4J8UD

X-ray structure of ncp145 with chlorido(eta-6-p-cymene)(n-phenyl-2-pyridinecarbothioamide)osmium(ii)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
95
structure length
95
Chain Sequence
KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Novel metal(II) arene 2-pyridinecarbothioamides: a rationale to orally active organometallic anticancer agents
doi rcsb
source organism Xenopus laevis
total genus 37
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4j8uD00
4CSRB 3B0DB 5CPIA 3AFAC 4WNNB 4Z2MG 3AV1D 4JJNA 4J8VA 3W98C 4ZUXD 4CSRA 3AFAB 3W98B 5B24D 4WU8C 3W99B 4WU8B 5AV5C 3W99A 2CV5D 3TU4B 5E5AC 3WAAC 5AV5B 5AVCD 4DRBA 1ZLAD 5E5AB 3WAAB 3MGQC 3TU4A 3B0CW 3MGQB 2HIOA 3B6GD 3B6FD 5AY8D 1KX3D 3AYWC 5B31D 4WU9D 1P3FD 4XUJA 5KDMB 3B0CT 3REHA 5AV6D 3AZGA 3AZNC 3AYWB 3AZNB 5KDMA 3AYWA 4R8PD 5B40C 2YFWB 2NZDD 5CPKD 2FJ7D 5GT3D 5B40B 1HTAA 2AROD 5B0YA 1P3AC 3W97C 3AZFC 3O62C 1P3AB 3AZFB 3O62B 5CPID 3UTBC 4J8VD 3MGRB 4J8XC 3UTBB 3O62A 3AV2C 4H9NB 4J8XB 3MGRA 3AV2B 3UTBA 3RELA 3AN2A 3W99D 4H9NA 4J8XA 1P3GA 5AV8C 5JRGC 3KWQD 4KHAA 3MGSC 5AV8B 3TU4D 5GXQC 5G49B 1P3IB 4CAYB 4E44A 3KSYA 5BNXA 5GXQB 1B67A 2HIOD 1P3IA 1M18A 5AVBC 5B33C 3WKJA 5AVBB 3AZEA 4X23A 5B33B 4XUJD 3C1BC 4G92C 3REHD 3AZGD 4XZQA 3C1BB 4G92B 3REIB 3AYWD 3C1BA 3REIA 3AZJB 3AZJA 5B32G 5F99C 5B0YD 3VH6A 5F99B 3AZHA 5DNMC 5GSUC 4YM6D 4EO5C 5DNMB 3X1SA 3O62D 5GSUB 3AZIA 1P3BB 1H3OB 4EO5B 1HQ3C 3MGRD 3UTBD 1HQ3B 5GSUA 3UTAC 1P3BA 1H3OA 3RELD 3AN2D 5CP6C 4J8XD 1P34D 1P3GD 3R45B 3UTAB 4HGAC 1KX4C 1AOIA 4HGAB 3UTAA 4H9RA 1KX5C 3V9RA 1P3ID 1TZYC 1M18D 1KX5B 4J8WA 3WKJD 3AZED 2RVQD 4X23D 3AZMA 2PYOA 4XZQD 1TAFB 4YS3B 3X1TC 3MVDA 2F8NA 3X1TB 1BH9B 1TAFA 4YS3A 3X1VB 3A6NC 3REID 2NQBC 2JSSA 1BH8B 1WWSA 1M1AA 1BH9A 3A6NB 2NQBB 3X1VA 4Z2MH 5BS7A 5B31G 3AZJD 1BH8A 3W96A 2CWEA 4G91C 1F66A 4G91B 3AZHD 3MGPA 4KGCC 5CPJC 4KGCB 3NQUA 3X1SD 5CPJB 3AZID 1P3MC 1U35C 4WNNA 4NE6A 5GSUD 1P3MB 1P3BD 3AFAA 5B1MC 4UUZB 3W98A 1P3MA 1AOID 5B1MB 4WU8A 3X1UC 1N1JB 1P3LC 4QLCC 3X1UB 5AV5A 5B0ZC 1P3LB 4QLCB 1N1JA 5E5AA 3WAAA 4J8WD 1A7WA 3MGQA 3KXBC 4DRAA 3AZLD 3AZMD 5B2JC 3KXBB 2PYOD 3MNND 1F1EA 4J8UC 5B2JB 3MVDD 3C1CC 4J8UB 2F8ND 3LZ1C 4YS3D 3C1CB 3LZ1B 4Z5TC 1M1AD 5B2IC 3AZNA 4Z5TB 3X1VD 3WA9D 4H9PB 3AZKC 5B2IB 3W96D 5GT0C 3AZKB 1KU5A 3VH6W 1P3KC 2YFWA 5GT0B 1F66D 5B40A 1P3KB 2BYKB 3MGPD 3W97B 1P3PC 5B1LC 1ID3C 2BYKA 1S32C 2F8NK 4JJND 4AWLC 5B1LB 3KUYC 3W97A 1S32B 1P3AA 3VH6T 3AZFA 1P3PB 1ID3B 4WV4B 4AWLB 3KUYB 1ID3A 5B1LA 3AFAD 3W98D 4NE5A 3AV2A 4WU8D 5DNNC 1M19C 5JRGB 3MGSB 5AV5D 3LELC 5DNNB 1M19B 5E5AD 1EQZC 3WAAD 5AV8A 5JRGA 3LELB 3REJC 3MGSA 5DNNA 5G49A 1EQZB 3MGQD 2BYMB 1M19A 4CAYA 3REJB 5C3IC 5GXQA 3VH5A 3UT9C 4KUDC 5C3IB 3UT9B 4KUDB 5AVBA 5BT1C 5B33A 3LZ0C 3AZND 3LZ0B 5B40D 5AV9C 5B32C 5F99A 5AV9B 1P3AD 3W97D 5B32B 3AZFD 5DNMA 3REKC 4H9QB 3WTPC 3REKB 3LJAC 3AV2D 1P3OC 3WTPB 4H9QA 1HQ3A 5CP6B 4LD9C 3LJAB 1P3OB 1KX4B 3R45A 4LD9B 3WTPA 5CP6A 5AV8D 5JRGD 1KX4A 3MGSD 3AV1C 4ZUXC 5GXQD 1TZYB 4ZUXB 5B24C 1KX5A 5B24B 1TZYA 5AVBD 2CV5C 5B33D 5AVCC 2CV5B 1ZLAC 2YFVB 3C1BD 1ZLAB 2CV5A 3X1TA 1ZLAA 4H9OB 3A6NA 2F8NG 2NQBA 3B6FC 2LY8A 5AY8C 1KX3C 3B6GC 4H9OA 3B6FB 3B6GB 5AY8B 1KX3B 5B31C 3WTPE 4WU9C 5F99D 5AV6C 4WU9B 3B6FA 5AY8A 5AV6B 4R8PC 5DNMD 4KGCA 5CPJA 4R8PB 1U35B 2NZDC 5CPKC 2FJ7C 5GT3C 1HQ3D 2L5AA 5CPKB 2NZDB 2FJ7B 2AROC 5GT3B 1U35A 4UUZA 1Q9CA 3UTAD 2AROB 5CP6D 5B1MA 5CPKA 5CPIC 1KX4D 4J8VC 5B0ZB 3X1UA 5CPIB 3VH5W 1P3LA 4J8VB 4QLCA 1KX5D 5B0ZA 1TZYD 5CHLB 5JA4B 3W99C 3KXBA 3KWQC 5JA4A 1JFIB 5B2JA 3VH5T 3KWQB 3TU4C 3B0BA 4J8UA 1JFIA 3X1TD 3C1CA 3KWQA 2HIOC 3LZ1A 3A6ND 2NQBD 2HIOB 4Z5TA 4H9PA 5B2IA 3AZKA 4XUJC 3REHC 3AZGC 5GT0A 4XUJB 1P3KA 3REHB 3AZGB 1B6WA 4KGCD 5CPJD 1P3PA 1S32A 5BO0B 1P3MD 3KUYA 1U35D 5BO0A 5B0YC 5B1MD 2HUEC 4E45A 5B0YB 2HUEB 4YM6C 3X1UD 1P3LD 4QLCD 4YM6B 4NFTA 3LELA 5B0ZD 4Z66C 3MGRC 1EQZA 2BYMA 4YM6A 3REJA 3RELC 4Z66B 3AN2C 1P34C 1P3GC 3KXBD 3RELB 3AN2B 1P34B 1P3GB 4Z66A 5B2JD 3UT9A 2IO5C 4KHAB 4KUDA 4J8UD 1P34A 1ULYA 2IO5B 4H9SC 3C1CD 5BNVB 3LZ1D 1P3IC 5BNXB 1M18C 4Z5TD 5BNVA 3LZ0A 1M18B 3WKJC 5B2ID 4WZSB 2RVQC 4H9SA 4X23C 3AZEC 3AZKD 3WKJB 3AZEB 4XZQC 5GT0D 4X23B 1P3KD 4XZQB 3REIC 1P3PD 5B1LD 5AV9A 1S32D 1ID3D 5B32A 3KUYD 3AZJC 1BFMA 3REKA 3AZHC 3LJAA 3AZHB 1P3OA 1WWIA 3X1SC 5DNND 4LD9A 3AZIC 1M19D 3LELD 3X1SB 3AV1B 3AZIB 1EQZD 1P3BC 3REJD 3AV1A 4ZUXA 1AOIC 4Z66D 3UT9D 2F8NH 4NE3A 5B24A 1AOIB 4KUDD 5AVCB 1R4VA 5BT1D 4H9RB 5FUGB 2YFVA 3V9RB 5AVCA 4J8WC 3LZ0D 5FUGA 4J8WB 3AZLC 3AZMC 3AZLB 2PYOC 3MNNC 3AZMB 1P3FC 2PYOB 3MNNB 3MVDC 3AZLA 5B31B 3B6GA 1P3FB 1KX3A 4YS3C 3MVDB 3NQJB 2F8NB 3MNNA 5B31A 4WU9A 5AV9D 1P3FA 1M1AC 5B32D 5AV6A 4M6BA 3NQJA 3X1VC 3WA9C 5BS7C 1M1AB 3W96C 3WA9B 4R8PA 3W96B 1F66C 3REKD 4ZBJC 3WTPD 3MGPC 3WA9A 1F66B 2NZDA 4ZBJB 3LJAD 2FJ7A 5GT3A 1P3OD 3MGPB 4LD9D 2AROA 4JJNC 3NQUB 3B0DC 4JJNB
chains in the Genus database with same CATH superfamily
4CSRB 3B0DB 5CPIA 3AFAC 4WNNB 4Z2MG 2G5IC 3AV1D 4JJNA 4J8VA 3W98C 4ZUXD 4CSRA 3AFAB 3W98B 5B24D 4WU8C 3W99B 4WU8B 5AV5C 3W99A 2CV5D 3TU4B 5E5AC 3WAAC 5AV5B 5AVCD 4DRBA 1ZLAD 5E5AB 3WAAB 2BG1A 3MGQC 3TU4A 2Y2LA 3B0CW 3MGQB 2HIOA 3B6GD 3B6FD 5AY8D 1KX3D 3AYWC 5B31D 4WU9D 1P3FD 4XUJA 3EPHA 5KDMB 3B0CT 3REHA 5AV6D 3AZGA 3AZNC 3AYWB 3AZNB 3EG5B 5KDMA 3AYWA 4R8PD 2Y2KA 5B40C 3A1IA 2YFWB 2NZDD 5CPKD 2FJ7D 2Y2GA 5GT3D 5B40B 1HTAA 2AROD 5B0YA 1P3AC 3W97C 3AZFC 3O62C 1P3AB 3AZFB 3O62B 5CPID 3UTBC 4J8VD 3MGRB 4J8XC 3UTBB 3O62A 3AV2C 4H9NB 4J8XB 3MGRA 3AV2B 3UTBA 3RELA 3AN2A 3W99D 4H9NA 4J8XA 1P3GA 5AV8C 5JRGC 3KWQD 4KHAA 3MGSC 5AV8B 3TU4D 5GXQC 5G49B 1P3IB 4CAYB 4E44A 3KSYA 5BNXA 5GXQB 1B67A 2HIOD 1P3IA 2XD5A 1M18A 5AVBC 5B33C 3WKJA 5AVBB 3AZEA 4X23A 5B33B 4XUJD 3C1BC 2XD1A 4G92C 3REHD 3AZGD 4XZQA 3C1BB 4G92B 3EPLA 3REIB 3AYWD 3C1BA 3REIA 3AZJB 2DQNC 3AZJA 5B32G 5F99C 5B0YD 3VH6A 5F99B 3AZHA 5DNMC 5GSUC 4YM6D 3H0MC 4EO5C 5DNMB 3A1KA 3X1SA 3O62D 5GSUB 3AZIA 1P3BB 1H3OB 4EO5B 1HQ3C 3AL0C 3MGRD 3UTBD 1HQ3B 5GSUA 3UTAC 1P3BA 1H3OA 3RELD 3AN2D 5CP6C 4J8XD 1PZRA 1P34D 1P3GD 3R45B 3UTAB 4HGAC 1KX4C 1AOIA 3FDDA 4HGAB 3UTAA 4H9RA 1KX5C 3V9RA 1P3ID 1TZYC 1M18D 1KX5B 4J8WA 3WKJD 3AZED 2RVQD 4X23D 3AZMA 2PYOA 4XZQD 4DQYB 1TAFB 4YS3B 3X1TC 3MVDA 2F8NA 3X1TB 1BH9B 1TAFA 4YS3A 3X1VB 3A6NC 3REID 2NQBC 2JSSA 1BH8B 1WWSA 1M1AA 1BH9A 3A6NB 2NQBB 3X1VA 4Z2MH 5BS7A 5B31G 3AZJD 1BH8A 2Y2OA 2CWEA 3W96A 4G91C 1T3UA 1F66A 4G91B 3AZHD 3MGPA 4KGCC 5CPJC 4KGCB 3NQUA 3X1SD 5CPJB 3AZID 1P3MC 1U35C 4WNNA 4NE6A 4UPKA 5GSUD 1P3BD 1P3MB 3AFAA 5B1MC 4UUZB 3W98A 1P3MA 1AOID 5B1MB 4WU8A 3X1UC 1N1JB 1P3LC 4QLCC 3P5JB 3X1UB 5AV5A 5B0ZC 1P3LB 4QLCB 1N1JA 5E5AA 3WAAA 3KFUG 4J8WD 1A7WA 3MGQA 3KXBC 4DRAA 3AZLD 3AZMD 5B2JC 3KXBB 2PYOD 3MNND 1F1EA 4J8UC 5B2JB 3MVDD 3C1CC 4J8UB 2F8ND 3LZ1C 4YS3D 3C1CB 3LZ1B 4Z5TC 1M1AD 5B2IC 3AZNA 4Z5TB 3X1VD 3WA9D 4H9PB 3AZKC 5B2IB 3W96D 5GT0C 3AZKB 1KU5A 3VH6W 1P3KC 2YFWA 5GT0B 1F66D 5B40A 1P3KB 2BYKB 3MGPD 3W97B 1P3PC 5B1LC 1ID3C 2BYKA 1S32C 3EPJA 2F8NK 4JJND 4AWLC 5B1LB 3KUYC 3W97A 1S32B 1P3AA 3VH6T 3AZFA 1P3PB 1ID3B 4WV4B 4WJ3C 4AWLB 3KUYB 1ID3A 5B1LA 3AFAD 3W98D 4NE5A 3AV2A 4WU8D 5DNNC 1M19C 5JRGB 3MGSB 5AV5D 3LELC 5DNNB 1M19B 5E5AD 1EQZC 3WAAD 5AV8A 5JRGA 3LELB 3REJC 3MGSA 5DNNA 5G49A 1EQZB 3MGQD 2BYMB 1M19A 4CAYA 2RIQA 3REJB 5C3IC 5GXQA 3VH5A 3UT9C 4KUDC 5C3IB 3UT9B 4KUDB 5AVBA 5BT1C 5B33A 2JCHA 3LZ0C 3AZND 2Y2QA 3LZ0B 3H0RC 5B40D 3IP4C 2Y2IA 5AV9C 5B32C 2VQRA 5F99A 5AV9B 1P3AD 3W97D 5B32B 3AZFD 5DNMA 3REKC 4H9QB 3WTPC 3REKB 3LJAC 3AV2D 1P3OC 3WTPB 4H9QA 1HQ3A 5CP6B 4LD9C 3LJAB 1P3OB 1KX4B 3R45A 4LD9B 3WTPA 5CP6A 5AV8D 5JRGD 1KX4A 3MGSD 3AV1C 4ZUXC 5GXQD 1TZYB 4ZUXB 5B24C 1KX5A 5B24B 1TZYA 5AVBD 2CV5C 5B33D 5AVCC 2ZY5A 2CV5B 2Y2HA 2YFVB 1ZLAC 3C1BD 1ZLAB 2CV5A 3X1TA 1ZLAA 4H9OB 3A6NA 2F8NG 2NQBA 3B6FC 2LY8A 5AY8C 1KX3C 3B6GC 4H9OA 3B6FB 3B6GB 5AY8B 1KX3B 5B31C 3WTPE 4WU9C 5F99D 5AV6C 4WU9B 3B6FA 5AY8A 5AV6B 4R8PC 5DNMD 4KGCA 5CPJA 2ZY2A 4R8PB 2Y2NA 1U35B 5CPKC 2NZDC 2FJ7C 5GT3C 1HQ3D 2L5AA 5CPKB 2NZDB 2FJ7B 2AROC 5GT3B 1U35A 4UUZA 1Q9CA 3UTAD 2AROB 5CP6D 5B1MA 5CPKA 5CPIC 1KX4D 2J8PA 4J8VC 5B0ZB 3X1UA 5CPIB 3VH5W 1P3LA 4J8VB 4QLCA 1KX5D 5B0ZA 1TZYD 2Y2PA 5CHLB 5JA4B 3W99C 3KXBA 3KWQC 5JA4A 1JFIB 5B2JA 3VH5T 3KWQB 3TU4C 3B0BA 4J8UA 1JFIA 3X1TD 3C1CA 3KWQA 2HIOC 3LZ1A 3A6ND 2NQBD 2HIOB 4Z5TA 4H9PA 5B2IA 3AZKA 4XUJC 3REHC 3AZGC 5GT0A 4XUJB 1P3KA 3REHB 3AZGB 1B6WA 4KGCD 2W8SA 2UWXA 5CPJD 1P3PA 1S32A 5BO0B 1P3MD 3KUYA 1U35D 5BO0A 5B0YC 2JE5A 5B1MD 2HUEC 2FFFB 4E45A 5B0YB 2ZY3A 2HUEB 4YM6C 3X1UD 1P3LD 4QLCD 4YM6B 4NFTA 3LELA 5B0ZD 4Z66C 3MGRC 1EQZA 2BYMA 4YM6A 3REJA 3RELC 4Z66B 3AN2C 1P34C 1Z2CB 1P3GC 3KXBD 3RELB 3AN2B 1P34B 1W2EA 1P3GB 4Z66A 5B2JD 3UT9A 2IO5C 4KHAB 4KUDA 4J8UD 1P34A 1ULYA 2IO5B 4H9SC 3C1CD 5BNVB 3LZ1D 1P3IC 5BNXB 1M18C 4Z5TD 5BNVA 3LZ0A 1M18B 3WKJC 5B2ID 4WZSB 2RVQC 4H9SA 4X23C 3AZEC 3AZKD 3WKJB 3AZEB 4XZQC 5GT0D 4X23B 1P3KD 4XZQB 2Y2MA 3REIC 1P3PD 5B1LD 5AV9A 1S32D 1ID3D 5B32A 3H0LC 3KUYD 3AZJC 1BFMA 2DF4C 2ZM5A 3REKA 3AZHC 3LJAA 3AZHB 1P3OA 1WWIA 3X1SC 5DNND 4LD9A 3AZIC 1M19D 3EPKA 3LELD 3X1SB 3AV1B 2F2AC 3AZIB 1EQZD 1P3BC 3REJD 3AV1A 4ZUXA 1AOIC 4Z66D 3UT9D 2F8NH 4NE3A 5B24A 1AOIB 4KUDD 5AVCB 1R4VA 5BT1D 4H9RB 5FUGB 2YFVA 3V9RB 5AVCA 4J8WC 3LZ0D 5FUGA 4J8WB 3AZLC 3AZMC 3AZLB 2PYOC 3MNNC 3AZMB 1P3FC 2PYOB 3MNNB 3MVDC 3AZLA 5B31B 3B6GA 1P3FB 1KX3A 4YS3C 3MVDB 3NQJB 2F8NB 3MNNA 5B31A 4WU9A 5AV9D 1P3FA 1M1AC 3F6TA 5B32D 5AV6A 4M6BA 3NQJA 3X1VC 3WA9C 5BS7C 1M1AB 3W96C 3WA9B 2ZY4A 2G5HC 4R8PA 3W96B 1F66C 3REKD 4ZBJC 3WTPD 3MGPC 3WA9A 1F66B 2NZDA 4ZBJB 3LJAD 2FJ7A 5GT3A 1P3OD 3MGPB 4LD9D 2AROA 4JJNC 2Y2JA 3NQUB 3B0DC 4JJNB
chains in the Genus database with same CATH topology
4CSRB 3B0DB 5CPIA 3AFAC 4WNNB 4Z2MG 2G5IC 3AV1D 4JJNA 4J8VA 3W98C 4ZUXD 4CSRA 3AFAB 3W98B 5B24D 4WU8C 3W99B 4WU8B 5AV5C 3W99A 2CV5D 3TU4B 5E5AC 3WAAC 5AV5B 5AVCD 4DRBA 1ZLAD 5E5AB 3WAAB 2BG1A 3MGQC 3TU4A 2Y2LA 3B0CW 3MGQB 2HIOA 3B6GD 3B6FD 5AY8D 1KX3D 3AYWC 5B31D 4WU9D 1P3FD 4XUJA 3EPHA 5KDMB 3B0CT 3REHA 5AV6D 3AZGA 3AZNC 3AYWB 3AZNB 3EG5B 5KDMA 3AYWA 4R8PD 2Y2KA 5B40C 3A1IA 2YFWB 2NZDD 5CPKD 2FJ7D 2Y2GA 5GT3D 5B40B 1HTAA 2AROD 5B0YA 1P3AC 3W97C 3AZFC 3O62C 1P3AB 3AZFB 3O62B 5CPID 3UTBC 4J8VD 3MGRB 4J8XC 3UTBB 3O62A 3AV2C 4H9NB 4J8XB 3MGRA 3AV2B 3UTBA 3RELA 3AN2A 3W99D 4H9NA 4J8XA 1P3GA 5AV8C 5JRGC 3KWQD 4KHAA 3MGSC 5AV8B 3TU4D 5GXQC 5G49B 1P3IB 4CAYB 4E44A 3KSYA 5BNXA 5GXQB 1B67A 2HIOD 1P3IA 2XD5A 1M18A 5AVBC 5B33C 3WKJA 5AVBB 3AZEA 4X23A 5B33B 4XUJD 3C1BC 2XD1A 4G92C 3REHD 3AZGD 4XZQA 3C1BB 4G92B 3EPLA 3REIB 3AYWD 3C1BA 3REIA 3AZJB 2DQNC 3AZJA 5B32G 5F99C 5B0YD 3VH6A 5F99B 3AZHA 5DNMC 5GSUC 4YM6D 3H0MC 4EO5C 5DNMB 3A1KA 3X1SA 3O62D 5GSUB 3AZIA 1P3BB 1H3OB 4EO5B 1HQ3C 3AL0C 3MGRD 3UTBD 1HQ3B 5GSUA 3UTAC 1P3BA 1H3OA 3RELD 3AN2D 5CP6C 4J8XD 1PZRA 1P34D 1P3GD 3R45B 3UTAB 4HGAC 1KX4C 1AOIA 3FDDA 4HGAB 3UTAA 4H9RA 1KX5C 3V9RA 1P3ID 1TZYC 1M18D 1KX5B 4J8WA 3WKJD 3AZED 2RVQD 4X23D 3AZMA 2PYOA 4XZQD 4DQYB 1TAFB 4YS3B 3X1TC 3MVDA 2F8NA 3X1TB 1BH9B 1TAFA 4YS3A 3X1VB 3A6NC 3REID 2NQBC 2JSSA 1BH8B 1WWSA 1M1AA 1BH9A 3A6NB 2NQBB 3X1VA 4Z2MH 5BS7A 5B31G 3AZJD 1BH8A 2Y2OA 2CWEA 3W96A 4G91C 1T3UA 1F66A 4G91B 3AZHD 3MGPA 4KGCC 5CPJC 4KGCB 3NQUA 3X1SD 5CPJB 3AZID 1P3MC 1U35C 4WNNA 4NE6A 4UPKA 5GSUD 1P3BD 1P3MB 3AFAA 5B1MC 4UUZB 3W98A 1P3MA 1AOID 5B1MB 4WU8A 3X1UC 1N1JB 1P3LC 4QLCC 3P5JB 3X1UB 5AV5A 5B0ZC 1P3LB 4QLCB 1N1JA 5E5AA 3WAAA 3KFUG 4J8WD 1A7WA 3MGQA 3KXBC 4DRAA 3AZLD 3AZMD 5B2JC 3KXBB 2PYOD 3MNND 1F1EA 4J8UC 5B2JB 3MVDD 3C1CC 4J8UB 2F8ND 3LZ1C 4YS3D 3C1CB 3LZ1B 4Z5TC 1M1AD 5B2IC 3AZNA 4Z5TB 3X1VD 3WA9D 4H9PB 3AZKC 5B2IB 3W96D 5GT0C 3AZKB 1KU5A 3VH6W 1P3KC 2YFWA 5GT0B 1F66D 5B40A 1P3KB 2BYKB 3MGPD 3W97B 1P3PC 5B1LC 1ID3C 2BYKA 1S32C 3EPJA 2F8NK 4JJND 4AWLC 5B1LB 3KUYC 3W97A 1S32B 1P3AA 3VH6T 3AZFA 1P3PB 1ID3B 4WV4B 4WJ3C 4AWLB 3KUYB 1ID3A 5B1LA 3AFAD 3W98D 4NE5A 3AV2A 4WU8D 5DNNC 1M19C 5JRGB 3MGSB 5AV5D 3LELC 5DNNB 1M19B 5E5AD 1EQZC 3WAAD 5AV8A 5JRGA 3LELB 3REJC 3MGSA 5DNNA 5G49A 1EQZB 3MGQD 2BYMB 1M19A 4CAYA 2RIQA 3REJB 5C3IC 5GXQA 3VH5A 3UT9C 4KUDC 5C3IB 3UT9B 4KUDB 5AVBA 5BT1C 5B33A 2JCHA 3LZ0C 3AZND 2Y2QA 3LZ0B 3H0RC 5B40D 3IP4C 2Y2IA 5AV9C 5B32C 2VQRA 5F99A 5AV9B 1P3AD 3W97D 5B32B 3AZFD 5DNMA 3REKC 4H9QB 3WTPC 3REKB 3LJAC 3AV2D 1P3OC 3WTPB 4H9QA 1HQ3A 5CP6B 4LD9C 3LJAB 1P3OB 1KX4B 3R45A 4LD9B 3WTPA 5CP6A 5AV8D 5JRGD 1KX4A 3MGSD 3AV1C 4ZUXC 5GXQD 1TZYB 4ZUXB 5B24C 1KX5A 5B24B 1TZYA 5AVBD 2CV5C 5B33D 5AVCC 2ZY5A 2CV5B 2Y2HA 2YFVB 1ZLAC 3C1BD 1ZLAB 2CV5A 3X1TA 1ZLAA 4H9OB 3A6NA 2F8NG 2NQBA 3B6FC 2LY8A 5AY8C 1KX3C 3B6GC 4H9OA 3B6FB 3B6GB 5AY8B 1KX3B 5B31C 3WTPE 4WU9C 5F99D 5AV6C 4WU9B 3B6FA 5AY8A 5AV6B 4R8PC 5DNMD 4KGCA 5CPJA 2ZY2A 4R8PB 2Y2NA 1U35B 5CPKC 2NZDC 2FJ7C 5GT3C 1HQ3D 2L5AA 5CPKB 2NZDB 2FJ7B 2AROC 5GT3B 1U35A 4UUZA 1Q9CA 3UTAD 2AROB 5CP6D 5B1MA 5CPKA 5CPIC 1KX4D 2J8PA 4J8VC 5B0ZB 3X1UA 5CPIB 3VH5W 1P3LA 4J8VB 4QLCA 1KX5D 5B0ZA 1TZYD 2Y2PA 5CHLB 5JA4B 3W99C 3KXBA 3KWQC 5JA4A 1JFIB 5B2JA 3VH5T 3KWQB 3TU4C 3B0BA 4J8UA 1JFIA 3X1TD 3C1CA 3KWQA 2HIOC 3LZ1A 3A6ND 2NQBD 2HIOB 4Z5TA 4H9PA 5B2IA 3AZKA 4XUJC 3REHC 3AZGC 5GT0A 4XUJB 1P3KA 3REHB 3AZGB 1B6WA 4KGCD 2W8SA 2UWXA 5CPJD 1P3PA 1S32A 5BO0B 1P3MD 3KUYA 1U35D 5BO0A 5B0YC 2JE5A 5B1MD 2HUEC 2FFFB 4E45A 5B0YB 2ZY3A 2HUEB 4YM6C 3X1UD 1P3LD 4QLCD 4YM6B 4NFTA 3LELA 5B0ZD 4Z66C 3MGRC 1EQZA 2BYMA 4YM6A 3REJA 3RELC 4Z66B 3AN2C 1P34C 1Z2CB 1P3GC 3KXBD 3RELB 3AN2B 1P34B 1W2EA 1P3GB 4Z66A 5B2JD 3UT9A 2IO5C 4KHAB 4KUDA 4J8UD 1P34A 1ULYA 2IO5B 4H9SC 3C1CD 5BNVB 3LZ1D 1P3IC 5BNXB 1M18C 4Z5TD 5BNVA 3LZ0A 1M18B 3WKJC 5B2ID 4WZSB 2RVQC 4H9SA 4X23C 3AZEC 3AZKD 3WKJB 3AZEB 4XZQC 5GT0D 4X23B 1P3KD 4XZQB 2Y2MA 3REIC 1P3PD 5B1LD 5AV9A 1S32D 1ID3D 5B32A 3H0LC 3KUYD 3AZJC 1BFMA 2DF4C 2ZM5A 3REKA 3AZHC 3LJAA 3AZHB 1P3OA 1WWIA 3X1SC 5DNND 4LD9A 3AZIC 1M19D 3EPKA 3LELD 3X1SB 3AV1B 2F2AC 3AZIB 1EQZD 1P3BC 3REJD 3AV1A 4ZUXA 1AOIC 4Z66D 3UT9D 2F8NH 4NE3A 5B24A 1AOIB 4KUDD 5AVCB 1R4VA 5BT1D 4H9RB 5FUGB 2YFVA 3V9RB 5AVCA 4J8WC 3LZ0D 5FUGA 4J8WB 3AZLC 3AZMC 3AZLB 2PYOC 3MNNC 3AZMB 1P3FC 2PYOB 3MNNB 3MVDC 3AZLA 5B31B 3B6GA 1P3FB 1KX3A 4YS3C 3MVDB 3NQJB 2F8NB 3MNNA 5B31A 4WU9A 5AV9D 1P3FA 1M1AC 3F6TA 5B32D 5AV6A 4M6BA 3NQJA 3X1VC 3WA9C 5BS7C 1M1AB 3W96C 3WA9B 2ZY4A 2G5HC 4R8PA 3W96B 1F66C 3REKD 4ZBJC 3WTPD 3MGPC 3WA9A 1F66B 2NZDA 4ZBJB 3LJAD 2FJ7A 5GT3A 1P3OD 3MGPB 4LD9D 2AROA 4JJNC 2Y2JA 3NQUB 3B0DC 4JJNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CSR B;  3B0D B;  5CPI A;  3AFA C;  4WNN B;  4Z2M G;  3AV1 D;  4JJN A;  4J8V A;  3W98 C;  4ZUX D;  4CSR A;  3AFA B;  3W98 B;  5B24 D;  4WU8 C;  3W99 B;  4WU8 B;  5AV5 C;  3W99 A;  2CV5 D;  3TU4 B;  5E5A C;  3WAA C;  5AV5 B;  5AVC D;  4DRB A;  1ZLA D;  5E5A B;  3WAA B;  3MGQ C;  3TU4 A;  3B0C W;  3MGQ B;  2HIO A;  3B6G D;  3B6F D;  5AY8 D;  1KX3 D;  3AYW C;  5B31 D;  4WU9 D;  1P3F D;  4XUJ A;  5KDM B;  3B0C T;  3REH A;  5AV6 D;  3AZG A;  3AZN C;  3AYW B;  3AZN B;  5KDM A;  3AYW A;  4R8P D;  5B40 C;  2YFW B;  2NZD D;  5CPK D;  2FJ7 D;  5GT3 D;  5B40 B;  1HTA A;  2ARO D;  5B0Y A;  1P3A C;  3W97 C;  3AZF C;  3O62 C;  1P3A B;  3AZF B;  3O62 B;  5CPI D;  3UTB C;  4J8V D;  3MGR B;  4J8X C;  3UTB B;  3O62 A;  3AV2 C;  4H9N B;  4J8X B;  3MGR A;  3AV2 B;  3UTB A;  3REL A;  3AN2 A;  3W99 D;  4H9N A;  4J8X A;  1P3G A;  5AV8 C;  5JRG C;  3KWQ D;  4KHA A;  3MGS C;  5AV8 B;  3TU4 D;  5GXQ C;  5G49 B;  1P3I B;  4CAY B;  4E44 A;  3KSY A;  5BNX A;  5GXQ B;  1B67 A;  2HIO D;  1P3I A;  1M18 A;  5AVB C;  5B33 C;  3WKJ A;  5AVB B;  3AZE A;  4X23 A;  5B33 B;  4XUJ D;  3C1B C;  4G92 C;  3REH D;  3AZG D;  4XZQ A;  3C1B B;  4G92 B;  3REI B;  3AYW D;  3C1B A;  3REI A;  3AZJ B;  3AZJ A;  5B32 G;  5F99 C;  5B0Y D;  3VH6 A;  5F99 B;  3AZH A;  5DNM C;  5GSU C;  4YM6 D;  4EO5 C;  5DNM B;  3X1S A;  3O62 D;  5GSU B;  3AZI A;  1P3B B;  1H3O B;  4EO5 B;  1HQ3 C;  3MGR D;  3UTB D;  1HQ3 B;  5GSU A;  3UTA C;  1P3B A;  1H3O A;  3REL D;  3AN2 D;  5CP6 C;  4J8X D;  1P34 D;  1P3G D;  3R45 B;  3UTA B;  4HGA C;  1KX4 C;  1AOI A;  4HGA B;  3UTA A;  4H9R A;  1KX5 C;  3V9R A;  1P3I D;  1TZY C;  1M18 D;  1KX5 B;  4J8W A;  3WKJ D;  3AZE D;  2RVQ D;  4X23 D;  3AZM A;  2PYO A;  4XZQ D;  1TAF B;  4YS3 B;  3X1T C;  3MVD A;  2F8N A;  3X1T B;  1BH9 B;  1TAF A;  4YS3 A;  3X1V B;  3A6N C;  3REI D;  2NQB C;  2JSS A;  1BH8 B;  1WWS A;  1M1A A;  1BH9 A;  3A6N B;  2NQB B;  3X1V A;  4Z2M H;  5BS7 A;  5B31 G;  3AZJ D;  1BH8 A;  3W96 A;  2CWE A;  4G91 C;  1F66 A;  4G91 B;  3AZH D;  3MGP A;  4KGC C;  5CPJ C;  4KGC B;  3NQU A;  3X1S D;  5CPJ B;  3AZI D;  1P3M C;  1U35 C;  4WNN A;  4NE6 A;  5GSU D;  1P3M B;  1P3B D;  3AFA A;  5B1M C;  4UUZ B;  3W98 A;  1P3M A;  1AOI D;  5B1M B;  4WU8 A;  3X1U C;  1N1J B;  1P3L C;  4QLC C;  3X1U B;  5AV5 A;  5B0Z C;  1P3L B;  4QLC B;  1N1J A;  5E5A A;  3WAA A;  4J8W D;  1A7W A;  3MGQ A;  3KXB C;  4DRA A;  3AZL D;  3AZM D;  5B2J C;  3KXB B;  2PYO D;  3MNN D;  1F1E A;  4J8U C;  5B2J B;  3MVD D;  3C1C C;  4J8U B;  2F8N D;  3LZ1 C;  4YS3 D;  3C1C B;  3LZ1 B;  4Z5T C;  1M1A D;  5B2I C;  3AZN A;  4Z5T B;  3X1V D;  3WA9 D;  4H9P B;  3AZK C;  5B2I B;  3W96 D;  5GT0 C;  3AZK B;  1KU5 A;  3VH6 W;  1P3K C;  2YFW A;  5GT0 B;  1F66 D;  5B40 A;  1P3K B;  2BYK B;  3MGP D;  3W97 B;  1P3P C;  5B1L C;  1ID3 C;  2BYK A;  1S32 C;  2F8N K;  4JJN D;  4AWL C;  5B1L B;  3KUY C;  3W97 A;  1S32 B;  1P3A A;  3VH6 T;  3AZF A;  1P3P B;  1ID3 B;  4WV4 B;  4AWL B;  3KUY B;  1ID3 A;  5B1L A;  3AFA D;  3W98 D;  4NE5 A;  3AV2 A;  4WU8 D;  5DNN C;  1M19 C;  5JRG B;  3MGS B;  5AV5 D;  3LEL C;  5DNN B;  1M19 B;  5E5A D;  1EQZ C;  3WAA D;  5AV8 A;  5JRG A;  3LEL B;  3REJ C;  3MGS A;  5DNN A;  5G49 A;  1EQZ B;  3MGQ D;  2BYM B;  1M19 A;  4CAY A;  3REJ B;  5C3I C;  5GXQ A;  3VH5 A;  3UT9 C;  4KUD C;  5C3I B;  3UT9 B;  4KUD B;  5AVB A;  5BT1 C;  5B33 A;  3LZ0 C;  3AZN D;  3LZ0 B;  5B40 D;  5AV9 C;  5B32 C;  5F99 A;  5AV9 B;  1P3A D;  3W97 D;  5B32 B;  3AZF D;  5DNM A;  3REK C;  4H9Q B;  3WTP C;  3REK B;  3LJA C;  3AV2 D;  1P3O C;  3WTP B;  4H9Q A;  1HQ3 A;  5CP6 B;  4LD9 C;  3LJA B;  1P3O B;  1KX4 B;  3R45 A;  4LD9 B;  3WTP A;  5CP6 A;  5AV8 D;  5JRG D;  1KX4 A;  3MGS D;  3AV1 C;  4ZUX C;  5GXQ D;  1TZY B;  4ZUX B;  5B24 C;  1KX5 A;  5B24 B;  1TZY A;  5AVB D;  2CV5 C;  5B33 D;  5AVC C;  2CV5 B;  1ZLA C;  2YFV B;  3C1B D;  1ZLA B;  2CV5 A;  3X1T A;  1ZLA A;  4H9O B;  3A6N A;  2F8N G;  2NQB A;  3B6F C;  2LY8 A;  5AY8 C;  1KX3 C;  3B6G C;  4H9O A;  3B6F B;  3B6G B;  5AY8 B;  1KX3 B;  5B31 C;  3WTP E;  4WU9 C;  5F99 D;  5AV6 C;  4WU9 B;  3B6F A;  5AY8 A;  5AV6 B;  4R8P C;  5DNM D;  4KGC A;  5CPJ A;  4R8P B;  1U35 B;  2NZD C;  5CPK C;  2FJ7 C;  5GT3 C;  1HQ3 D;  2L5A A;  5CPK B;  2NZD B;  2FJ7 B;  2ARO C;  5GT3 B;  1U35 A;  4UUZ A;  1Q9C A;  3UTA D;  2ARO B;  5CP6 D;  5B1M A;  5CPK A;  5CPI C;  1KX4 D;  4J8V C;  5B0Z B;  3X1U A;  5CPI B;  3VH5 W;  1P3L A;  4J8V B;  4QLC A;  1KX5 D;  5B0Z A;  1TZY D;  5CHL B;  5JA4 B;  3W99 C;  3KXB A;  3KWQ C;  5JA4 A;  1JFI B;  5B2J A;  3VH5 T;  3KWQ B;  3TU4 C;  3B0B A;  4J8U A;  1JFI A;  3X1T D;  3C1C A;  3KWQ A;  2HIO C;  3LZ1 A;  3A6N D;  2NQB D;  2HIO B;  4Z5T A;  4H9P A;  5B2I A;  3AZK A;  4XUJ C;  3REH C;  3AZG C;  5GT0 A;  4XUJ B;  1P3K A;  3REH B;  3AZG B;  1B6W A;  4KGC D;  5CPJ D;  1P3P A;  1S32 A;  5BO0 B;  1P3M D;  3KUY A;  1U35 D;  5BO0 A;  5B0Y C;  5B1M D;  2HUE C;  4E45 A;  5B0Y B;  2HUE B;  4YM6 C;  3X1U D;  1P3L D;  4QLC D;  4YM6 B;  4NFT A;  3LEL A;  5B0Z D;  4Z66 C;  3MGR C;  1EQZ A;  2BYM A;  4YM6 A;  3REJ A;  3REL C;  4Z66 B;  3AN2 C;  1P34 C;  1P3G C;  3KXB D;  3REL B;  3AN2 B;  1P34 B;  1P3G B;  4Z66 A;  5B2J D;  3UT9 A;  2IO5 C;  4KHA B;  4KUD A;  4J8U D;  1P34 A;  1ULY A;  2IO5 B;  4H9S C;  3C1C D;  5BNV B;  3LZ1 D;  1P3I C;  5BNX B;  1M18 C;  4Z5T D;  5BNV A;  3LZ0 A;  1M18 B;  3WKJ C;  5B2I D;  4WZS B;  2RVQ C;  4H9S A;  4X23 C;  3AZE C;  3AZK D;  3WKJ B;  3AZE B;  4XZQ C;  5GT0 D;  4X23 B;  1P3K D;  4XZQ B;  3REI C;  1P3P D;  5B1L D;  5AV9 A;  1S32 D;  1ID3 D;  5B32 A;  3KUY D;  3AZJ C;  1BFM A;  3REK A;  3AZH C;  3LJA A;  3AZH B;  1P3O A;  1WWI A;  3X1S C;  5DNN D;  4LD9 A;  3AZI C;  1M19 D;  3LEL D;  3X1S B;  3AV1 B;  3AZI B;  1EQZ D;  1P3B C;  3REJ D;  3AV1 A;  4ZUX A;  1AOI C;  4Z66 D;  3UT9 D;  2F8N H;  4NE3 A;  5B24 A;  1AOI B;  4KUD D;  5AVC B;  1R4V A;  5BT1 D;  4H9R B;  5FUG B;  2YFV A;  3V9R B;  5AVC A;  4J8W C;  3LZ0 D;  5FUG A;  4J8W B;  3AZL C;  3AZM C;  3AZL B;  2PYO C;  3MNN C;  3AZM B;  1P3F C;  2PYO B;  3MNN B;  3MVD C;  3AZL A;  5B31 B;  3B6G A;  1P3F B;  1KX3 A;  4YS3 C;  3MVD B;  3NQJ B;  2F8N B;  3MNN A;  5B31 A;  4WU9 A;  5AV9 D;  1P3F A;  1M1A C;  5B32 D;  5AV6 A;  4M6B A;  3NQJ A;  3X1V C;  3WA9 C;  5BS7 C;  1M1A B;  3W96 C;  3WA9 B;  4R8P A;  3W96 B;  1F66 C;  3REK D;  4ZBJ C;  3WTP D;  3MGP C;  3WA9 A;  1F66 B;  2NZD A;  4ZBJ B;  3LJA D;  2FJ7 A;  5GT3 A;  1P3O D;  3MGP B;  4LD9 D;  2ARO A;  4JJN C;  3NQU B;  3B0D C;  4JJN B; 
#chains in the Genus database with same CATH topology
 4CSR B;  3B0D B;  5CPI A;  3AFA C;  4WNN B;  4Z2M G;  2G5I C;  3AV1 D;  4JJN A;  4J8V A;  3W98 C;  4ZUX D;  4CSR A;  3AFA B;  3W98 B;  5B24 D;  4WU8 C;  3W99 B;  4WU8 B;  5AV5 C;  3W99 A;  2CV5 D;  3TU4 B;  5E5A C;  3WAA C;  5AV5 B;  5AVC D;  4DRB A;  1ZLA D;  5E5A B;  3WAA B;  2BG1 A;  3MGQ C;  3TU4 A;  2Y2L A;  3B0C W;  3MGQ B;  2HIO A;  3B6G D;  3B6F D;  5AY8 D;  1KX3 D;  3AYW C;  5B31 D;  4WU9 D;  1P3F D;  4XUJ A;  3EPH A;  5KDM B;  3B0C T;  3REH A;  5AV6 D;  3AZG A;  3AZN C;  3AYW B;  3AZN B;  3EG5 B;  5KDM A;  3AYW A;  4R8P D;  2Y2K A;  5B40 C;  3A1I A;  2YFW B;  2NZD D;  5CPK D;  2FJ7 D;  2Y2G A;  5GT3 D;  5B40 B;  1HTA A;  2ARO D;  5B0Y A;  1P3A C;  3W97 C;  3AZF C;  3O62 C;  1P3A B;  3AZF B;  3O62 B;  5CPI D;  3UTB C;  4J8V D;  3MGR B;  4J8X C;  3UTB B;  3O62 A;  3AV2 C;  4H9N B;  4J8X B;  3MGR A;  3AV2 B;  3UTB A;  3REL A;  3AN2 A;  3W99 D;  4H9N A;  4J8X A;  1P3G A;  5AV8 C;  5JRG C;  3KWQ D;  4KHA A;  3MGS C;  5AV8 B;  3TU4 D;  5GXQ C;  5G49 B;  1P3I B;  4CAY B;  4E44 A;  3KSY A;  5BNX A;  5GXQ B;  1B67 A;  2HIO D;  1P3I A;  2XD5 A;  1M18 A;  5AVB C;  5B33 C;  3WKJ A;  5AVB B;  3AZE A;  4X23 A;  5B33 B;  4XUJ D;  3C1B C;  2XD1 A;  4G92 C;  3REH D;  3AZG D;  4XZQ A;  3C1B B;  4G92 B;  3EPL A;  3REI B;  3AYW D;  3C1B A;  3REI A;  3AZJ B;  2DQN C;  3AZJ A;  5B32 G;  5F99 C;  5B0Y D;  3VH6 A;  5F99 B;  3AZH A;  5DNM C;  5GSU C;  4YM6 D;  3H0M C;  4EO5 C;  5DNM B;  3A1K A;  3X1S A;  3O62 D;  5GSU B;  3AZI A;  1P3B B;  1H3O B;  4EO5 B;  1HQ3 C;  3AL0 C;  3MGR D;  3UTB D;  1HQ3 B;  5GSU A;  3UTA C;  1P3B A;  1H3O A;  3REL D;  3AN2 D;  5CP6 C;  4J8X D;  1PZR A;  1P34 D;  1P3G D;  3R45 B;  3UTA B;  4HGA C;  1KX4 C;  1AOI A;  3FDD A;  4HGA B;  3UTA A;  4H9R A;  1KX5 C;  3V9R A;  1P3I D;  1TZY C;  1M18 D;  1KX5 B;  4J8W A;  3WKJ D;  3AZE D;  2RVQ D;  4X23 D;  3AZM A;  2PYO A;  4XZQ D;  4DQY B;  1TAF B;  4YS3 B;  3X1T C;  3MVD A;  2F8N A;  3X1T B;  1BH9 B;  1TAF A;  4YS3 A;  3X1V B;  3A6N C;  3REI D;  2NQB C;  2JSS A;  1BH8 B;  1WWS A;  1M1A A;  1BH9 A;  3A6N B;  2NQB B;  3X1V A;  4Z2M H;  5BS7 A;  5B31 G;  3AZJ D;  1BH8 A;  2Y2O A;  2CWE A;  3W96 A;  4G91 C;  1T3U A;  1F66 A;  4G91 B;  3AZH D;  3MGP A;  4KGC C;  5CPJ C;  4KGC B;  3NQU A;  3X1S D;  5CPJ B;  3AZI D;  1P3M C;  1U35 C;  4WNN A;  4NE6 A;  4UPK A;  5GSU D;  1P3B D;  1P3M B;  3AFA A;  5B1M C;  4UUZ B;  3W98 A;  1P3M A;  1AOI D;  5B1M B;  4WU8 A;  3X1U C;  1N1J B;  1P3L C;  4QLC C;  3P5J B;  3X1U B;  5AV5 A;  5B0Z C;  1P3L B;  4QLC B;  1N1J A;  5E5A A;  3WAA A;  3KFU G;  4J8W D;  1A7W A;  3MGQ A;  3KXB C;  4DRA A;  3AZL D;  3AZM D;  5B2J C;  3KXB B;  2PYO D;  3MNN D;  1F1E A;  4J8U C;  5B2J B;  3MVD D;  3C1C C;  4J8U B;  2F8N D;  3LZ1 C;  4YS3 D;  3C1C B;  3LZ1 B;  4Z5T C;  1M1A D;  5B2I C;  3AZN A;  4Z5T B;  3X1V D;  3WA9 D;  4H9P B;  3AZK C;  5B2I B;  3W96 D;  5GT0 C;  3AZK B;  1KU5 A;  3VH6 W;  1P3K C;  2YFW A;  5GT0 B;  1F66 D;  5B40 A;  1P3K B;  2BYK B;  3MGP D;  3W97 B;  1P3P C;  5B1L C;  1ID3 C;  2BYK A;  1S32 C;  3EPJ A;  2F8N K;  4JJN D;  4AWL C;  5B1L B;  3KUY C;  3W97 A;  1S32 B;  1P3A A;  3VH6 T;  3AZF A;  1P3P B;  1ID3 B;  4WV4 B;  4WJ3 C;  4AWL B;  3KUY B;  1ID3 A;  5B1L A;  3AFA D;  3W98 D;  4NE5 A;  3AV2 A;  4WU8 D;  5DNN C;  1M19 C;  5JRG B;  3MGS B;  5AV5 D;  3LEL C;  5DNN B;  1M19 B;  5E5A D;  1EQZ C;  3WAA D;  5AV8 A;  5JRG A;  3LEL B;  3REJ C;  3MGS A;  5DNN A;  5G49 A;  1EQZ B;  3MGQ D;  2BYM B;  1M19 A;  4CAY A;  2RIQ A;  3REJ B;  5C3I C;  5GXQ A;  3VH5 A;  3UT9 C;  4KUD C;  5C3I B;  3UT9 B;  4KUD B;  5AVB A;  5BT1 C;  5B33 A;  2JCH A;  3LZ0 C;  3AZN D;  2Y2Q A;  3LZ0 B;  3H0R C;  5B40 D;  3IP4 C;  2Y2I A;  5AV9 C;  5B32 C;  2VQR A;  5F99 A;  5AV9 B;  1P3A D;  3W97 D;  5B32 B;  3AZF D;  5DNM A;  3REK C;  4H9Q B;  3WTP C;  3REK B;  3LJA C;  3AV2 D;  1P3O C;  3WTP B;  4H9Q A;  1HQ3 A;  5CP6 B;  4LD9 C;  3LJA B;  1P3O B;  1KX4 B;  3R45 A;  4LD9 B;  3WTP A;  5CP6 A;  5AV8 D;  5JRG D;  1KX4 A;  3MGS D;  3AV1 C;  4ZUX C;  5GXQ D;  1TZY B;  4ZUX B;  5B24 C;  1KX5 A;  5B24 B;  1TZY A;  5AVB D;  2CV5 C;  5B33 D;  5AVC C;  2ZY5 A;  2CV5 B;  2Y2H A;  2YFV B;  1ZLA C;  3C1B D;  1ZLA B;  2CV5 A;  3X1T A;  1ZLA A;  4H9O B;  3A6N A;  2F8N G;  2NQB A;  3B6F C;  2LY8 A;  5AY8 C;  1KX3 C;  3B6G C;  4H9O A;  3B6F B;  3B6G B;  5AY8 B;  1KX3 B;  5B31 C;  3WTP E;  4WU9 C;  5F99 D;  5AV6 C;  4WU9 B;  3B6F A;  5AY8 A;  5AV6 B;  4R8P C;  5DNM D;  4KGC A;  5CPJ A;  2ZY2 A;  4R8P B;  2Y2N A;  1U35 B;  5CPK C;  2NZD C;  2FJ7 C;  5GT3 C;  1HQ3 D;  2L5A A;  5CPK B;  2NZD B;  2FJ7 B;  2ARO C;  5GT3 B;  1U35 A;  4UUZ A;  1Q9C A;  3UTA D;  2ARO B;  5CP6 D;  5B1M A;  5CPK A;  5CPI C;  1KX4 D;  2J8P A;  4J8V C;  5B0Z B;  3X1U A;  5CPI B;  3VH5 W;  1P3L A;  4J8V B;  4QLC A;  1KX5 D;  5B0Z A;  1TZY D;  2Y2P A;  5CHL B;  5JA4 B;  3W99 C;  3KXB A;  3KWQ C;  5JA4 A;  1JFI B;  5B2J A;  3VH5 T;  3KWQ B;  3TU4 C;  3B0B A;  4J8U A;  1JFI A;  3X1T D;  3C1C A;  3KWQ A;  2HIO C;  3LZ1 A;  3A6N D;  2NQB D;  2HIO B;  4Z5T A;  4H9P A;  5B2I A;  3AZK A;  4XUJ C;  3REH C;  3AZG C;  5GT0 A;  4XUJ B;  1P3K A;  3REH B;  3AZG B;  1B6W A;  4KGC D;  2W8S A;  2UWX A;  5CPJ D;  1P3P A;  1S32 A;  5BO0 B;  1P3M D;  3KUY A;  1U35 D;  5BO0 A;  5B0Y C;  2JE5 A;  5B1M D;  2HUE C;  2FFF B;  4E45 A;  5B0Y B;  2ZY3 A;  2HUE B;  4YM6 C;  3X1U D;  1P3L D;  4QLC D;  4YM6 B;  4NFT A;  3LEL A;  5B0Z D;  4Z66 C;  3MGR C;  1EQZ A;  2BYM A;  4YM6 A;  3REJ A;  3REL C;  4Z66 B;  3AN2 C;  1P34 C;  1Z2C B;  1P3G C;  3KXB D;  3REL B;  3AN2 B;  1P34 B;  1W2E A;  1P3G B;  4Z66 A;  5B2J D;  3UT9 A;  2IO5 C;  4KHA B;  4KUD A;  4J8U D;  1P34 A;  1ULY A;  2IO5 B;  4H9S C;  3C1C D;  5BNV B;  3LZ1 D;  1P3I C;  5BNX B;  1M18 C;  4Z5T D;  5BNV A;  3LZ0 A;  1M18 B;  3WKJ C;  5B2I D;  4WZS B;  2RVQ C;  4H9S A;  4X23 C;  3AZE C;  3AZK D;  3WKJ B;  3AZE B;  4XZQ C;  5GT0 D;  4X23 B;  1P3K D;  4XZQ B;  2Y2M A;  3REI C;  1P3P D;  5B1L D;  5AV9 A;  1S32 D;  1ID3 D;  5B32 A;  3H0L C;  3KUY D;  3AZJ C;  1BFM A;  2DF4 C;  2ZM5 A;  3REK A;  3AZH C;  3LJA A;  3AZH B;  1P3O A;  1WWI A;  3X1S C;  5DNN D;  4LD9 A;  3AZI C;  1M19 D;  3EPK A;  3LEL D;  3X1S B;  3AV1 B;  2F2A C;  3AZI B;  1EQZ D;  1P3B C;  3REJ D;  3AV1 A;  4ZUX A;  1AOI C;  4Z66 D;  3UT9 D;  2F8N H;  4NE3 A;  5B24 A;  1AOI B;  4KUD D;  5AVC B;  1R4V A;  5BT1 D;  4H9R B;  5FUG B;  2YFV A;  3V9R B;  5AVC A;  4J8W C;  3LZ0 D;  5FUG A;  4J8W B;  3AZL C;  3AZM C;  3AZL B;  2PYO C;  3MNN C;  3AZM B;  1P3F C;  2PYO B;  3MNN B;  3MVD C;  3AZL A;  5B31 B;  3B6G A;  1P3F B;  1KX3 A;  4YS3 C;  3MVD B;  3NQJ B;  2F8N B;  3MNN A;  5B31 A;  4WU9 A;  5AV9 D;  1P3F A;  1M1A C;  3F6T A;  5B32 D;  5AV6 A;  4M6B A;  3NQJ A;  3X1V C;  3WA9 C;  5BS7 C;  1M1A B;  3W96 C;  3WA9 B;  2ZY4 A;  2G5H C;  4R8P A;  3W96 B;  1F66 C;  3REK D;  4ZBJ C;  3WTP D;  3MGP C;  3WA9 A;  1F66 B;  2NZD A;  4ZBJ B;  3LJA D;  2FJ7 A;  5GT3 A;  1P3O D;  3MGP B;  4LD9 D;  2ARO A;  4JJN C;  2Y2J A;  3NQU B;  3B0D C;  4JJN B; 
#chains in the Genus database with same CATH homology
 4CSR B;  3B0D B;  5CPI A;  3AFA C;  4WNN B;  4Z2M G;  2G5I C;  3AV1 D;  4JJN A;  4J8V A;  3W98 C;  4ZUX D;  4CSR A;  3AFA B;  3W98 B;  5B24 D;  4WU8 C;  3W99 B;  4WU8 B;  5AV5 C;  3W99 A;  2CV5 D;  3TU4 B;  5E5A C;  3WAA C;  5AV5 B;  5AVC D;  4DRB A;  1ZLA D;  5E5A B;  3WAA B;  2BG1 A;  3MGQ C;  3TU4 A;  2Y2L A;  3B0C W;  3MGQ B;  2HIO A;  3B6G D;  3B6F D;  5AY8 D;  1KX3 D;  3AYW C;  5B31 D;  4WU9 D;  1P3F D;  4XUJ A;  3EPH A;  5KDM B;  3B0C T;  3REH A;  5AV6 D;  3AZG A;  3AZN C;  3AYW B;  3AZN B;  3EG5 B;  5KDM A;  3AYW A;  4R8P D;  2Y2K A;  5B40 C;  3A1I A;  2YFW B;  2NZD D;  5CPK D;  2FJ7 D;  2Y2G A;  5GT3 D;  5B40 B;  1HTA A;  2ARO D;  5B0Y A;  1P3A C;  3W97 C;  3AZF C;  3O62 C;  1P3A B;  3AZF B;  3O62 B;  5CPI D;  3UTB C;  4J8V D;  3MGR B;  4J8X C;  3UTB B;  3O62 A;  3AV2 C;  4H9N B;  4J8X B;  3MGR A;  3AV2 B;  3UTB A;  3REL A;  3AN2 A;  3W99 D;  4H9N A;  4J8X A;  1P3G A;  5AV8 C;  5JRG C;  3KWQ D;  4KHA A;  3MGS C;  5AV8 B;  3TU4 D;  5GXQ C;  5G49 B;  1P3I B;  4CAY B;  4E44 A;  3KSY A;  5BNX A;  5GXQ B;  1B67 A;  2HIO D;  1P3I A;  2XD5 A;  1M18 A;  5AVB C;  5B33 C;  3WKJ A;  5AVB B;  3AZE A;  4X23 A;  5B33 B;  4XUJ D;  3C1B C;  2XD1 A;  4G92 C;  3REH D;  3AZG D;  4XZQ A;  3C1B B;  4G92 B;  3EPL A;  3REI B;  3AYW D;  3C1B A;  3REI A;  3AZJ B;  2DQN C;  3AZJ A;  5B32 G;  5F99 C;  5B0Y D;  3VH6 A;  5F99 B;  3AZH A;  5DNM C;  5GSU C;  4YM6 D;  3H0M C;  4EO5 C;  5DNM B;  3A1K A;  3X1S A;  3O62 D;  5GSU B;  3AZI A;  1P3B B;  1H3O B;  4EO5 B;  1HQ3 C;  3AL0 C;  3MGR D;  3UTB D;  1HQ3 B;  5GSU A;  3UTA C;  1P3B A;  1H3O A;  3REL D;  3AN2 D;  5CP6 C;  4J8X D;  1PZR A;  1P34 D;  1P3G D;  3R45 B;  3UTA B;  4HGA C;  1KX4 C;  1AOI A;  3FDD A;  4HGA B;  3UTA A;  4H9R A;  1KX5 C;  3V9R A;  1P3I D;  1TZY C;  1M18 D;  1KX5 B;  4J8W A;  3WKJ D;  3AZE D;  2RVQ D;  4X23 D;  3AZM A;  2PYO A;  4XZQ D;  4DQY B;  1TAF B;  4YS3 B;  3X1T C;  3MVD A;  2F8N A;  3X1T B;  1BH9 B;  1TAF A;  4YS3 A;  3X1V B;  3A6N C;  3REI D;  2NQB C;  2JSS A;  1BH8 B;  1WWS A;  1M1A A;  1BH9 A;  3A6N B;  2NQB B;  3X1V A;  4Z2M H;  5BS7 A;  5B31 G;  3AZJ D;  1BH8 A;  2Y2O A;  2CWE A;  3W96 A;  4G91 C;  1T3U A;  1F66 A;  4G91 B;  3AZH D;  3MGP A;  4KGC C;  5CPJ C;  4KGC B;  3NQU A;  3X1S D;  5CPJ B;  3AZI D;  1P3M C;  1U35 C;  4WNN A;  4NE6 A;  4UPK A;  5GSU D;  1P3B D;  1P3M B;  3AFA A;  5B1M C;  4UUZ B;  3W98 A;  1P3M A;  1AOI D;  5B1M B;  4WU8 A;  3X1U C;  1N1J B;  1P3L C;  4QLC C;  3P5J B;  3X1U B;  5AV5 A;  5B0Z C;  1P3L B;  4QLC B;  1N1J A;  5E5A A;  3WAA A;  3KFU G;  4J8W D;  1A7W A;  3MGQ A;  3KXB C;  4DRA A;  3AZL D;  3AZM D;  5B2J C;  3KXB B;  2PYO D;  3MNN D;  1F1E A;  4J8U C;  5B2J B;  3MVD D;  3C1C C;  4J8U B;  2F8N D;  3LZ1 C;  4YS3 D;  3C1C B;  3LZ1 B;  4Z5T C;  1M1A D;  5B2I C;  3AZN A;  4Z5T B;  3X1V D;  3WA9 D;  4H9P B;  3AZK C;  5B2I B;  3W96 D;  5GT0 C;  3AZK B;  1KU5 A;  3VH6 W;  1P3K C;  2YFW A;  5GT0 B;  1F66 D;  5B40 A;  1P3K B;  2BYK B;  3MGP D;  3W97 B;  1P3P C;  5B1L C;  1ID3 C;  2BYK A;  1S32 C;  3EPJ A;  2F8N K;  4JJN D;  4AWL C;  5B1L B;  3KUY C;  3W97 A;  1S32 B;  1P3A A;  3VH6 T;  3AZF A;  1P3P B;  1ID3 B;  4WV4 B;  4WJ3 C;  4AWL B;  3KUY B;  1ID3 A;  5B1L A;  3AFA D;  3W98 D;  4NE5 A;  3AV2 A;  4WU8 D;  5DNN C;  1M19 C;  5JRG B;  3MGS B;  5AV5 D;  3LEL C;  5DNN B;  1M19 B;  5E5A D;  1EQZ C;  3WAA D;  5AV8 A;  5JRG A;  3LEL B;  3REJ C;  3MGS A;  5DNN A;  5G49 A;  1EQZ B;  3MGQ D;  2BYM B;  1M19 A;  4CAY A;  2RIQ A;  3REJ B;  5C3I C;  5GXQ A;  3VH5 A;  3UT9 C;  4KUD C;  5C3I B;  3UT9 B;  4KUD B;  5AVB A;  5BT1 C;  5B33 A;  2JCH A;  3LZ0 C;  3AZN D;  2Y2Q A;  3LZ0 B;  3H0R C;  5B40 D;  3IP4 C;  2Y2I A;  5AV9 C;  5B32 C;  2VQR A;  5F99 A;  5AV9 B;  1P3A D;  3W97 D;  5B32 B;  3AZF D;  5DNM A;  3REK C;  4H9Q B;  3WTP C;  3REK B;  3LJA C;  3AV2 D;  1P3O C;  3WTP B;  4H9Q A;  1HQ3 A;  5CP6 B;  4LD9 C;  3LJA B;  1P3O B;  1KX4 B;  3R45 A;  4LD9 B;  3WTP A;  5CP6 A;  5AV8 D;  5JRG D;  1KX4 A;  3MGS D;  3AV1 C;  4ZUX C;  5GXQ D;  1TZY B;  4ZUX B;  5B24 C;  1KX5 A;  5B24 B;  1TZY A;  5AVB D;  2CV5 C;  5B33 D;  5AVC C;  2ZY5 A;  2CV5 B;  2Y2H A;  2YFV B;  1ZLA C;  3C1B D;  1ZLA B;  2CV5 A;  3X1T A;  1ZLA A;  4H9O B;  3A6N A;  2F8N G;  2NQB A;  3B6F C;  2LY8 A;  5AY8 C;  1KX3 C;  3B6G C;  4H9O A;  3B6F B;  3B6G B;  5AY8 B;  1KX3 B;  5B31 C;  3WTP E;  4WU9 C;  5F99 D;  5AV6 C;  4WU9 B;  3B6F A;  5AY8 A;  5AV6 B;  4R8P C;  5DNM D;  4KGC A;  5CPJ A;  2ZY2 A;  4R8P B;  2Y2N A;  1U35 B;  5CPK C;  2NZD C;  2FJ7 C;  5GT3 C;  1HQ3 D;  2L5A A;  5CPK B;  2NZD B;  2FJ7 B;  2ARO C;  5GT3 B;  1U35 A;  4UUZ A;  1Q9C A;  3UTA D;  2ARO B;  5CP6 D;  5B1M A;  5CPK A;  5CPI C;  1KX4 D;  2J8P A;  4J8V C;  5B0Z B;  3X1U A;  5CPI B;  3VH5 W;  1P3L A;  4J8V B;  4QLC A;  1KX5 D;  5B0Z A;  1TZY D;  2Y2P A;  5CHL B;  5JA4 B;  3W99 C;  3KXB A;  3KWQ C;  5JA4 A;  1JFI B;  5B2J A;  3VH5 T;  3KWQ B;  3TU4 C;  3B0B A;  4J8U A;  1JFI A;  3X1T D;  3C1C A;  3KWQ A;  2HIO C;  3LZ1 A;  3A6N D;  2NQB D;  2HIO B;  4Z5T A;  4H9P A;  5B2I A;  3AZK A;  4XUJ C;  3REH C;  3AZG C;  5GT0 A;  4XUJ B;  1P3K A;  3REH B;  3AZG B;  1B6W A;  4KGC D;  2W8S A;  2UWX A;  5CPJ D;  1P3P A;  1S32 A;  5BO0 B;  1P3M D;  3KUY A;  1U35 D;  5BO0 A;  5B0Y C;  2JE5 A;  5B1M D;  2HUE C;  2FFF B;  4E45 A;  5B0Y B;  2ZY3 A;  2HUE B;  4YM6 C;  3X1U D;  1P3L D;  4QLC D;  4YM6 B;  4NFT A;  3LEL A;  5B0Z D;  4Z66 C;  3MGR C;  1EQZ A;  2BYM A;  4YM6 A;  3REJ A;  3REL C;  4Z66 B;  3AN2 C;  1P34 C;  1Z2C B;  1P3G C;  3KXB D;  3REL B;  3AN2 B;  1P34 B;  1W2E A;  1P3G B;  4Z66 A;  5B2J D;  3UT9 A;  2IO5 C;  4KHA B;  4KUD A;  4J8U D;  1P34 A;  1ULY A;  2IO5 B;  4H9S C;  3C1C D;  5BNV B;  3LZ1 D;  1P3I C;  5BNX B;  1M18 C;  4Z5T D;  5BNV A;  3LZ0 A;  1M18 B;  3WKJ C;  5B2I D;  4WZS B;  2RVQ C;  4H9S A;  4X23 C;  3AZE C;  3AZK D;  3WKJ B;  3AZE B;  4XZQ C;  5GT0 D;  4X23 B;  1P3K D;  4XZQ B;  2Y2M A;  3REI C;  1P3P D;  5B1L D;  5AV9 A;  1S32 D;  1ID3 D;  5B32 A;  3H0L C;  3KUY D;  3AZJ C;  1BFM A;  2DF4 C;  2ZM5 A;  3REK A;  3AZH C;  3LJA A;  3AZH B;  1P3O A;  1WWI A;  3X1S C;  5DNN D;  4LD9 A;  3AZI C;  1M19 D;  3EPK A;  3LEL D;  3X1S B;  3AV1 B;  2F2A C;  3AZI B;  1EQZ D;  1P3B C;  3REJ D;  3AV1 A;  4ZUX A;  1AOI C;  4Z66 D;  3UT9 D;  2F8N H;  4NE3 A;  5B24 A;  1AOI B;  4KUD D;  5AVC B;  1R4V A;  5BT1 D;  4H9R B;  5FUG B;  2YFV A;  3V9R B;  5AVC A;  4J8W C;  3LZ0 D;  5FUG A;  4J8W B;  3AZL C;  3AZM C;  3AZL B;  2PYO C;  3MNN C;  3AZM B;  1P3F C;  2PYO B;  3MNN B;  3MVD C;  3AZL A;  5B31 B;  3B6G A;  1P3F B;  1KX3 A;  4YS3 C;  3MVD B;  3NQJ B;  2F8N B;  3MNN A;  5B31 A;  4WU9 A;  5AV9 D;  1P3F A;  1M1A C;  3F6T A;  5B32 D;  5AV6 A;  4M6B A;  3NQJ A;  3X1V C;  3WA9 C;  5BS7 C;  1M1A B;  3W96 C;  3WA9 B;  2ZY4 A;  2G5H C;  4R8P A;  3W96 B;  1F66 C;  3REK D;  4ZBJ C;  3WTP D;  3MGP C;  3WA9 A;  1F66 B;  2NZD A;  4ZBJ B;  3LJA D;  2FJ7 A;  5GT3 A;  1P3O D;  3MGP B;  4LD9 D;  2ARO A;  4JJN C;  2Y2J A;  3NQU B;  3B0D C;  4JJN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...