2M G;  3WA9 D;  5B31 A;  1KX5 D;  3MNN D;  5B24 D;  5CPK C;  1P3G C;  3C1C A;  1BH9 A;  1R4V A;  4Z5T D;  5BT1 C;  1P3A C;  1F66 D;  4KUD A;  2CV5 C;  1P3O B;  4J8W A;  5BS7 C;  4XZQ D;  1ID3 A;  4EO5 B;  1TAF A;  4WU9 D;  2PYO D;  1TZY D;  2F8N G;  5CPK B;  5GT0 D;  5DNN C;  5B32 D;  3KWQ C;  3C1B C;  1M1A A;  3AYW C;  4X23 A;  1P3A B;  3MNN B;  5AY8 A;  4UUZ A;  2CV5 B;  3MGQ A;  5B40 C;  3AZH C;  1KX4 D;  5B2I D;  4H9Q A;  4DRA A;  4E45 A;  3KXB A;  3LJA D;  4LD9 D;  5DNN B;  3KWQ B;  3C1B B;  5G49 A;  5B1L D;  5GT3 C;  4J8V D;  5F99 C;  3WAA C;  1P3B D;  4JJN D;  3W99 C;  5B24 A;  3AZH B;  1EQZ A;  5BO0 B;  3UTB A;  2F8N K;  1KX3 A;  3AZF C;  5AV9 A;  5B33 D;  5B31 G;  5F99 B;  1A7W A;  4M6B A;  4QLC D;  3A6N D;  3VH6 A;  3MGR D;  4WU9 A;  3WAA B;  1TZY A;  4LD9 B;  1U35 D;  5GXQ C;  3AZG D;  4ZUX B;  1HQ3 C;  3UTA C;  3AZF B;  5C3I C;  1P3F D;  4Z66 C;  3B6F D;  1P34 D;  5CPJ A;  3LJA A;  1P3L D;  5GXQ B;  3A6N B;  2BYM A;  3X1S C;  1HQ3 B;  4H9P A;  3VH5 A;  3UTA B;  5AVC D;  5C3I B;  5B0Z A;  3MGP D;  4Z66 B;  3AV1 D;  2ARO C;  1H3O A;  3REH D;  5CPI D;  4R8P D;  3X1U A;  4CAY B;  5AV8 D;  3LEL A;  5CP6 A;  5JA4 A;  3B6F B;  1P34 B;  3X1S B;  1M18 D;  3LZ0 C;  5AV5 B;  4QLC A;  3LZ1 C;  3TU4 C;  3AZK D;  5B2J D;  1P3I A;  2ARO B;  1N1J B;  3MGP B;  3REI A;  3REH B;  1P3F A;  3W97 D;  5DNM C;  2RVQ C;  3LZ0 B;  1P3M A;  4H9R A;  4HGA C;  4WZS B;  5JRG A;  3LZ1 B;  3AFA D;  2NQB C;  3AZL C;  3AV2 D;  3REJ C;  3AZM A;  3UT9 D;  3AZE A;  4XUJ A;  5B0Y A;  4YM6 C;  3O62 D;  5DNM B;  3AN2 A;  5CPI A;  1P3P C;  1ZLA C;  4HGA B;  5AV8 A;  2YFV A;  5AVB A;  2NQB B;  3AZL B;  4WU8 C;  3B6G C;  3REJ B;  2F8N H;  1P3K D;  2F8N B;  3V9R B;  2NZD B;  3NQU B;  4YM6 B;  1P3P B;  1S32 D;  3WKJ C;  5GSU A;  3X1T D;  4YS3 A;  4WNN A;  3MVD A;  3REL D;  4H9S C;  3W96 C;  3MGS C;  5B31 D;  1M19 C;  2FJ7 A;  3C1C D;  4KUD D;  3WKJ B;  4J8W D;  1ID3 D;  3KUY A;  3B0D B;  3REK A;  3W96 B;  1M19 B;  3AZN C;  1M1A D;  1AOI A;  1B6W A;  4X23 D;  4G92 C;  3AZI D;  5AY8 D;  2YFW B;  4ZBJ C;  1BH9 B;  3MGQ D;  2HIO C;  3KXB D;  3AZN B;  2IO5 C;  4J8U C;  3NQJ A;  2BYK B;  4G92 B;  4EO5 C;  3REL A;  3W98 D;  4ZBJ B;  5B1M A;  1EQZ D;  3WA9 C;  3UTB D;  2HIO B;  1KX5 C;  3MNN C;  5B24 C;  1KX3 D;  2IO5 B;  5AV9 D;  4J8U B;  3AZJ A;  4Z5T C; 
#chains in the Genus database with same CATH topology
 1F66 C;  3H0R C;  5G49 B;  3VH6 T;  4XZQ C;  3VH6 W;  4CSR A;  3X1V A;  2JCH A;  3WA9 B;  4WU9 C;  5FUG A;  2PYO C;  1TZY C;  3AZI A;  1KX5 B;  5B24 B;  5GT0 C;  5B32 C;  5BNV B;  4H9O A;  4Z5T B;  1F66 B;  5CPJ D;  4DQY B;  4XZQ B;  5AV6 A;  1KX4 C;  4WU9 B;  2PYO B;  5B2I C;  1TZY B;  3W98 A;  4LD9 C;  3VH5 T;  5GT0 B;  3VH5 W;  5B32 B;  3WTP A;  5B0Z D;  2ZY3 A;  5B1L C;  2ZM5 A;  2Y2L A;  4J8V C;  4ZUX C;  3EPL A;  1P3B C;  4WV4 B;  3X1U D;  3LEL D;  4JJN C;  5CP6 D;  3KSY A;  1KX4 B;  5B2I B;  5B40 D;  3LJA B;  3AL0 C;  5E5A A;  5B33 C;  2BYM B;  5B1L B;  4H9P B;  4J8V B;  1P3I D;  1P3B B;  3A6N C;  3MGR C;  1P3O A;  4JJN B;  5B0Z B;  3REI D;  1U35 C;  3AZG C;  5CPK A;  5JA4 B;  1P3G A;  1P3M D;  3F6T A;  5B33 B;  5JRG D;  1P3F C;  1P3A A;  4AWL B;  2CV5 A;  3B6F C;  3AZM D;  4QLC B;  3MGR B;  1P34 C;  5BS7 A;  1P3L C;  1U35 B;  5AV5 C;  3AZG B;  1P3I B;  1JFI B;  2XD1 A;  2NZD C;  3AZE D;  4XUJ D;  5B0Y D;  5DNN A;  3KWQ A;  5AVC C;  3AN2 D;  3AYW A;  1P3F B;  5AVB D;  3MGP C;  3AV1 C;  5CPI C;  3REH C;  2L5A A;  4R8P C;  4H9R B;  5B40 A;  1P3L B;  3AZH A;  5BO0 A;  1M18 C;  5AVC B;  3AZK C;  5B2J C;  5GSU D;  5GT3 A;  3AV1 B;  5F99 A;  5B0Y B;  4YS3 D;  4J8X D;  5CPI B;  3WAA A;  4R8P B;  3MVD D;  3W99 A;  5AV8 B;  2YFV B;  4Z2M H;  4NE6 A;  3W97 C;  1M18 B;  3AZF A;  2FJ7 D;  3AFA C;  5KDM B;  3AZK B;  5B2J B;  3AV2 C;  3KUY D;  3REK D;  3B0C T;  5GXQ A;  5GSU B;  4YS3 B;  1HQ3 A;  3UT9 C;  3UTA A;  3W97 B;  1AOI D;  3O62 C;  3AFA B;  4Z66 A;  3AV2 B;  4CAY A;  1P3K C;  3X1S A;  3REK B;  3UT9 B;  4H9N B;  3O62 B;  4J8X A;  3B0D C;  1S32 C;  1BH8 B;  3X1T C;  1N1J A;  2Y2I A;  4E44 A;  3WTP E;  1ZLA D;  5B1M D;  4KHA B;  1P3K B;  5B31 C;  2G5I C;  3AZJ D;  3LZ0 A;  5BNX B;  3C1C C;  3LZ1 A;  3TU4 A;  1S32 B;  2DF4 C;  3R45 A;  4KUD C;  3X1T B;  4J8W C;  1ID3 C;  3X1V D;  2Y2J A;  3REL B;  3H0L C;  5B31 B;  4KGC D;  1M1A C;  5DNM A;  1W2E A;  3C1C B;  2Y2O A;  4X23 C;  2NQB A;  5AY8 C;  3AZL A;  4KUD B;  4J8W B;  3REJ A;  1ID3 B;  5AV6 D;  3MGQ C;  1TAF B;  3V9R A;  3KXB C;  4CSR B;  3X1V B;  1M1A B;  2NZD A;  3NQU A;  4YM6 A;  3WTP D;  1P3P A;  1ZLA A;  5FUG B;  4X23 B;  3W98 C;  3AZI B;  5AY8 B;  4UUZ B;  4WU8 A;  3B6G A;  3MGQ B;  1EQZ C;  3UTB C;  4H9Q B;  3KXB B;  1KX3 C;  1WWI A;  3H0M C;  5E5A D;  5AV9 C;  3W98 B;  3WKJ A;  1P3O D;  4KGC A;  1HTA A;  4H9S A;  1EQZ B;  3W96 A;  3MGS A;  3UTB B;  1M19 A;  5CPK D;  1KX3 B;  1P3G D;  5AV9 B;  5BT1 D;  1KU5 A;  1P3A D;  2CV5 D;  5E5A B;  2YFW A;  5CPJ C;  3LJA C;  2LY8 A;  4NE5 A;  3AZN A;  5DNN D;  3KWQ D;  3C1B D;  3AYW D;  1PZR A;  5B0Z C;  2BYK A;  1P3G B;  3X1U C;  3LEL C;  5CPJ B;  5CP6 C;  3AZH D;  2HIO A;  4AWL C;  4QLC C;  4J8U A;  3EPJ A;  5GT3 D;  5F99 D;  1P3I C;  1H3O B;  3WAA D;  3X1U B;  3W99 D;  3AYW B;  3LEL B;  5CP6 B;  3REI C;  4ZUX D;  3WA9 A;  1B67 A;  1KX5 A;  3MNN A;  3AZF D;  5BNV A;  5B40 B;  1P3M C;  5JRG C;  4Z5T A;  1F66 A;  3AZM C;  4XZQ A;  5GXQ D;  5GT3 B;  3REI B;  3C1B A;  2PYO A;  1HQ3 D;  3UTA D;  4XUJ C;  5B0Y C;  3AZE C;  5GT0 A;  5B32 A;  3AN2 C;  3W99 B;  1P3M B;  5JRG B;  5AVB C;  5AV8 C;  4Z66 D;  2CWE A;  3AZM B;  4WJ3 C;  2FFF B;  1KX4 A;  3X1S D;  5B2I A;  3AZE B;  4XUJ B;  4LD9 A;  5AV5 D;  3AN2 B;  1ULY A;  3EPK A;  5B1L A;  5AVB B;  5GSU C;  2ARO D;  4J8V A;  4ZUX A;  4YS3 C;  4J8X C;  1P3B A;  3MVD C;  4JJN A;  2DQN C;  2BG1 A;  3LZ0 D;  2FJ7 C;  3LZ1 D;  3TU4 D;  5B33 A;  3B0C W;  4J8X B;  3A6N A;  3MGR A;  4WNN B;  3KUY C;  3REK C;  3MVD B;  1U35 A;  1JFI A;  3AZG A;  5DNM D;  2RVQ D;  1AOI C;  1BFM A;  1WWS A;  2FJ7 B;  2NQB D;  3AZL D;  3B6F A;  3REJ D;  1P34 A;  5B32 G;  3KUY B;  3TU4 B;  1P3L A;  3R45 B;  5AV5 A;  2F8N D;  2NZD D;  2ARO A;  4YM6 D;  2Y2N A;  5AVC A;  1P3P D;  1AOI B;  2Y2G A;  3REL C;  3MGP A;  3AV1 A;  4WU8 D;  3B6G D;  3REH A;  4R8P A;  5B1M C;  1M18 A;  3AZJ C;  2Y2P A;  3NQJ B;  5KDM A;  3AZK A;  5B2J A;  3WKJ D;  1Q9C A;  4NFT A;  3X1V C;  1ZLA B;  5B1M B;  3W96 D;  3MGS D;  2JSS A;  4WU8 B;  3B6G B;  1M19 D;  4KGC C;  3AZI C;  3W97 A;  3B0B A;  3AZJ B;  3AFA A;  1F1E A;  4NE3 A;  3AV2 A;  2F8N A;  5AV6 C;  2HUE C;  3AZN D;  4KGC B;  3UT9 A;  2J8P A;  4H9N A;  3O62 A;  4H9O B;  3WTP C;  3MGS B;  1BH8 A;  4G91 C;  4DRB A;  5CHL B;  5AV6 B;  2HUE B;  4KHA A;  1P3K A;  2HIO D;  2RIQ A;  5E5A C;  4J8U D;  5BNX A;  3WTP B;  1S32 A;  2XD5 A;  4G91 B;  3X1T A;  1P3O C;  4Z2M G;  3WA9 D;  5B31 A;  1KX5 D;  3MNN D;  5B24 D;  5CPK C;  1P3G C;  3C1C A;  1BH9 A;  1R4V A;  4Z5T D;  5BT1 C;  1P3A C;  1F66 D;  4KUD A;  2CV5 C;  3FDD A;  1P3O B;  4J8W A;  5BS7 C;  4XZQ D;  1ID3 A;  4EO5 B;  1TAF A;  4WU9 D;  2PYO D;  1TZY D;  2F8N G;  5CPK B;  5GT0 D;  5DNN C;  5B32 D;  3KWQ C;  3C1B C;  1M1A A;  3AYW C;  4X23 A;  3P5J B;  1P3A B;  3MNN B;  3KFU G;  5AY8 A;  4UUZ A;  2CV5 B;  3EG5 B;  3MGQ A;  5B40 C;  3AZH C;  1KX4 D;  5B2I D;  2JE5 A;  4H9Q A;  4DRA A;  4E45 A;  3KXB A;  3LJA D;  4LD9 D;  5DNN B;  3KWQ B;  3EPH A;  3C1B B;  5G49 A;  5B1L D;  5GT3 C;  4J8V D;  5F99 C;  2Y2K A;  3WAA C;  1P3B D;  4JJN D;  3W99 C;  5B24 A;  3AZH B;  1EQZ A;  5BO0 B;  3UTB A;  2F8N K;  1KX3 A;  3AZF C;  5AV9 A;  5B33 D;  5B31 G;  5F99 B;  1A7W A;  4M6B A;  4QLC D;  3A6N D;  3VH6 A;  3MGR D;  4WU9 A;  3WAA B;  1TZY A;  4LD9 B;  1U35 D;  2VQR A;  5GXQ C;  3AZG D;  4ZUX B;  2ZY5 A;  1HQ3 C;  3UTA C;  3AZF B;  5C3I C;  2F2A C;  1P3F D;  4Z66 C;  3B6F D;  1P34 D;  2G5H C;  5CPJ A;  3LJA A;  1P3L D;  5GXQ B;  2Y2H A;  3A6N B;  2BYM A;  3X1S C;  1HQ3 B;  4H9P A;  3VH5 A;  3UTA B;  5AVC D;  5C3I B;  2Y2Q A;  5B0Z A;  4Z66 B;  3MGP D;  3AV1 D;  2ARO C;  1H3O A;  2Y2M A;  3REH D;  5CPI D;  4R8P D;  3X1U A;  4CAY B;  5AV8 D;  4UPK A;  5CP6 A;  3LEL A;  5JA4 A;  3B6F B;  1P34 B;  3X1S B;  1M18 D;  3LZ0 C;  5AV5 B;  4QLC A;  3LZ1 C;  1T3U A;  3TU4 C;  3AZK D;  5B2J D;  1P3I A;  2ARO B;  1N1J B;  3A1K A;  3MGP B;  3REI A;  3REH B;  1P3F A;  3W97 D;  5DNM C;  2RVQ C;  3LZ0 B;  1P3M A;  4H9R A;  4HGA C;  4WZS B;  5JRG A;  3LZ1 B;  3AFA D;  2NQB C;  3AZL C;  3AV2 D;  3REJ C;  3AZM A;  3A1I A;  3UT9 D;  3AZE A;  4XUJ A;  5B0Y A;  4YM6 C;  3O62 D;  5DNM B;  3AN2 A;  5CPI A;  1P3P C;  1ZLA C;  4HGA B;  5AV8 A;  2YFV A;  5AVB A;  2NQB B;  3AZL B;  4WU8 C;  3B6G C;  3REJ B;  2F8N H;  1P3K D;  2F8N B;  3V9R B;  2ZY4 A;  2NZD B;  3NQU B;  4YM6 B;  1P3P B;  1S32 D;  3WKJ C;  1Z2C B;  5GSU A;  3X1T D;  4YS3 A;  4WNN A;  3MVD A;  3REL D;  4H9S C;  3W96 C;  3MGS C;  5B31 D;  1M19 C;  2FJ7 A;  3C1C D;  2UWX A;  4KUD D;  3WKJ B;  2W8S A;  4J8W D;  1ID3 D;  3KUY A;  3B0D B;  3REK A;  3W96 B;  1M19 B;  3AZN C;  1M1A D;  1AOI A;  1B6W A;  4X23 D;  4G92 C;  3AZI D;  5AY8 D;  2YFW B;  4ZBJ C;  1BH9 B;  3MGQ D;  2HIO C;  3KXB D;  3AZN B;  2IO5 C;  3IP4 C;  4J8U C;  3NQJ A;  2BYK B;  4G92 B;  4EO5 C;  3REL A;  3W98 D;  2ZY2 A;  4ZBJ B;  5B1M A;  1EQZ D;  3WA9 C;  3UTB D;  2HIO B;  1KX5 C;  3MNN C;  5B24 C;  1KX3 D;  2IO5 B;  5AV9 D;  4J8U B;  3AZJ A;  4Z5T C; 
#chains in the Genus database with same CATH homology
 1F66 C;  3H0R C;  5G49 B;  3VH6 T;  4XZQ C;  3VH6 W;  4CSR A;  3X1V A;  2JCH A;  3WA9 B;  4WU9 C;  5FUG A;  2PYO C;  1TZY C;  3AZI A;  1KX5 B;  5B24 B;  5GT0 C;  5B32 C;  5BNV B;  4H9O A;  4Z5T B;  1F66 B;  5CPJ D;  4DQY B;  4XZQ B;  5AV6 A;  1KX4 C;  4WU9 B;  2PYO B;  5B2I C;  1TZY B;  3W98 A;  4LD9 C;  3VH5 T;  5GT0 B;  3VH5 W;  5B32 B;  3WTP A;  5B0Z D;  2ZY3 A;  5B1L C;  2ZM5 A;  2Y2L A;  4J8V C;  4ZUX C;  3EPL A;  1P3B C;  4WV4 B;  3X1U D;  3LEL D;  4JJN C;  5CP6 D;  3KSY A;  1KX4 B;  5B2I B;  5B40 D;  3LJA B;  3AL0 C;  5E5A A;  5B33 C;  2BYM B;  5B1L B;  4H9P B;  4J8V B;  1P3I D;  1P3B B;  3A6N C;  3MGR C;  1P3O A;  4JJN B;  5B0Z B;  3REI D;  1U35 C;  3AZG C;  5CPK A;  5JA4 B;  1P3G A;  1P3M D;  3F6T A;  5B33 B;  5JRG D;  1P3F C;  1P3A A;  4AWL B;  2CV5 A;  3B6F C;  3AZM D;  4QLC B;  3MGR B;  1P34 C;  5BS7 A;  1P3L C;  1U35 B;  5AV5 C;  3AZG B;  1P3I B;  1JFI B;  2XD1 A;  2NZD C;  3AZE D;  4XUJ D;  5B0Y D;  5DNN A;  3KWQ A;  5AVC C;  3AN2 D;  3AYW A;  1P3F B;  5AVB D;  3MGP C;  3AV1 C;  5CPI C;  3REH C;  2L5A A;  4R8P C;  4H9R B;  5B40 A;  1P3L B;  3AZH A;  5BO0 A;  1M18 C;  5AVC B;  3AZK C;  5B2J C;  5GSU D;  5GT3 A;  3AV1 B;  5F99 A;  5B0Y B;  4YS3 D;  4J8X D;  5CPI B;  3WAA A;  4R8P B;  3MVD D;  3W99 A;  5AV8 B;  2YFV B;  4Z2M H;  4NE6 A;  3W97 C;  1M18 B;  3AZF A;  2FJ7 D;  3AFA C;  5KDM B;  3AZK B;  5B2J B;  3AV2 C;  3KUY D;  3REK D;  3B0C T;  5GXQ A;  5GSU B;  4YS3 B;  1HQ3 A;  3UT9 C;  3UTA A;  3W97 B;  1AOI D;  3O62 C;  3AFA B;  4Z66 A;  3AV2 B;  4CAY A;  1P3K C;  3X1S A;  3REK B;  3UT9 B;  4H9N B;  3O62 B;  4J8X A;  3B0D C;  1S32 C;  1BH8 B;  3X1T C;  1N1J A;  2Y2I A;  4E44 A;  3WTP E;  1ZLA D;  5B1M D;  4KHA B;  1P3K B;  5B31 C;  2G5I C;  3AZJ D;  3LZ0 A;  5BNX B;  3C1C C;  3LZ1 A;  3TU4 A;  1S32 B;  2DF4 C;  3R45 A;  4KUD C;  3X1T B;  4J8W C;  1ID3 C;  3X1V D;  2Y2J A;  3REL B;  3H0L C;  5B31 B;  4KGC D;  1M1A C;  5DNM A;  1W2E A;  3C1C B;  2Y2O A;  4X23 C;  2NQB A;  5AY8 C;  3AZL A;  4KUD B;  4J8W B;  3REJ A;  1ID3 B;  5AV6 D;  3MGQ C;  1TAF B;  3V9R A;  3KXB C;  4CSR B;  3X1V B;  1M1A B;  2NZD A;  3NQU A;  4YM6 A;  3WTP D;  1P3P A;  1ZLA A;  5FUG B;  4X23 B;  3W98 C;  3AZI B;  5AY8 B;  4UUZ B;  4WU8 A;  3B6G A;  3MGQ B;  1EQZ C;  3UTB C;  4H9Q B;  3KXB B;  1KX3 C;  1WWI A;  3H0M C;  5E5A D;  5AV9 C;  3W98 B;  3WKJ A;  1P3O D;  4KGC A;  1HTA A;  4H9S A;  1EQZ B;  3W96 A;  3MGS A;  3UTB B;  1M19 A;  5CPK D;  1KX3 B;  1P3G D;  5AV9 B;  5BT1 D;  1KU5 A;  1P3A D;  2CV5 D;  5E5A B;  2YFW A;  5CPJ C;  3LJA C;  2LY8 A;  4NE5 A;  3AZN A;  5DNN D;  3KWQ D;  3C1B D;  3AYW D;  1PZR A;  5B0Z C;  2BYK A;  1P3G B;  3X1U C;  3LEL C;  5CPJ B;  5CP6 C;  3AZH D;  2HIO A;  4AWL C;  4QLC C;  4J8U A;  3EPJ A;  5GT3 D;  5F99 D;  1P3I C;  1H3O B;  3WAA D;  3X1U B;  3W99 D;  3AYW B;  3LEL B;  5CP6 B;  3REI C;  4ZUX D;  3WA9 A;  1B67 A;  1KX5 A;  3MNN A;  3AZF D;  5BNV A;  5B40 B;  1P3M C;  5JRG C;  4Z5T A;  1F66 A;  3AZM C;  4XZQ A;  5GXQ D;  5GT3 B;  3REI B;  3C1B A;  2PYO A;  1HQ3 D;  3UTA D;  4XUJ C;  5B0Y C;  3AZE C;  5GT0 A;  5B32 A;  3AN2 C;  3W99 B;  1P3M B;  5JRG B;  5AVB C;  5AV8 C;  4Z66 D;  2CWE A;  3AZM B;  4WJ3 C;  2FFF B;  1KX4 A;  3X1S D;  5B2I A;  3AZE B;  4XUJ B;  4LD9 A;  5AV5 D;  3AN2 B;  1ULY A;  3EPK A;  5B1L A;  5AVB B;  5GSU C;  2ARO D;  4J8V A;  4ZUX A;  4YS3 C;  4J8X C;  1P3B A;  3MVD C;  4JJN A;  2DQN C;  2BG1 A;  3LZ0 D;  2FJ7 C;  3LZ1 D;  3TU4 D;  5B33 A;  3B0C W;  4J8X B;  3A6N A;  3MGR A;  4WNN B;  3KUY C;  3REK C;  3MVD B;  1U35 A;  1JFI A;  3AZG A;  5DNM D;  2RVQ D;  1AOI C;  1BFM A;  1WWS A;  2FJ7 B;  2NQB D;  3AZL D;  3B6F A;  3REJ D;  1P34 A;  5B32 G;  3KUY B;  3TU4 B;  1P3L A;  3R45 B;  5AV5 A;  2F8N D;  2NZD D;  2ARO A;  4YM6 D;  2Y2N A;  5AVC A;  1P3P D;  1AOI B;  2Y2G A;  3REL C;  3MGP A;  3AV1 A;  4WU8 D;  3B6G D;  3REH A;  4R8P A;  5B1M C;  1M18 A;  3AZJ C;  2Y2P A;  3NQJ B;  5KDM A;  3AZK A;  5B2J A;  3WKJ D;  1Q9C A;  4NFT A;  3X1V C;  1ZLA B;  5B1M B;  3W96 D;  3MGS D;  2JSS A;  4WU8 B;  3B6G B;  1M19 D;  4KGC C;  3AZI C;  3W97 A;  3B0B A;  3AZJ B;  3AFA A;  1F1E A;  4NE3 A;  3AV2 A;  2F8N A;  5AV6 C;  2HUE C;  3AZN D;  4KGC B;  3UT9 A;  2J8P A;  4H9N A;  3O62 A;  4H9O B;  3WTP C;  3MGS B;  1BH8 A;  4G91 C;  4DRB A;  5CHL B;  5AV6 B;  2HUE B;  4KHA A;  1P3K A;  2HIO D;  2RIQ A;  5E5A C;  4J8U D;  5BNX A;  3WTP B;  1S32 A;  2XD5 A;  4G91 B;  3X1T A;  1P3O C;  4Z2M G;  3WA9 D;  5B31 A;  1KX5 D;  3MNN D;  5B24 D;  5CPK C;  1P3G C;  3C1C A;  1BH9 A;  1R4V A;  4Z5T D;  5BT1 C;  1P3A C;  1F66 D;  4KUD A;  2CV5 C;  3FDD A;  1P3O B;  4J8W A;  5BS7 C;  4XZQ D;  1ID3 A;  4EO5 B;  1TAF A;  4WU9 D;  2PYO D;  1TZY D;  2F8N G;  5CPK B;  5GT0 D;  5DNN C;  5B32 D;  3KWQ C;  3C1B C;  1M1A A;  3AYW C;  4X23 A;  3P5J B;  1P3A B;  3MNN B;  3KFU G;  5AY8 A;  4UUZ A;  2CV5 B;  3EG5 B;  3MGQ A;  5B40 C;  3AZH C;  1KX4 D;  5B2I D;  2JE5 A;  4H9Q A;  4DRA A;  4E45 A;  3KXB A;  3LJA D;  4LD9 D;  5DNN B;  3KWQ B;  3EPH A;  3C1B B;  5G49 A;  5B1L D;  5GT3 C;  4J8V D;  5F99 C;  2Y2K A;  3WAA C;  1P3B D;  4JJN D;  3W99 C;  5B24 A;  3AZH B;  1EQZ A;  5BO0 B;  3UTB A;  2F8N K;  1KX3 A;  3AZF C;  5AV9 A;  5B33 D;  5B31 G;  5F99 B;  1A7W A;  4M6B A;  4QLC D;  3A6N D;  3VH6 A;  3MGR D;  4WU9 A;  3WAA B;  1TZY A;  4LD9 B;  1U35 D;  2VQR A;  5GXQ C;  3AZG D;  4ZUX B;  2ZY5 A;  1HQ3 C;  3UTA C;  3AZF B;  5C3I C;  2F2A C;  1P3F D;  4Z66 C;  3B6F D;  1P34 D;  2G5H C;  5CPJ A;  3LJA A;  1P3L D;  5GXQ B;  2Y2H A;  3A6N B;  2BYM A;  3X1S C;  1HQ3 B;  4H9P A;  3VH5 A;  3UTA B;  5AVC D;  5C3I B;  2Y2Q A;  5B0Z A;  4Z66 B;  3MGP D;  3AV1 D;  2ARO C;  1H3O A;  2Y2M A;  3REH D;  5CPI D;  4R8P D;  3X1U A;  4CAY B;  5AV8 D;  4UPK A;  5CP6 A;  3LEL A;  5JA4 A;  3B6F B;  1P34 B;  3X1S B;  1M18 D;  3LZ0 C;  5AV5 B;  4QLC A;  3LZ1 C;  1T3U A;  3TU4 C;  3AZK D;  5B2J D;  1P3I A;  2ARO B;  1N1J B;  3A1K A;  3MGP B;  3REI A;  3REH B;  1P3F A;  3W97 D;  5DNM C;  2RVQ C;  3LZ0 B;  1P3M A;  4H9R A;  4HGA C;  4WZS B;  5JRG A;  3LZ1 B;  3AFA D;  2NQB C;  3AZL C;  3AV2 D;  3REJ C;  3AZM A;  3A1I A;  3UT9 D;  3AZE A;  4XUJ A;  5B0Y A;  4YM6 C;  3O62 D;  5DNM B;  3AN2 A;  5CPI A;  1P3P C;  1ZLA C;  4HGA B;  5AV8 A;  2YFV A;  5AVB A;  2NQB B;  3AZL B;  4WU8 C;  3B6G C;  3REJ B;  2F8N H;  1P3K D;  2F8N B;  3V9R B;  2ZY4 A;  2NZD B;  3NQU B;  4YM6 B;  1P3P B;  1S32 D;  3WKJ C;  1Z2C B;  5GSU A;  3X1T D;  4YS3 A;  4WNN A;  3MVD A;  3REL D;  4H9S C;  3W96 C;  3MGS C;  5B31 D;  1M19 C;  2FJ7 A;  3C1C D;  2UWX A;  4KUD D;  3WKJ B;  2W8S A;  4J8W D;  1ID3 D;  3KUY A;  3B0D B;  3REK A;  3W96 B;  1M19 B;  3AZN C;  1M1A D;  1AOI A;  1B6W A;  4X23 D;  4G92 C;  3AZI D;  5AY8 D;  2YFW B;  4ZBJ C;  1BH9 B;  3MGQ D;  2HIO C;  3KXB D;  3AZN B;  2IO5 C;  3IP4 C;  4J8U C;  3NQJ A;  2BYK B;  4G92 B;  4EO5 C;  3REL A;  3W98 D;  2ZY2 A;  4ZBJ B;  5B1M A;  1EQZ D;  3WA9 C;  3UTB D;  2HIO B;  1KX5 C;  3MNN C;  5B24 C;  1KX3 D;  2IO5 B;  5AV9 D;  4J8U B;  3AZJ A;  4Z5T C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...