4J8UD

X-ray structure of ncp145 with chlorido(eta-6-p-cymene)(n-phenyl-2-pyridinecarbothioamide)osmium(ii)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
95
structure length
95
Chain Sequence
KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Novel metal(II) arene 2-pyridinecarbothioamides: a rationale to orally active organometallic anticancer agents
doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 37
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4j8uD00
2HIOC 1H3OA 3KUYC 1HQ3D 3W98D 5GT3B 3B0DB 3MNNC 1U35B 3O62D 4KHAB 1ZLAA 2L5AA 5E5AD 5GT0D 5GSUD 4WU9A 5AY8B 1P3MD 4WNNB 3LZ1B 3AZKA 2F8NB 2NQBB 3WA9C 4Z5TA 1S32C 4NFTA 5B40B 5AVBB 4ZUXA 5GXQC 3WKJA 3WAAC 5AVCC 4YM6D 3AZED 3LZ0B 4J8UB 5B0ZA 3W97A 4J8VD 3REHB 4XUJD 4Z2MG 5JRGC 5CPJB 5BO0A 3UT9B 4KUDB 3X1SB 3AZNB 5DNMA 5FUGA 3NQJA 1BH8A 5F99B 4H9PA 2IO5C 4M6BA 4DRAA 1P3LD 3KWQD 3AZFA 3AV2C 3REJC 3UTBC 5B32A 5B2JB 5AV9C 5AV8B 3AV1A 3AZGA 1M1AC 3B6FD 3LELA 3AZID 3B6GA 1P3KB 5AV6D 3B0CW 3REIC 5B1LD 4Z66D 1KX5A 2CV5B 3AZMA 3C1CB 1KX3B 3MGPB 4CSRB 3UTAD 4XZQB 3AFAC 3REKD 5B2ID 3AZLB 5C3IB 3C1BB 4JJNA 3MGQA 1P3FC 3WTPC 5B24C 4H9RB 4J8XD 5DNNA 3TU4B 2F8NH 3AYWA 1P34A 2BYKA 1HQ3C 4X23A 4E45A 4QLCD 3X1TB 3W98C 2FJ7D 3KUYB 3RELC 3O62C 5B31B 5GT3A 5E5AC 2HUEB 3MNNB 5B1MB 5GT0C 5GSUC 3WA9D 1U35A 1S32D 4KHAA 5B0YD 5GXQD 3WAAD 3W99C 5AY8A 4WU9D 4WNNA 3LZ1A 4NE5A 5BNXA 2CWEA 2F8NA 2RVQD 1P3OB 2NQBA 5B33B 3AZEC 5B40A 1AOIC 5AVBA 1EQZC 4J8VC 5JRGD 4XUJC 3LZ0A 4NE6A 4J8UA 1P3PC 1ID3B 5B0ZD 3W97D 3REHA 4WU8D 5B32G 5CPJA 3UT9A 3W96A 3UTBD 4KUDA 3X1SA 3AZNA 1P3LC 1M18B 3A6NB 3KWQC 5G49B 2IO5B 5F99A 3KXBD 4J8WB 1F66B 1M1AD 1P3GC 1P3IA 5B2JA 5B32D 3R45B 3B6FC 5AV9B 4R8PB 5AV8A 3AV1D 3AZJB 5B1LC 4H9SA 1Q9CA 3REIB 3AZHB 1P3KA 3UTAC 5CPID 2CV5A 1KX5D 3MGRB 5B2IC 3C1CA 3WTPD 3MGPA 3X1VA 1KX3A 4G91C 4NE3A 4XZQA 4EO5C 3AZLA 4J8XC 1P3FB 5B24B 3RELD 3MGSB 4QLCC 4AWLC 2FJ7C 4H9RA 3B0CT 5DNND 1HQ3B 3TU4A 3W98B 1P34D 3X1TA 1M19B 3KUYA 3O62B 5BT1C 4H9QB 3W99D 5E5AB 5B31A 2YFVB 4LD9A 5GT3D 5GT0B 5GSUB 3NQUB 5B0YC 5B1MA 3MNNA 1P3MB 4WU9C 5CPKD 1AOID 3AZKC 1EQZD 2RVQC 4Z5TC 5AY8D 1TAFB 5KDMB 4YM6B 1P3PD 3AZEB 1P3OA 2NQBD 4H9OB 5B33A 2F8NK 3LJAD 5B0ZC 3W97C 4G92B 4XUJB 3MVDA 4WU8C 1JFIB 4YS3B 5BS7C 2AROD 3LZ0D 1ID3A 2JSSA 4HGAB 3AN2D 3REHD 2NZDB 5DNMC 3V9RB 3KSYA 4ZBJC 1P3AD 3W96D 3KXBC 1M18A 3A6NA 3AZFC 1P3GD 5G49A 3X1UD 1KX4D 5B32C 4J8WA 2PYOD 1F66A 1BH9B 3AV1C 1P3ID 3B6FB 5CP6D 3AZGC 3R45A 3AZIB 1WWIA 5AV9A 1TZYD 5AV6B 4KGCA 4R8PA 3B6GC 5B1LB 3AZJA 1P3BB 4Z66B 5CPIC 5AV5D 1KX5C 3REIA 3AZHA 3UTAB 3REKB 5B2IB 2CV5D 4G91B 3MGRA 3X1VD 1KX3D 2HIOB 4EO5B 3AZLD 5DNNC 1P3FA 4QLCB 4AWLB 1P34C 5B24A 5BT1D 4X23C 3MGSA 2FJ7B 1ZLAD 1HQ3A 5GT3C 1M19A 3AZKD 3WA9B 3O62A 1S32B 5CPKC 4H9QA 4Z5TD 4E44A 5E5AA 5B0YB 5GXQB 2YFVA 3WAAB 4LD9D 5AVCB 5GT0A 5GSUA 1B6WA 3NQUA 4ZUXD 5B1MD 4WU9B 1P3MA 3WKJD 5AY8C 3LZ1C 2NQBC 3LJAC 5B40C 5AVBC 5KDMA 5JRGB 4YM6A 1P3OD 4H9OA 2AROC 3LZ0C 4J8UC 5BNVB 5DNMD 4WU8B 3AN2C 4XUJA 4Z2MH 3MVDD 3REHC 1JFIA 4YS3A 3AZFD 3AV2B 3REJB 3UTBB 1P3AC 3UT9C 3W96C 1N1JB 4KUDC 2NZDA 3AZNC 3X1SC 4ZBJB 1A7WA 3X1UC 1KX4C 1BH8B 3KXBB 2PYOC 1M1AB 3AZGD 3LELD 3B6GD 1P3IC 5B2JC 5CP6C 4J8WD 1BH9A 1TZYC 5AV8C 3AZMD 3B6FA 3AZIA 4CSRA 5AV5C 4H9SC 3AFAB 5AV6A 4KGCD 4UUZB 5B1LA 3AZJD 5CPIB 1P3BA 4Z66A 3C1BA 1KX5B 2BYMB 3WTPB 4JJND 2CV5C 3MGQD 3AZHD 3X1VC 3UTAA 1KX3C 3REKA 5B2IA 3AYWD 3B0BA 4X23D 3AZLC 2LY8A 2HIOA 2F8NG 3RELB 1ZLAC 3VH6A 4WZSB 4QLCA 2FJ7A 1U35D 1ULYA 3W99B 3VH5T 5B31C 3LZ1D 1M19D 4LD9C 2HUEC 4ZUXC 5CPKB 5B1MC 2F8ND 3WA9A 1S32A 3WKJC 1AOIB 1EQZB 5B0YA 5B40D 5GXQA 4J8VB 5AVBD 3WAAA 5AVCA 3VH6W 1P3PB 5BNXB 4J8UD 1P3OC 3LJAB 5B33C 1F1EA 5JRGA 5CPJD 2AROB 3MVDC 3UT9D 1P3LB 1R4VA 3KWQB 4KUDD 3AN2B 5BNVA 3X1SD 3AZND 1ID3C 4H9NB 4WU8A 5JA4B 5BS7A 4YS3D 2YFWB 5F99D 1P3AB 1HTAA 3VH5A 3AV2A 3REJA 3UTBA 3W96B 1N1JA 1P3GB 1M18C 2NZDD 3X1UB 3A6NC 1KX4B 5B2JD 3KXBA 3LELC 2PYOB 5AV8D 4J8WC 1M1AA 1F66C 1P3IB 5CP6B 3AZMC 1P3KD 1TZYB 3VH5W 4KGCC 4R8PC 5AV5B 3AZJC 3C1CD 3MGPD 3AFAA 4UUZA 4XZQD 3MGQC 4JJNC 3AZHC 4CAYB 4J8XB 5CPIA 5B31G 1P3BD 3C1BD 2BYMA 3WTPA 3AYWC 3X1VB 3MGRC 1H3OB 3TU4D 3W98A 3X1TD 2HIOD 3B0DC 1B67A 3RELA 3KUYD 3WTPE 1U35C 3MGSC 1ZLAB 5B31D 3MNND 3AZKB 1M19C 4Z5TB 3W99A 4LD9B 1TAFA 4ZUXB 3WKJB 5CHLB 5CPKA 3AZEA 1P3MC 1AOIA 5B33D 1EQZA 1BFMA 5B0ZB 3W97B 4J8VA 1WWSA 5AVCD 1P3PA 4YM6C 1ID3D 5BO0B 5CPJC 3LJAA 5DNMB 3MVDB 3V9RA 5FUGB 4G92C 2AROA 3NQJB 4H9PB 4YS3C 1P3LA 3KWQA 3AZFB 5F99C 3AN2A 1M18D 4H9NA 3A6ND 4HGAC 5JA4A 2NZDC 2YFWA 5B32B 1P3AA 3VH6T 3AV2D 3REJD 1F66D 3AV1B 1P3GA 3AZGB 3X1UA 1KX4A 1KU5A 3LELB 3B6GB 5AV9D 2PYOA 4R8PD 1P3KC 3AZMB 5CP6A 3REID 3C1CC 3MGPC 1TZYA 3AZIC 4KGCB 5AV6C 4XZQC 5AV5A 3MGRD 1P3BC 4DRBA 5C3IC 4Z66C 3C1BC 4JJNB 3AFAD 3MGQB 4CAYA 4J8XA 5DNNB 3REKC 4WV4B 3AYWB 1P34B 1P3FD 2BYKB 4X23B 3TU4C 5B24D 3X1TC 3MGSD
chains in the Genus database with same CATH superfamily
2HIOC 1H3OA 3KUYC 1HQ3D 3W98D 5GT3B 3B0DB 3MNNC 1U35B 3O62D 4KHAB 1ZLAA 2L5AA 5E5AD 5GT0D 5GSUD 4WU9A 5AY8B 1P3MD 4WNNB 3LZ1B 3AZKA 2F8NB 3EPHA 2NQBB 3WA9C 2ZY5A 4Z5TA 1S32C 4NFTA 2G5HC 5B40B 5AVBB 4ZUXA 5GXQC 3WKJA 3WAAC 5AVCC 4YM6D 3AZED 3LZ0B 4J8UB 5B0ZA 3W97A 4J8VD 3REHB 4XUJD 4Z2MG 5JRGC 5CPJB 5BO0A 3UT9B 4KUDB 3X1SB 3AZNB 5DNMA 2Y2PA 5FUGA 3NQJA 2F2AC 1BH8A 4H9PA 4DRAA 2IO5C 2Y2LA 4M6BA 5F99B 3KWQD 3AZFA 1P3LD 3AV2C 3REJC 3EG5B 3UTBC 5B32A 5B2JB 2Y2MA 5AV9C 5AV8B 3AV1A 3AZGA 1M1AC 3B6FD 3LELA 3AZID 2JE5A 3B6GA 1P3KB 5AV6D 3B0CW 3REIC 5B1LD 2Y2HA 4Z66D 1KX5A 2CV5B 3AZMA 3C1CB 1KX3B 3MGPB 4CSRB 3UTAD 4XZQB 3AFAC 3REKD 5B2ID 3AZLB 5C3IB 3C1BB 4JJNA 3MGQA 1P3FC 3WTPC 5B24C 4H9RB 4J8XD 5DNNA 3TU4B 2F8NH 3AYWA 1P34A 2BYKA 1HQ3C 4X23A 4E45A 4QLCD 3X1TB 3W98C 2FJ7D 3KUYB 3RELC 3O62C 5B31B 2FFFB 5GT3A 5E5AC 2HUEB 3MNNB 5B1MB 5GT0C 5GSUC 3WA9D 1U35A 1S32D 4KHAA 2VQRA 5B0YD 5GXQD 3WAAD 3W99C 5AY8A 4WU9D 4WNNA 3LZ1A 4NE5A 5BNXA 2CWEA 2F8NA 2RVQD 1P3OB 2NQBA 5B33B 3AZEC 5B40A 1AOIC 5AVBA 1EQZC 4J8VC 5JRGD 4XUJC 3LZ0A 4NE6A 4J8UA 1P3PC 1ID3B 1T3UA 2Y2KA 5B0ZD 3W97D 3REHA 4WU8D 2DF4C 5B32G 5CPJA 3UT9A 3W96A 3UTBD 4KUDA 3X1SA 3AZNA 1P3LC 1M18B 3A6NB 3KWQC 4WJ3C 2G5IC 5G49B 2IO5B 5F99A 3KXBD 4J8WB 1F66B 1M1AD 1P3GC 1P3IA 5B2JA 5B32D 3R45B 3B6FC 5AV9B 4R8PB 5AV8A 3AV1D 3AZJB 5B1LC 3EPKA 4H9SA 1Q9CA 2Y2OA 3REIB 3AZHB 1P3KA 3UTAC 5CPID 2CV5A 1KX5D 3MGRB 5B2IC 3C1CA 3WTPD 3MGPA 3X1VA 1KX3A 4G91C 4NE3A 4XZQA 4EO5C 3AZLA 4J8XC 1P3FB 5B24B 3RELD 3MGSB 4QLCC 4AWLC 2FJ7C 4H9RA 3B0CT 5DNND 1HQ3B 3TU4A 3W98B 1P34D 3X1TA 1M19B 3KUYA 3O62B 5BT1C 4H9QB 3W99D 5E5AB 5B31A 2YFVB 4LD9A 5GT3D 3FDDA 5GSUB 3NQUB 5GT0B 5B1MA 5B0YC 3MNNA 1P3MB 2Y2QA 4WU9C 5CPKD 1AOID 3AZKC 1EQZD 2RVQC 4Z5TC 5AY8D 1TAFB 5KDMB 4YM6B 1P3PD 3AZEB 1P3OA 2NQBD 4H9OB 5B33A 2F8NK 3LJAD 5B0ZC 3W97C 4G92B 4XUJB 3MVDA 4WU8C 1JFIB 4YS3B 5BS7C 2AROD 3LZ0D 1ID3A 2JSSA 3A1KA 4HGAB 3AN2D 3REHD 2NZDB 5DNMC 3V9RB 3KSYA 4ZBJC 2XD1A 1P3AD 3W96D 3KXBC 1M18A 3A6NA 3AZFC 1P3GD 5G49A 3X1UD 1KX4D 2Y2GA 3H0LC 5B32C 4J8WA 2PYOD 1F66A 1BH9B 3AV1C 1P3ID 3B6FB 5CP6D 3AZGC 3R45A 3AZIB 1WWIA 5AV9A 1TZYD 5AV6B 4KGCA 4R8PA 3B6GC 5B1LB 3AZJA 1P3BB 4Z66B 2Y2JA 5CPIC 2J8PA 5AV5D 1KX5C 3REIA 3AZHA 3UTAB 3REKB 5B2IB 2CV5D 4G91B 3MGRA 3X1VD 2DQNC 1KX3D 2HIOB 4EO5B 1PZRA 3AZLD 5DNNC 1P3FA 4QLCB 4AWLB 1P34C 5B24A 5BT1D 4X23C 3MGSA 2FJ7B 1ZLAD 1HQ3A 5GT3C 1M19A 3AZKD 3WA9B 3O62A 1S32B 5CPKC 4H9QA 4Z5TD 4E44A 5E5AA 5B0YB 5GXQB 2YFVA 3WAAB 4LD9D 5AVCB 5GT0A 5GSUA 1B6WA 3NQUA 4ZUXD 5B1MD 4WU9B 1P3MA 3WKJD 5AY8C 3LZ1C 2NQBC 3LJAC 5B40C 2XD5A 5AVBC 5KDMA 5JRGB 4YM6A 1P3OD 4H9OA 2AROC 3LZ0C 4J8UC 3EPLA 5BNVB 5DNMD 4WU8B 3AN2C 4XUJA 4Z2MH 3MVDD 3REHC 1JFIA 4YS3A 3AZFD 3AV2B 3REJB 3UTBB 1P3AC 3UT9C 3W96C 1N1JB 4KUDC 2NZDA 3AZNC 3X1SC 4ZBJB 1A7WA 3X1UC 1KX4C 1BH8B 3KXBB 3H0RC 2PYOC 1M1AB 3AZGD 3LELD 3B6GD 1P3IC 1W2EA 5B2JC 5CP6C 4J8WD 1BH9A 1TZYC 5AV8C 3AZMD 3B6FA 3AZIA 4CSRA 5AV5C 4H9SC 3AFAB 5AV6A 4KGCD 4UUZB 5B1LA 3AZJD 5CPIB 1P3BA 4Z66A 3C1BA 1KX5B 2BYMB 3WTPB 4JJND 2CV5C 3MGQD 3AZHD 3X1VC 3UTAA 1KX3C 2Y2NA 3REKA 5B2IA 3AYWD 3B0BA 2ZY2A 4X23D 3AZLC 2LY8A 2HIOA 1Z2CB 3H0MC 2F8NG 3RELB 3P5JB 3AL0C 1ZLAC 3VH6A 4WZSB 4QLCA 3EPJA 2FJ7A 1U35D 1ULYA 3KFUG 3W99B 3VH5T 5B31C 3LZ1D 1M19D 4LD9C 2HUEC 4ZUXC 5CPKB 5B1MC 2F8ND 3WA9A 1S32A 3WKJC 1AOIB 1EQZB 5B40D 5B0YA 5GXQA 4J8VB 5AVBD 3WAAA 5AVCA 3VH6W 1P3PB 5BNXB 4J8UD 1P3OC 3LJAB 5B33C 1F1EA 2JCHA 5JRGA 3IP4C 5CPJD 2AROB 3MVDC 3UT9D 1P3LB 1R4VA 3KWQB 4KUDD 3AN2B 5BNVA 3X1SD 3AZND 1ID3C 4H9NB 4WU8A 5JA4B 5BS7A 4YS3D 2YFWB 5F99D 1P3AB 1HTAA 3VH5A 3AV2A 3REJA 3UTBA 3W96B 2ZY3A 1N1JA 1P3GB 1M18C 2NZDD 3A1IA 3X1UB 3A6NC 1KX4B 2W8SA 5B2JD 3KXBA 3LELC 4UPKA 2PYOB 5AV8D 2Y2IA 4J8WC 2ZY4A 1M1AA 1F66C 1P3IB 5CP6B 3AZMC 1P3KD 1TZYB 3VH5W 4KGCC 4R8PC 5AV5B 3AZJC 3C1CD 3MGPD 3AFAA 4UUZA 4XZQD 3MGQC 4JJNC 3AZHC 4CAYB 4J8XB 5CPIA 5B31G 1P3BD 3C1BD 2BYMA 3WTPA 3AYWC 3X1VB 3MGRC 1H3OB 3TU4D 3W98A 3X1TD 2HIOD 3B0DC 1B67A 3RELA 3KUYD 3WTPE 1U35C 3MGSC 1ZLAB 5B31D 3MNND 3AZKB 1M19C 4Z5TB 3W99A 4LD9B 1TAFA 4ZUXB 3WKJB 5CHLB 5CPKA 3AZEA 1P3MC 1AOIA 5B33D 1EQZA 1BFMA 5B0ZB 3W97B 4J8VA 1WWSA 5AVCD 4DQYB 2RIQA 1P3PA 4YM6C 1ID3D 5BO0B 5CPJC 3LJAA 5DNMB 3MVDB 3V9RA 5FUGB 4G92C 2AROA 3NQJB 4H9PB 4YS3C 1P3LA 3KWQA 3AZFB 5F99C 3AN2A 1M18D 4H9NA 3A6ND 4HGAC 5JA4A 2BG1A 2NZDC 2YFWA 5B32B 1P3AA 3VH6T 3AV2D 3REJD 1F66D 3AV1B 1P3GA 3AZGB 3X1UA 1KX4A 1KU5A 3LELB 3B6GB 5AV9D 2PYOA 4R8PD 1P3KC 3AZMB 5CP6A 3REID 3C1CC 3MGPC 1TZYA 3AZIC 4KGCB 5AV6C 4XZQC 5AV5A 3MGRD 2ZM5A 1P3BC 4DRBA 5C3IC 4Z66C 3C1BC 4JJNB 3AFAD 3MGQB 4CAYA 4J8XA 5DNNB 2UWXA 3F6TA 3REKC 4WV4B 3AYWB 1P34B 1P3FD 2BYKB 4X23B 3TU4C 5B24D 3X1TC 3MGSD
chains in the Genus database with same CATH topology
2HIOC 1H3OA 3KUYC 1HQ3D 3W98D 5GT3B 3B0DB 3MNNC 1U35B 3O62D 4KHAB 1ZLAA 2L5AA 5E5AD 5GT0D 5GSUD 4WU9A 5AY8B 1P3MD 4WNNB 3LZ1B 3AZKA 2F8NB 3EPHA 2NQBB 3WA9C 2ZY5A 4Z5TA 1S32C 4NFTA 2G5HC 5B40B 5AVBB 4ZUXA 5GXQC 3WKJA 3WAAC 5AVCC 4YM6D 3AZED 3LZ0B 4J8UB 5B0ZA 3W97A 4J8VD 3REHB 4XUJD 4Z2MG 5JRGC 5CPJB 5BO0A 3UT9B 4KUDB 3X1SB 3AZNB 5DNMA 2Y2PA 5FUGA 3NQJA 2F2AC 1BH8A 4H9PA 4DRAA 2IO5C 2Y2LA 4M6BA 5F99B 3KWQD 3AZFA 1P3LD 3AV2C 3REJC 3EG5B 3UTBC 5B32A 5B2JB 2Y2MA 5AV9C 5AV8B 3AV1A 3AZGA 1M1AC 3B6FD 3LELA 3AZID 2JE5A 3B6GA 1P3KB 5AV6D 3B0CW 3REIC 5B1LD 2Y2HA 4Z66D 1KX5A 2CV5B 3AZMA 3C1CB 1KX3B 3MGPB 4CSRB 3UTAD 4XZQB 3AFAC 3REKD 5B2ID 3AZLB 5C3IB 3C1BB 4JJNA 3MGQA 1P3FC 3WTPC 5B24C 4H9RB 4J8XD 5DNNA 3TU4B 2F8NH 3AYWA 1P34A 2BYKA 1HQ3C 4X23A 4E45A 4QLCD 3X1TB 3W98C 2FJ7D 3KUYB 3RELC 3O62C 5B31B 2FFFB 5GT3A 5E5AC 2HUEB 3MNNB 5B1MB 5GT0C 5GSUC 3WA9D 1U35A 1S32D 4KHAA 2VQRA 5B0YD 5GXQD 3WAAD 3W99C 5AY8A 4WU9D 4WNNA 3LZ1A 4NE5A 5BNXA 2CWEA 2F8NA 2RVQD 1P3OB 2NQBA 5B33B 3AZEC 5B40A 1AOIC 5AVBA 1EQZC 4J8VC 5JRGD 4XUJC 3LZ0A 4NE6A 4J8UA 1P3PC 1ID3B 1T3UA 2Y2KA 5B0ZD 3W97D 3REHA 4WU8D 2DF4C 5B32G 5CPJA 3UT9A 3W96A 3UTBD 4KUDA 3X1SA 3AZNA 1P3LC 1M18B 3A6NB 3KWQC 4WJ3C 2G5IC 5G49B 2IO5B 5F99A 3KXBD 4J8WB 1F66B 1M1AD 1P3GC 1P3IA 5B2JA 5B32D 3R45B 3B6FC 5AV9B 4R8PB 5AV8A 3AV1D 3AZJB 5B1LC 3EPKA 4H9SA 1Q9CA 2Y2OA 3REIB 3AZHB 1P3KA 3UTAC 5CPID 2CV5A 1KX5D 3MGRB 5B2IC 3C1CA 3WTPD 3MGPA 3X1VA 1KX3A 4G91C 4NE3A 4XZQA 4EO5C 3AZLA 4J8XC 1P3FB 5B24B 3RELD 3MGSB 4QLCC 4AWLC 2FJ7C 4H9RA 3B0CT 5DNND 1HQ3B 3TU4A 3W98B 1P34D 3X1TA 1M19B 3KUYA 3O62B 5BT1C 4H9QB 3W99D 5E5AB 5B31A 2YFVB 4LD9A 5GT3D 3FDDA 5GSUB 3NQUB 5GT0B 5B1MA 5B0YC 3MNNA 1P3MB 2Y2QA 4WU9C 5CPKD 1AOID 3AZKC 1EQZD 2RVQC 4Z5TC 5AY8D 1TAFB 5KDMB 4YM6B 1P3PD 3AZEB 1P3OA 2NQBD 4H9OB 5B33A 2F8NK 3LJAD 5B0ZC 3W97C 4G92B 4XUJB 3MVDA 4WU8C 1JFIB 4YS3B 5BS7C 2AROD 3LZ0D 1ID3A 2JSSA 3A1KA 4HGAB 3AN2D 3REHD 2NZDB 5DNMC 3V9RB 3KSYA 4ZBJC 2XD1A 1P3AD 3W96D 3KXBC 1M18A 3A6NA 3AZFC 1P3GD 5G49A 3X1UD 1KX4D 2Y2GA 3H0LC 5B32C 4J8WA 2PYOD 1F66A 1BH9B 3AV1C 1P3ID 3B6FB 5CP6D 3AZGC 3R45A 3AZIB 1WWIA 5AV9A 1TZYD 5AV6B 4KGCA 4R8PA 3B6GC 5B1LB 3AZJA 1P3BB 4Z66B 2Y2JA 5CPIC 2J8PA 5AV5D 1KX5C 3REIA 3AZHA 3UTAB 3REKB 5B2IB 2CV5D 4G91B 3MGRA 3X1VD 2DQNC 1KX3D 2HIOB 4EO5B 1PZRA 3AZLD 5DNNC 1P3FA 4QLCB 4AWLB 1P34C 5B24A 5BT1D 4X23C 3MGSA 2FJ7B 1ZLAD 1HQ3A 5GT3C 1M19A 3AZKD 3WA9B 3O62A 1S32B 5CPKC 4H9QA 4Z5TD 4E44A 5E5AA 5B0YB 5GXQB 2YFVA 3WAAB 4LD9D 5AVCB 5GT0A 5GSUA 1B6WA 3NQUA 4ZUXD 5B1MD 4WU9B 1P3MA 3WKJD 5AY8C 3LZ1C 2NQBC 3LJAC 5B40C 2XD5A 5AVBC 5KDMA 5JRGB 4YM6A 1P3OD 4H9OA 2AROC 3LZ0C 4J8UC 3EPLA 5BNVB 5DNMD 4WU8B 3AN2C 4XUJA 4Z2MH 3MVDD 3REHC 1JFIA 4YS3A 3AZFD 3AV2B 3REJB 3UTBB 1P3AC 3UT9C 3W96C 1N1JB 4KUDC 2NZDA 3AZNC 3X1SC 4ZBJB 1A7WA 3X1UC 1KX4C 1BH8B 3KXBB 3H0RC 2PYOC 1M1AB 3AZGD 3LELD 3B6GD 1P3IC 1W2EA 5B2JC 5CP6C 4J8WD 1BH9A 1TZYC 5AV8C 3AZMD 3B6FA 3AZIA 4CSRA 5AV5C 4H9SC 3AFAB 5AV6A 4KGCD 4UUZB 5B1LA 3AZJD 5CPIB 1P3BA 4Z66A 3C1BA 1KX5B 2BYMB 3WTPB 4JJND 2CV5C 3MGQD 3AZHD 3X1VC 3UTAA 1KX3C 2Y2NA 3REKA 5B2IA 3AYWD 3B0BA 2ZY2A 4X23D 3AZLC 2LY8A 2HIOA 1Z2CB 3H0MC 2F8NG 3RELB 3P5JB 3AL0C 1ZLAC 3VH6A 4WZSB 4QLCA 3EPJA 2FJ7A 1U35D 1ULYA 3KFUG 3W99B 3VH5T 5B31C 3LZ1D 1M19D 4LD9C 2HUEC 4ZUXC 5CPKB 5B1MC 2F8ND 3WA9A 1S32A 3WKJC 1AOIB 1EQZB 5B40D 5B0YA 5GXQA 4J8VB 5AVBD 3WAAA 5AVCA 3VH6W 1P3PB 5BNXB 4J8UD 1P3OC 3LJAB 5B33C 1F1EA 2JCHA 5JRGA 3IP4C 5CPJD 2AROB 3MVDC 3UT9D 1P3LB 1R4VA 3KWQB 4KUDD 3AN2B 5BNVA 3X1SD 3AZND 1ID3C 4H9NB 4WU8A 5JA4B 5BS7A 4YS3D 2YFWB 5F99D 1P3AB 1HTAA 3VH5A 3AV2A 3REJA 3UTBA 3W96B 2ZY3A 1N1JA 1P3GB 1M18C 2NZDD 3A1IA 3X1UB 3A6NC 1KX4B 2W8SA 5B2JD 3KXBA 3LELC 4UPKA 2PYOB 5AV8D 2Y2IA 4J8WC 2ZY4A 1M1AA 1F66C 1P3IB 5CP6B 3AZMC 1P3KD 1TZYB 3VH5W 4KGCC 4R8PC 5AV5B 3AZJC 3C1CD 3MGPD 3AFAA 4UUZA 4XZQD 3MGQC 4JJNC 3AZHC 4CAYB 4J8XB 5CPIA 5B31G 1P3BD 3C1BD 2BYMA 3WTPA 3AYWC 3X1VB 3MGRC 1H3OB 3TU4D 3W98A 3X1TD 2HIOD 3B0DC 1B67A 3RELA 3KUYD 3WTPE 1U35C 3MGSC 1ZLAB 5B31D 3MNND 3AZKB 1M19C 4Z5TB 3W99A 4LD9B 1TAFA 4ZUXB 3WKJB 5CHLB 5CPKA 3AZEA 1P3MC 1AOIA 5B33D 1EQZA 1BFMA 5B0ZB 3W97B 4J8VA 1WWSA 5AVCD 4DQYB 2RIQA 1P3PA 4YM6C 1ID3D 5BO0B 5CPJC 3LJAA 5DNMB 3MVDB 3V9RA 5FUGB 4G92C 2AROA 3NQJB 4H9PB 4YS3C 1P3LA 3KWQA 3AZFB 5F99C 3AN2A 1M18D 4H9NA 3A6ND 4HGAC 5JA4A 2BG1A 2NZDC 2YFWA 5B32B 1P3AA 3VH6T 3AV2D 3REJD 1F66D 3AV1B 1P3GA 3AZGB 3X1UA 1KX4A 1KU5A 3LELB 3B6GB 5AV9D 2PYOA 4R8PD 1P3KC 3AZMB 5CP6A 3REID 3C1CC 3MGPC 1TZYA 3AZIC 4KGCB 5AV6C 4XZQC 5AV5A 3MGRD 2ZM5A 1P3BC 4DRBA 5C3IC 4Z66C 3C1BC 4JJNB 3AFAD 3MGQB 4CAYA 4J8XA 5DNNB 2UWXA 3F6TA 3REKC 4WV4B 3AYWB 1P34B 1P3FD 2BYKB 4X23B 3TU4C 5B24D 3X1TC 3MGSD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HIO C;  1H3O A;  3KUY C;  1HQ3 D;  3W98 D;  5GT3 B;  3B0D B;  3MNN C;  1U35 B;  3O62 D;  4KHA B;  1ZLA A;  2L5A A;  5E5A D;  5GT0 D;  5GSU D;  4WU9 A;  5AY8 B;  1P3M D;  4WNN B;  3LZ1 B;  3AZK A;  2F8N B;  2NQB B;  3WA9 C;  4Z5T A;  1S32 C;  4NFT A;  5B40 B;  5AVB B;  4ZUX A;  5GXQ C;  3WKJ A;  3WAA C;  5AVC C;  4YM6 D;  3AZE D;  3LZ0 B;  4J8U B;  5B0Z A;  3W97 A;  4J8V D;  3REH B;  4XUJ D;  4Z2M G;  5JRG C;  5CPJ B;  5BO0 A;  3UT9 B;  4KUD B;  3X1S B;  3AZN B;  5DNM A;  5FUG A;  3NQJ A;  1BH8 A;  5F99 B;  4H9P A;  2IO5 C;  4M6B A;  4DRA A;  1P3L D;  3KWQ D;  3AZF A;  3AV2 C;  3REJ C;  3UTB C;  5B32 A;  5B2J B;  5AV9 C;  5AV8 B;  3AV1 A;  3AZG A;  1M1A C;  3B6F D;  3LEL A;  3AZI D;  3B6G A;  1P3K B;  5AV6 D;  3B0C W;  3REI C;  5B1L D;  4Z66 D;  1KX5 A;  2CV5 B;  3AZM A;  3C1C B;  1KX3 B;  3MGP B;  4CSR B;  3UTA D;  4XZQ B;  3AFA C;  3REK D;  5B2I D;  3AZL B;  5C3I B;  3C1B B;  4JJN A;  3MGQ A;  1P3F C;  3WTP C;  5B24 C;  4H9R B;  4J8X D;  5DNN A;  3TU4 B;  2F8N H;  3AYW A;  1P34 A;  2BYK A;  1HQ3 C;  4X23 A;  4E45 A;  4QLC D;  3X1T B;  3W98 C;  2FJ7 D;  3KUY B;  3REL C;  3O62 C;  5B31 B;  5GT3 A;  5E5A C;  2HUE B;  3MNN B;  5B1M B;  5GT0 C;  5GSU C;  3WA9 D;  1U35 A;  1S32 D;  4KHA A;  5B0Y D;  5GXQ D;  3WAA D;  3W99 C;  5AY8 A;  4WU9 D;  4WNN A;  3LZ1 A;  4NE5 A;  5BNX A;  2CWE A;  2F8N A;  2RVQ D;  1P3O B;  2NQB A;  5B33 B;  3AZE C;  5B40 A;  1AOI C;  5AVB A;  1EQZ C;  4J8V C;  5JRG D;  4XUJ C;  3LZ0 A;  4NE6 A;  4J8U A;  1P3P C;  1ID3 B;  5B0Z D;  3W97 D;  3REH A;  4WU8 D;  5B32 G;  5CPJ A;  3UT9 A;  3W96 A;  3UTB D;  4KUD A;  3X1S A;  3AZN A;  1P3L C;  1M18 B;  3A6N B;  3KWQ C;  5G49 B;  2IO5 B;  5F99 A;  3KXB D;  4J8W B;  1F66 B;  1M1A D;  1P3G C;  1P3I A;  5B2J A;  5B32 D;  3R45 B;  3B6F C;  5AV9 B;  4R8P B;  5AV8 A;  3AV1 D;  3AZJ B;  5B1L C;  4H9S A;  1Q9C A;  3REI B;  3AZH B;  1P3K A;  3UTA C;  5CPI D;  2CV5 A;  1KX5 D;  3MGR B;  5B2I C;  3C1C A;  3WTP D;  3MGP A;  3X1V A;  1KX3 A;  4G91 C;  4NE3 A;  4XZQ A;  4EO5 C;  3AZL A;  4J8X C;  1P3F B;  5B24 B;  3REL D;  3MGS B;  4QLC C;  4AWL C;  2FJ7 C;  4H9R A;  3B0C T;  5DNN D;  1HQ3 B;  3TU4 A;  3W98 B;  1P34 D;  3X1T A;  1M19 B;  3KUY A;  3O62 B;  5BT1 C;  4H9Q B;  3W99 D;  5E5A B;  5B31 A;  2YFV B;  4LD9 A;  5GT3 D;  5GT0 B;  5GSU B;  3NQU B;  5B0Y C;  5B1M A;  3MNN A;  1P3M B;  4WU9 C;  5CPK D;  1AOI D;  3AZK C;  1EQZ D;  2RVQ C;  4Z5T C;  5AY8 D;  1TAF B;  5KDM B;  4YM6 B;  1P3P D;  3AZE B;  1P3O A;  2NQB D;  4H9O B;  5B33 A;  2F8N K;  3LJA D;  5B0Z C;  3W97 C;  4G92 B;  4XUJ B;  3MVD A;  4WU8 C;  1JFI B;  4YS3 B;  5BS7 C;  2ARO D;  3LZ0 D;  1ID3 A;  2JSS A;  4HGA B;  3AN2 D;  3REH D;  2NZD B;  5DNM C;  3V9R B;  3KSY A;  4ZBJ C;  1P3A D;  3W96 D;  3KXB C;  1M18 A;  3A6N A;  3AZF C;  1P3G D;  5G49 A;  3X1U D;  1KX4 D;  5B32 C;  4J8W A;  2PYO D;  1F66 A;  1BH9 B;  3AV1 C;  1P3I D;  3B6F B;  5CP6 D;  3AZG C;  3R45 A;  3AZI B;  1WWI A;  5AV9 A;  1TZY D;  5AV6 B;  4KGC A;  4R8P A;  3B6G C;  5B1L B;  3AZJ A;  1P3B B;  4Z66 B;  5CPI C;  5AV5 D;  1KX5 C;  3REI A;  3AZH A;  3UTA B;  3REK B;  5B2I B;  2CV5 D;  4G91 B;  3MGR A;  3X1V D;  1KX3 D;  2HIO B;  4EO5 B;  3AZL D;  5DNN C;  1P3F A;  4QLC B;  4AWL B;  1P34 C;  5B24 A;  5BT1 D;  4X23 C;  3MGS A;  2FJ7 B;  1ZLA D;  1HQ3 A;  5GT3 C;  1M19 A;  3AZK D;  3WA9 B;  3O62 A;  1S32 B;  5CPK C;  4H9Q A;  4Z5T D;  4E44 A;  5E5A A;  5B0Y B;  5GXQ B;  2YFV A;  3WAA B;  4LD9 D;  5AVC B;  5GT0 A;  5GSU A;  1B6W A;  3NQU A;  4ZUX D;  5B1M D;  4WU9 B;  1P3M A;  3WKJ D;  5AY8 C;  3LZ1 C;  2NQB C;  3LJA C;  5B40 C;  5AVB C;  5KDM A;  5JRG B;  4YM6 A;  1P3O D;  4H9O A;  2ARO C;  3LZ0 C;  4J8U C;  5BNV B;  5DNM D;  4WU8 B;  3AN2 C;  4XUJ A;  4Z2M H;  3MVD D;  3REH C;  1JFI A;  4YS3 A;  3AZF D;  3AV2 B;  3REJ B;  3UTB B;  1P3A C;  3UT9 C;  3W96 C;  1N1J B;  4KUD C;  2NZD A;  3AZN C;  3X1S C;  4ZBJ B;  1A7W A;  3X1U C;  1KX4 C;  1BH8 B;  3KXB B;  2PYO C;  1M1A B;  3AZG D;  3LEL D;  3B6G D;  1P3I C;  5B2J C;  5CP6 C;  4J8W D;  1BH9 A;  1TZY C;  5AV8 C;  3AZM D;  3B6F A;  3AZI A;  4CSR A;  5AV5 C;  4H9S C;  3AFA B;  5AV6 A;  4KGC D;  4UUZ B;  5B1L A;  3AZJ D;  5CPI B;  1P3B A;  4Z66 A;  3C1B A;  1KX5 B;  2BYM B;  3WTP B;  4JJN D;  2CV5 C;  3MGQ D;  3AZH D;  3X1V C;  3UTA A;  1KX3 C;  3REK A;  5B2I A;  3AYW D;  3B0B A;  4X23 D;  3AZL C;  2LY8 A;  2HIO A;  2F8N G;  3REL B;  1ZLA C;  3VH6 A;  4WZS B;  4QLC A;  2FJ7 A;  1U35 D;  1ULY A;  3W99 B;  3VH5 T;  5B31 C;  3LZ1 D;  1M19 D;  4LD9 C;  2HUE C;  4ZUX C;  5CPK B;  5B1M C;  2F8N D;  3WA9 A;  1S32 A;  3WKJ C;  1AOI B;  1EQZ B;  5B0Y A;  5B40 D;  5GXQ A;  4J8V B;  5AVB D;  3WAA A;  5AVC A;  3VH6 W;  1P3P B;  5BNX B;  4J8U D;  1P3O C;  3LJA B;  5B33 C;  1F1E A;  5JRG A;  5CPJ D;  2ARO B;  3MVD C;  3UT9 D;  1P3L B;  1R4V A;  3KWQ B;  4KUD D;  3AN2 B;  5BNV A;  3X1S D;  3AZN D;  1ID3 C;  4H9N B;  4WU8 A;  5JA4 B;  5BS7 A;  4YS3 D;  2YFW B;  5F99 D;  1P3A B;  1HTA A;  3VH5 A;  3AV2 A;  3REJ A;  3UTB A;  3W96 B;  1N1J A;  1P3G B;  1M18 C;  2NZD D;  3X1U B;  3A6N C;  1KX4 B;  5B2J D;  3KXB A;  3LEL C;  2PYO B;  5AV8 D;  4J8W C;  1M1A A;  1F66 C;  1P3I B;  5CP6 B;  3AZM C;  1P3K D;  1TZY B;  3VH5 W;  4KGC C;  4R8P C;  5AV5 B;  3AZJ C;  3C1C D;  3MGP D;  3AFA A;  4UUZ A;  4XZQ D;  3MGQ C;  4JJN C;  3AZH C;  4CAY B;  4J8X B;  5CPI A;  5B31 G;  1P3B D;  3C1B D;  2BYM A;  3WTP A;  3AYW C;  3X1V B;  3MGR C;  1H3O B;  3TU4 D;  3W98 A;  3X1T D;  2HIO D;  3B0D C;  1B67 A;  3REL A;  3KUY D;  3WTP E;  1U35 C;  3MGS C;  1ZLA B;  5B31 D;  3MNN D;  3AZK B;  1M19 C;  4Z5T B;  3W99 A;  4LD9 B;  1TAF A;  4ZUX B;  3WKJ B;  5CHL B;  5CPK A;  3AZE A;  1P3M C;  1AOI A;  5B33 D;  1EQZ A;  1BFM A;  5B0Z B;  3W97 B;  4J8V A;  1WWS A;  5AVC D;  1P3P A;  4YM6 C;  1ID3 D;  5BO0 B;  5CPJ C;  3LJA A;  5DNM B;  3MVD B;  3V9R A;  5FUG B;  4G92 C;  2ARO A;  3NQJ B;  4H9P B;  4YS3 C;  1P3L A;  3KWQ A;  3AZF B;  5F99 C;  3AN2 A;  1M18 D;  4H9N A;  3A6N D;  4HGA C;  5JA4 A;  2NZD C;  2YFW A;  5B32 B;  1P3A A;  3VH6 T;  3AV2 D;  3REJ D;  1F66 D;  3AV1 B;  1P3G A;  3AZG B;  3X1U A;  1KX4 A;  1KU5 A;  3LEL B;  3B6G B;  5AV9 D;  2PYO A;  4R8P D;  1P3K C;  3AZM B;  5CP6 A;  3REI D;  3C1C C;  3MGP C;  1TZY A;  3AZI C;  4KGC B;  5AV6 C;  4XZQ C;  5AV5 A;  3MGR D;  1P3B C;  4DRB A;  5C3I C;  4Z66 C;  3C1B C;  4JJN B;  3AFA D;  3MGQ B;  4CAY A;  4J8X A;  5DNN B;  3REK C;  4WV4 B;  3AYW B;  1P34 B;  1P3F D;  2BYK B;  4X23 B;  3TU4 C;  5B24 D;  3X1T C;  3MGS D; 
#chains in the Genus database with same CATH topology
 2HIO C;  1H3O A;  3KUY C;  1HQ3 D;  3W98 D;  5GT3 B;  3B0D B;  3MNN C;  1U35 B;  3O62 D;  4KHA B;  1ZLA A;  2L5A A;  5E5A D;  5GT0 D;  5GSU D;  4WU9 A;  5AY8 B;  1P3M D;  4WNN B;  3LZ1 B;  3AZK A;  2F8N B;  3EPH A;  2NQB B;  3WA9 C;  2ZY5 A;  4Z5T A;  1S32 C;  4NFT A;  2G5H C;  5B40 B;  5AVB B;  4ZUX A;  5GXQ C;  3WKJ A;  3WAA C;  5AVC C;  4YM6 D;  3AZE D;  3LZ0 B;  4J8U B;  5B0Z A;  3W97 A;  4J8V D;  3REH B;  4XUJ D;  4Z2M G;  5JRG C;  5CPJ B;  5BO0 A;  3UT9 B;  4KUD B;  3X1S B;  3AZN B;  5DNM A;  2Y2P A;  5FUG A;  3NQJ A;  2F2A C;  1BH8 A;  4H9P A;  4DRA A;  2IO5 C;  2Y2L A;  4M6B A;  5F99 B;  3KWQ D;  3AZF A;  1P3L D;  3AV2 C;  3REJ C;  3EG5 B;  3UTB C;  5B32 A;  5B2J B;  2Y2M A;  5AV9 C;  5AV8 B;  3AV1 A;  3AZG A;  1M1A C;  3B6F D;  3LEL A;  3AZI D;  2JE5 A;  3B6G A;  1P3K B;  5AV6 D;  3B0C W;  3REI C;  5B1L D;  2Y2H A;  4Z66 D;  1KX5 A;  2CV5 B;  3AZM A;  3C1C B;  1KX3 B;  3MGP B;  4CSR B;  3UTA D;  4XZQ B;  3AFA C;  3REK D;  5B2I D;  3AZL B;  5C3I B;  3C1B B;  4JJN A;  3MGQ A;  1P3F C;  3WTP C;  5B24 C;  4H9R B;  4J8X D;  5DNN A;  3TU4 B;  2F8N H;  3AYW A;  1P34 A;  2BYK A;  1HQ3 C;  4X23 A;  4E45 A;  4QLC D;  3X1T B;  3W98 C;  2FJ7 D;  3KUY B;  3REL C;  3O62 C;  5B31 B;  2FFF B;  5GT3 A;  5E5A C;  2HUE B;  3MNN B;  5B1M B;  5GT0 C;  5GSU C;  3WA9 D;  1U35 A;  1S32 D;  4KHA A;  2VQR A;  5B0Y D;  5GXQ D;  3WAA D;  3W99 C;  5AY8 A;  4WU9 D;  4WNN A;  3LZ1 A;  4NE5 A;  5BNX A;  2CWE A;  2F8N A;  2RVQ D;  1P3O B;  2NQB A;  5B33 B;  3AZE C;  5B40 A;  1AOI C;  5AVB A;  1EQZ C;  4J8V C;  5JRG D;  4XUJ C;  3LZ0 A;  4NE6 A;  4J8U A;  1P3P C;  1ID3 B;  1T3U A;  2Y2K A;  5B0Z D;  3W97 D;  3REH A;  4WU8 D;  2DF4 C;  5B32 G;  5CPJ A;  3UT9 A;  3W96 A;  3UTB D;  4KUD A;  3X1S A;  3AZN A;  1P3L C;  1M18 B;  3A6N B;  3KWQ C;  4WJ3 C;  2G5I C;  5G49 B;  2IO5 B;  5F99 A;  3KXB D;  4J8W B;  1F66 B;  1M1A D;  1P3G C;  1P3I A;  5B2J A;  5B32 D;  3R45 B;  3B6F C;  5AV9 B;  4R8P B;  5AV8 A;  3AV1 D;  3AZJ B;  5B1L C;  3EPK A;  4H9S A;  1Q9C A;  2Y2O A;  3REI B;  3AZH B;  1P3K A;  3UTA C;  5CPI D;  2CV5 A;  1KX5 D;  3MGR B;  5B2I C;  3C1C A;  3WTP D;  3MGP A;  3X1V A;  1KX3 A;  4G91 C;  4NE3 A;  4XZQ A;  4EO5 C;  3AZL A;  4J8X C;  1P3F B;  5B24 B;  3REL D;  3MGS B;  4QLC C;  4AWL C;  2FJ7 C;  4H9R A;  3B0C T;  5DNN D;  1HQ3 B;  3TU4 A;  3W98 B;  1P34 D;  3X1T A;  1M19 B;  3KUY A;  3O62 B;  5BT1 C;  4H9Q B;  3W99 D;  5E5A B;  5B31 A;  2YFV B;  4LD9 A;  5GT3 D;  3FDD A;  5GSU B;  3NQU B;  5GT0 B;  5B1M A;  5B0Y C;  3MNN A;  1P3M B;  2Y2Q A;  4WU9 C;  5CPK D;  1AOI D;  3AZK C;  1EQZ D;  2RVQ C;  4Z5T C;  5AY8 D;  1TAF B;  5KDM B;  4YM6 B;  1P3P D;  3AZE B;  1P3O A;  2NQB D;  4H9O B;  5B33 A;  2F8N K;  3LJA D;  5B0Z C;  3W97 C;  4G92 B;  4XUJ B;  3MVD A;  4WU8 C;  1JFI B;  4YS3 B;  5BS7 C;  2ARO D;  3LZ0 D;  1ID3 A;  2JSS A;  3A1K A;  4HGA B;  3AN2 D;  3REH D;  2NZD B;  5DNM C;  3V9R B;  3KSY A;  4ZBJ C;  2XD1 A;  1P3A D;  3W96 D;  3KXB C;  1M18 A;  3A6N A;  3AZF C;  1P3G D;  5G49 A;  3X1U D;  1KX4 D;  2Y2G A;  3H0L C;  5B32 C;  4J8W A;  2PYO D;  1F66 A;  1BH9 B;  3AV1 C;  1P3I D;  3B6F B;  5CP6 D;  3AZG C;  3R45 A;  3AZI B;  1WWI A;  5AV9 A;  1TZY D;  5AV6 B;  4KGC A;  4R8P A;  3B6G C;  5B1L B;  3AZJ A;  1P3B B;  4Z66 B;  2Y2J A;  5CPI C;  2J8P A;  5AV5 D;  1KX5 C;  3REI A;  3AZH A;  3UTA B;  3REK B;  5B2I B;  2CV5 D;  4G91 B;  3MGR A;  3X1V D;  2DQN C;  1KX3 D;  2HIO B;  4EO5 B;  1PZR A;  3AZL D;  5DNN C;  1P3F A;  4QLC B;  4AWL B;  1P34 C;  5B24 A;  5BT1 D;  4X23 C;  3MGS A;  2FJ7 B;  1ZLA D;  1HQ3 A;  5GT3 C;  1M19 A;  3AZK D;  3WA9 B;  3O62 A;  1S32 B;  5CPK C;  4H9Q A;  4Z5T D;  4E44 A;  5E5A A;  5B0Y B;  5GXQ B;  2YFV A;  3WAA B;  4LD9 D;  5AVC B;  5GT0 A;  5GSU A;  1B6W A;  3NQU A;  4ZUX D;  5B1M D;  4WU9 B;  1P3M A;  3WKJ D;  5AY8 C;  3LZ1 C;  2NQB C;  3LJA C;  5B40 C;  2XD5 A;  5AVB C;  5KDM A;  5JRG B;  4YM6 A;  1P3O D;  4H9O A;  2ARO C;  3LZ0 C;  4J8U C;  3EPL A;  5BNV B;  5DNM D;  4WU8 B;  3AN2 C;  4XUJ A;  4Z2M H;  3MVD D;  3REH C;  1JFI A;  4YS3 A;  3AZF D;  3AV2 B;  3REJ B;  3UTB B;  1P3A C;  3UT9 C;  3W96 C;  1N1J B;  4KUD C;  2NZD A;  3AZN C;  3X1S C;  4ZBJ B;  1A7W A;  3X1U C;  1KX4 C;  1BH8 B;  3KXB B;  3H0R C;  2PYO C;  1M1A B;  3AZG D;  3LEL D;  3B6G D;  1P3I C;  1W2E A;  5B2J C;  5CP6 C;  4J8W D;  1BH9 A;  1TZY C;  5AV8 C;  3AZM D;  3B6F A;  3AZI A;  4CSR A;  5AV5 C;  4H9S C;  3AFA B;  5AV6 A;  4KGC D;  4UUZ B;  5B1L A;  3AZJ D;  5CPI B;  1P3B A;  4Z66 A;  3C1B A;  1KX5 B;  2BYM B;  3WTP B;  4JJN D;  2CV5 C;  3MGQ D;  3AZH D;  3X1V C;  3UTA A;  1KX3 C;  2Y2N A;  3REK A;  5B2I A;  3AYW D;  3B0B A;  2ZY2 A;  4X23 D;  3AZL C;  2LY8 A;  2HIO A;  1Z2C B;  3H0M C;  2F8N G;  3REL B;  3P5J B;  3AL0 C;  1ZLA C;  3VH6 A;  4WZS B;  4QLC A;  3EPJ A;  2FJ7 A;  1U35 D;  1ULY A;  3KFU G;  3W99 B;  3VH5 T;  5B31 C;  3LZ1 D;  1M19 D;  4LD9 C;  2HUE C;  4ZUX C;  5CPK B;  5B1M C;  2F8N D;  3WA9 A;  1S32 A;  3WKJ C;  1AOI B;  1EQZ B;  5B40 D;  5B0Y A;  5GXQ A;  4J8V B;  5AVB D;  3WAA A;  5AVC A;  3VH6 W;  1P3P B;  5BNX B;  4J8U D;  1P3O C;  3LJA B;  5B33 C;  1F1E A;  2JCH A;  5JRG A;  3IP4 C;  5CPJ D;  2ARO B;  3MVD C;  3UT9 D;  1P3L B;  1R4V A;  3KWQ B;  4KUD D;  3AN2 B;  5BNV A;  3X1S D;  3AZN D;  1ID3 C;  4H9N B;  4WU8 A;  5JA4 B;  5BS7 A;  4YS3 D;  2YFW B;  5F99 D;  1P3A B;  1HTA A;  3VH5 A;  3AV2 A;  3REJ A;  3UTB A;  3W96 B;  2ZY3 A;  1N1J A;  1P3G B;  1M18 C;  2NZD D;  3A1I A;  3X1U B;  3A6N C;  1KX4 B;  2W8S A;  5B2J D;  3KXB A;  3LEL C;  4UPK A;  2PYO B;  5AV8 D;  2Y2I A;  4J8W C;  2ZY4 A;  1M1A A;  1F66 C;  1P3I B;  5CP6 B;  3AZM C;  1P3K D;  1TZY B;  3VH5 W;  4KGC C;  4R8P C;  5AV5 B;  3AZJ C;  3C1C D;  3MGP D;  3AFA A;  4UUZ A;  4XZQ D;  3MGQ C;  4JJN C;  3AZH C;  4CAY B;  4J8X B;  5CPI A;  5B31 G;  1P3B D;  3C1B D;  2BYM A;  3WTP A;  3AYW C;  3X1V B;  3MGR C;  1H3O B;  3TU4 D;  3W98 A;  3X1T D;  2HIO D;  3B0D C;  1B67 A;  3REL A;  3KUY D;  3WTP E;  1U35 C;  3MGS C;  1ZLA B;  5B31 D;  3MNN D;  3AZK B;  1M19 C;  4Z5T B;  3W99 A;  4LD9 B;  1TAF A;  4ZUX B;  3WKJ B;  5CHL B;  5CPK A;  3AZE A;  1P3M C;  1AOI A;  5B33 D;  1EQZ A;  1BFM A;  5B0Z B;  3W97 B;  4J8V A;  1WWS A;  5AVC D;  4DQY B;  2RIQ A;  1P3P A;  4YM6 C;  1ID3 D;  5BO0 B;  5CPJ C;  3LJA A;  5DNM B;  3MVD B;  3V9R A;  5FUG B;  4G92 C;  2ARO A;  3NQJ B;  4H9P B;  4YS3 C;  1P3L A;  3KWQ A;  3AZF B;  5F99 C;  3AN2 A;  1M18 D;  4H9N A;  3A6N D;  4HGA C;  5JA4 A;  2BG1 A;  2NZD C;  2YFW A;  5B32 B;  1P3A A;  3VH6 T;  3AV2 D;  3REJ D;  1F66 D;  3AV1 B;  1P3G A;  3AZG B;  3X1U A;  1KX4 A;  1KU5 A;  3LEL B;  3B6G B;  5AV9 D;  2PYO A;  4R8P D;  1P3K C;  3AZM B;  5CP6 A;  3REI D;  3C1C C;  3MGP C;  1TZY A;  3AZI C;  4KGC B;  5AV6 C;  4XZQ C;  5AV5 A;  3MGR D;  2ZM5 A;  1P3B C;  4DRB A;  5C3I C;  4Z66 C;  3C1B C;  4JJN B;  3AFA D;  3MGQ B;  4CAY A;  4J8X A;  5DNN B;  2UWX A;  3F6T A;  3REK C;  4WV4 B;  3AYW B;  1P34 B;  1P3F D;  2BYK B;  4X23 B;  3TU4 C;  5B24 D;  3X1T C;  3MGS D; 
#chains in the Genus database with same CATH homology
 2HIO C;  1H3O A;  3KUY C;  1HQ3 D;  3W98 D;  5GT3 B;  3B0D B;  3MNN C;  1U35 B;  3O62 D;  4KHA B;  1ZLA A;  2L5A A;  5E5A D;  5GT0 D;  5GSU D;  4WU9 A;  5AY8 B;  1P3M D;  4WNN B;  3LZ1 B;  3AZK A;  2F8N B;  3EPH A;  2NQB B;  3WA9 C;  2ZY5 A;  4Z5T A;  1S32 C;  4NFT A;  2G5H C;  5B40 B;  5AVB B;  4ZUX A;  5GXQ C;  3WKJ A;  3WAA C;  5AVC C;  4YM6 D;  3AZE D;  3LZ0 B;  4J8U B;  5B0Z A;  3W97 A;  4J8V D;  3REH B;  4XUJ D;  4Z2M G;  5JRG C;  5CPJ B;  5BO0 A;  3UT9 B;  4KUD B;  3X1S B;  3AZN B;  5DNM A;  2Y2P A;  5FUG A;  3NQJ A;  2F2A C;  1BH8 A;  4H9P A;  4DRA A;  2IO5 C;  2Y2L A;  4M6B A;  5F99 B;  3KWQ D;  3AZF A;  1P3L D;  3AV2 C;  3REJ C;  3EG5 B;  3UTB C;  5B32 A;  5B2J B;  2Y2M A;  5AV9 C;  5AV8 B;  3AV1 A;  3AZG A;  1M1A C;  3B6F D;  3LEL A;  3AZI D;  2JE5 A;  3B6G A;  1P3K B;  5AV6 D;  3B0C W;  3REI C;  5B1L D;  2Y2H A;  4Z66 D;  1KX5 A;  2CV5 B;  3AZM A;  3C1C B;  1KX3 B;  3MGP B;  4CSR B;  3UTA D;  4XZQ B;  3AFA C;  3REK D;  5B2I D;  3AZL B;  5C3I B;  3C1B B;  4JJN A;  3MGQ A;  1P3F C;  3WTP C;  5B24 C;  4H9R B;  4J8X D;  5DNN A;  3TU4 B;  2F8N H;  3AYW A;  1P34 A;  2BYK A;  1HQ3 C;  4X23 A;  4E45 A;  4QLC D;  3X1T B;  3W98 C;  2FJ7 D;  3KUY B;  3REL C;  3O62 C;  5B31 B;  2FFF B;  5GT3 A;  5E5A C;  2HUE B;  3MNN B;  5B1M B;  5GT0 C;  5GSU C;  3WA9 D;  1U35 A;  1S32 D;  4KHA A;  2VQR A;  5B0Y D;  5GXQ D;  3WAA D;  3W99 C;  5AY8 A;  4WU9 D;  4WNN A;  3LZ1 A;  4NE5 A;  5BNX A;  2CWE A;  2F8N A;  2RVQ D;  1P3O B;  2NQB A;  5B33 B;  3AZE C;  5B40 A;  1AOI C;  5AVB A;  1EQZ C;  4J8V C;  5JRG D;  4XUJ C;  3LZ0 A;  4NE6 A;  4J8U A;  1P3P C;  1ID3 B;  1T3U A;  2Y2K A;  5B0Z D;  3W97 D;  3REH A;  4WU8 D;  2DF4 C;  5B32 G;  5CPJ A;  3UT9 A;  3W96 A;  3UTB D;  4KUD A;  3X1S A;  3AZN A;  1P3L C;  1M18 B;  3A6N B;  3KWQ C;  4WJ3 C;  2G5I C;  5G49 B;  2IO5 B;  5F99 A;  3KXB D;  4J8W B;  1F66 B;  1M1A D;  1P3G C;  1P3I A;  5B2J A;  5B32 D;  3R45 B;  3B6F C;  5AV9 B;  4R8P B;  5AV8 A;  3AV1 D;  3AZJ B;  5B1L C;  3EPK A;  4H9S A;  1Q9C A;  2Y2O A;  3REI B;  3AZH B;  1P3K A;  3UTA C;  5CPI D;  2CV5 A;  1KX5 D;  3MGR B;  5B2I C;  3C1C A;  3WTP D;  3MGP A;  3X1V A;  1KX3 A;  4G91 C;  4NE3 A;  4XZQ A;  4EO5 C;  3AZL A;  4J8X C;  1P3F B;  5B24 B;  3REL D;  3MGS B;  4QLC C;  4AWL C;  2FJ7 C;  4H9R A;  3B0C T;  5DNN D;  1HQ3 B;  3TU4 A;  3W98 B;  1P34 D;  3X1T A;  1M19 B;  3KUY A;  3O62 B;  5BT1 C;  4H9Q B;  3W99 D;  5E5A B;  5B31 A;  2YFV B;  4LD9 A;  5GT3 D;  3FDD A;  5GSU B;  3NQU B;  5GT0 B;  5B1M A;  5B0Y C;  3MNN A;  1P3M B;  2Y2Q A;  4WU9 C;  5CPK D;  1AOI D;  3AZK C;  1EQZ D;  2RVQ C;  4Z5T C;  5AY8 D;  1TAF B;  5KDM B;  4YM6 B;  1P3P D;  3AZE B;  1P3O A;  2NQB D;  4H9O B;  5B33 A;  2F8N K;  3LJA D;  5B0Z C;  3W97 C;  4G92 B;  4XUJ B;  3MVD A;  4WU8 C;  1JFI B;  4YS3 B;  5BS7 C;  2ARO D;  3LZ0 D;  1ID3 A;  2JSS A;  3A1K A;  4HGA B;  3AN2 D;  3REH D;  2NZD B;  5DNM C;  3V9R B;  3KSY A;  4ZBJ C;  2XD1 A;  1P3A D;  3W96 D;  3KXB C;  1M18 A;  3A6N A;  3AZF C;  1P3G D;  5G49 A;  3X1U D;  1KX4 D;  2Y2G A;  3H0L C;  5B32 C;  4J8W A;  2PYO D;  1F66 A;  1BH9 B;  3AV1 C;  1P3I D;  3B6F B;  5CP6 D;  3AZG C;  3R45 A;  3AZI B;  1WWI A;  5AV9 A;  1TZY D;  5AV6 B;  4KGC A;  4R8P A;  3B6G C;  5B1L B;  3AZJ A;  1P3B B;  4Z66 B;  2Y2J A;  5CPI C;  2J8P A;  5AV5 D;  1KX5 C;  3REI A;  3AZH A;  3UTA B;  3REK B;  5B2I B;  2CV5 D;  4G91 B;  3MGR A;  3X1V D;  2DQN C;  1KX3 D;  2HIO B;  4EO5 B;  1PZR A;  3AZL D;  5DNN C;  1P3F A;  4QLC B;  4AWL B;  1P34 C;  5B24 A;  5BT1 D;  4X23 C;  3MGS A;  2FJ7 B;  1ZLA D;  1HQ3 A;  5GT3 C;  1M19 A;  3AZK D;  3WA9 B;  3O62 A;  1S32 B;  5CPK C;  4H9Q A;  4Z5T D;  4E44 A;  5E5A A;  5B0Y B;  5GXQ B;  2YFV A;  3WAA B;  4LD9 D;  5AVC B;  5GT0 A;  5GSU A;  1B6W A;  3NQU A;  4ZUX D;  5B1M D;  4WU9 B;  1P3M A;  3WKJ D;  5AY8 C;  3LZ1 C;  2NQB C;  3LJA C;  5B40 C;  2XD5 A;  5AVB C;  5KDM A;  5JRG B;  4YM6 A;  1P3O D;  4H9O A;  2ARO C;  3LZ0 C;  4J8U C;  3EPL A;  5BNV B;  5DNM D;  4WU8 B;  3AN2 C;  4XUJ A;  4Z2M H;  3MVD D;  3REH C;  1JFI A;  4YS3 A;  3AZF D;  3AV2 B;  3REJ B;  3UTB B;  1P3A C;  3UT9 C;  3W96 C;  1N1J B;  4KUD C;  2NZD A;  3AZN C;  3X1S C;  4ZBJ B;  1A7W A;  3X1U C;  1KX4 C;  1BH8 B;  3KXB B;  3H0R C;  2PYO C;  1M1A B;  3AZG D;  3LEL D;  3B6G D;  1P3I C;  1W2E A;  5B2J C;  5CP6 C;  4J8W D;  1BH9 A;  1TZY C;  5AV8 C;  3AZM D;  3B6F A;  3AZI A;  4CSR A;  5AV5 C;  4H9S C;  3AFA B;  5AV6 A;  4KGC D;  4UUZ B;  5B1L A;  3AZJ D;  5CPI B;  1P3B A;  4Z66 A;  3C1B A;  1KX5 B;  2BYM B;  3WTP B;  4JJN D;  2CV5 C;  3MGQ D;  3AZH D;  3X1V C;  3UTA A;  1KX3 C;  2Y2N A;  3REK A;  5B2I A;  3AYW D;  3B0B A;  2ZY2 A;  4X23 D;  3AZL C;  2LY8 A;  2HIO A;  1Z2C B;  3H0M C;  2F8N G;  3REL B;  3P5J B;  3AL0 C;  1ZLA C;  3VH6 A;  4WZS B;  4QLC A;  3EPJ A;  2FJ7 A;  1U35 D;  1ULY A;  3KFU G;  3W99 B;  3VH5 T;  5B31 C;  3LZ1 D;  1M19 D;  4LD9 C;  2HUE C;  4ZUX C;  5CPK B;  5B1M C;  2F8N D;  3WA9 A;  1S32 A;  3WKJ C;  1AOI B;  1EQZ B;  5B40 D;  5B0Y A;  5GXQ A;  4J8V B;  5AVB D;  3WAA A;  5AVC A;  3VH6 W;  1P3P B;  5BNX B;  4J8U D;  1P3O C;  3LJA B;  5B33 C;  1F1E A;  2JCH A;  5JRG A;  3IP4 C;  5CPJ D;  2ARO B;  3MVD C;  3UT9 D;  1P3L B;  1R4V A;  3KWQ B;  4KUD D;  3AN2 B;  5BNV A;  3X1S D;  3AZN D;  1ID3 C;  4H9N B;  4WU8 A;  5JA4 B;  5BS7 A;  4YS3 D;  2YFW B;  5F99 D;  1P3A B;  1HTA A;  3VH5 A;  3AV2 A;  3REJ A;  3UTB A;  3W96 B;  2ZY3 A;  1N1J A;  1P3G B;  1M18 C;  2NZD D;  3A1I A;  3X1U B;  3A6N C;  1KX4 B;  2W8S A;  5B2J D;  3KXB A;  3LEL C;  4UPK A;  2PYO B;  5AV8 D;  2Y2I A;  4J8W C;  2ZY4 A;  1M1A A;  1F66 C;  1P3I B;  5CP6 B;  3AZM C;  1P3K D;  1TZY B;  3VH5 W;  4KGC C;  4R8P C;  5AV5 B;  3AZJ C;  3C1C D;  3MGP D;  3AFA A;  4UUZ A;  4XZQ D;  3MGQ C;  4JJN C;  3AZH C;  4CAY B;  4J8X B;  5CPI A;  5B31 G;  1P3B D;  3C1B D;  2BYM A;  3WTP A;  3AYW C;  3X1V B;  3MGR C;  1H3O B;  3TU4 D;  3W98 A;  3X1T D;  2HIO D;  3B0D C;  1B67 A;  3REL A;  3KUY D;  3WTP E;  1U35 C;  3MGS C;  1ZLA B;  5B31 D;  3MNN D;  3AZK B;  1M19 C;  4Z5T B;  3W99 A;  4LD9 B;  1TAF A;  4ZUX B;  3WKJ B;  5CHL B;  5CPK A;  3AZE A;  1P3M C;  1AOI A;  5B33 D;  1EQZ A;  1BFM A;  5B0Z B;  3W97 B;  4J8V A;  1WWS A;  5AVC D;  4DQY B;  2RIQ A;  1P3P A;  4YM6 C;  1ID3 D;  5BO0 B;  5CPJ C;  3LJA A;  5DNM B;  3MVD B;  3V9R A;  5FUG B;  4G92 C;  2ARO A;  3NQJ B;  4H9P B;  4YS3 C;  1P3L A;  3KWQ A;  3AZF B;  5F99 C;  3AN2 A;  1M18 D;  4H9N A;  3A6N D;  4HGA C;  5JA4 A;  2BG1 A;  2NZD C;  2YFW A;  5B32 B;  1P3A A;  3VH6 T;  3AV2 D;  3REJ D;  1F66 D;  3AV1 B;  1P3G A;  3AZG B;  3X1U A;  1KX4 A;  1KU5 A;  3LEL B;  3B6G B;  5AV9 D;  2PYO A;  4R8P D;  1P3K C;  3AZM B;  5CP6 A;  3REI D;  3C1C C;  3MGP C;  1TZY A;  3AZI C;  4KGC B;  5AV6 C;  4XZQ C;  5AV5 A;  3MGR D;  2ZM5 A;  1P3B C;  4DRB A;  5C3I C;  4Z66 C;  3C1B C;  4JJN B;  3AFA D;  3MGQ B;  4CAY A;  4J8X A;  5DNN B;  2UWX A;  3F6T A;  3REK C;  4WV4 B;  3AYW B;  1P34 B;  1P3F D;  2BYK B;  4X23 B;  3TU4 C;  5B24 D;  3X1T C;  3MGS D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...