4J8UD

X-ray structure of ncp145 with chlorido(eta-6-p-cymene)(n-phenyl-2-pyridinecarbothioamide)osmium(ii)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
95
structure length
95
Chain Sequence
b'KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Novel metal(II) arene 2-pyridinecarbothioamides: a rationale to orally active organometallic anticancer agents
doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 37
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4j8uD00
3AFAB 3X1VB 2LY8A 2HIOA 3A6ND 5B40B 2NQBB 4H9OB 1KX5D 4H9SC 4KGCB 5JRGD 3UTAB 3AV1D 3AV2C 5GXQD 3AZLA 3KUYC 3REHD 2HIOC 4QLCB 2YFVA 2HUEC 3MGPA 5B1MB 3MGRB 1N1JB 4Z5TD 3WKJD 5AV5A 3AZLC 5C3IC 3MNNC 3WA9D 5B31B 1M19D 3W97A 5B1LB 3MGQA 5B2JB 4HGAC 5DNMA 5BO0B 5B33A 1P3IC 5F99A 3MGSD 4CAYA 5AV5C 4JJNC 5B24D 1ID3B 3W97C 2L5AA 5AY8B 3MGQC 4AWLC 3AZMA 5GT3A 5DNMC 5AV9B 5B33C 3W96B 2BYMA 3NQUB 1P34D 5B32G 5BNVA 1P3GC 5E5AA 4J8UB 3AZKC 4J8WA 3AZMC 1KX3A 5GT3C 1U35C 3TU4B 5AVCC 3V9RB 3B6GC 3REID 3O62B 3AYWB 1P3KB 4J8WC 4XUJA 3LZ0A 1KX3C 4Z2MH 2IO5B 1P3FA 5GT0B 4X23B 3NQJA 2HIOD 4EO5B 5GSUA 4YS3A 2PYOB 5AV6A 5B32A 5B0ZA 3LZ0C 1P3MB 1TZYC 1BFMA 2YFWB 1P3BC 2FJ7C 1KX4A 3AZLD 3MNND 5AVBA 5GSUC 3AZEA 5DNNA 5AV6C 4WU8A 2F8NB 3WTPB 1M1AB 1P3ID 3W98B 3B0DC 2CV5A 3KSYA 4JJND 3AZGA 3AZEC 3W97D 5DNNC 3MGQD 4WU8C 1BH9B 3X1TA 3RELB 5DNMD 5B33D 4NE3A 1F66B 3W99B 1P3GD 4CSRA 3UT9B 3AZKD 2CV5C 4YM6C 3AZGC 4UUZB 3AZIB 2NZDB 3KWQB 4ZUXA 1EQZC 3KXBB 5CP6A 3AZMD 3X1TC 1S32A 5GT3D 1U35D 5B0YB 1P3LC 5AVCD 3AZJA 3B6GD 1P3PA 2AROC 2BYKA 1H3OA 4J8WD 4ZUXC 2F8NH 4J8XA 1KX5B 4R8PC 1S32C 1KX3D 5GXQB 1M18A 4J8VA 3REHB 5CPIC 1P3PC 5JA4B 3LZ0D 3B6FA 5B31G 4J8XC 1TZYD 3AZHD 1P3BD 4KHAA 2FJ7D 4Z5TB 3MVDA 1M18C 3WKJB 4H9PA 4J8VC 3WA9B 1M19B 4Z2MG 3X1SC 2NQBA 3VH6W 5AV6D 4KGCA 3UTAA 4E44A 3MGSB 3MVDC 1HQ3C 5B24B 3AZED 5DNND 4WU8D 3UTAC 5CPJA 1P34B 1A7WA 5G49B 5B31A 1ZLAA 3B0BA 2CV5D 4YM6D 3AZGD 1EQZD 5BNXB 1P3AA 1WWSA 3X1UA 3R45B 5CPJC 1P3LD 4H9RB 3REIB 1ZLAC 1ID3A 2AROD 5AY8A 3LJAA 4ZUXD 3MGPC 1P3AC 4R8PD 3W96A 3LZ1A 3X1UC 5CPKA 1S32D 1AOIB 2HIOB 5CPID 1P3PD 5FUGA 5CHLB 1ID3C 4H9QA 3LJAC 1R4VA 4J8XD 3LZ1C 5CPKC 3TU4A 5F99C 1M18D 3AZLB 5C3IB 2F8NG 3MNNB 4J8VD 4WV4B 3X1SD 5BT1C 5KDMA 4HGAB 1JFIA 4G92B 3UTBA 3VH6T 1P3IB 3MVDD 5GT0A 4X23A 1HQ3D 5E5AC 5B2IA 4JJNB 3AN2A 3W97B 2PYOA 3MGQB 1P3MA 3C1CA 4AWLB 3LELA 5DNMB 3UTAD 3UTBC 1BH8B 5B33B 3AV2D 1HTAA 3KUYD 4CAYB 5GT0C 1P3GB 5B2IC 4LD9A 3AZKB 3AN2C 3REKA 4XUJC 3C1CC 5AV8A 3AZMB 3LELC 3WAAB 5GT3B 3AZFA 1M1AA 1U35B 5CPJD 5AVCB 1P3FC 3B6GB 3W98A 4DRAA 5BNVB 4YS3C 1ZLAD 4LD9C 4J8WB 3REKC 5B0ZC 5B32C 4XZQA 3MGPD 3RELA 5AV8C 1KX3B 1P3AD 3AZFC 3C1BA 3X1UD 1M1AC 1KX4C 4KUDA 5AV5D 3W99A 5AVBC 3UT9A 3AZNA 2NZDA 3AZIA 1ID3D 3KWQA 3LZ0B 4XZQC 3LJAD 1P3OA 3KXBA 1TZYB 3AZHB 1P3BB 2FJ7B 4WNNB 3LZ1D 5CPKD 3C1BC 5F99D 4KUDC 3NQJB 3AZNC 4DRBA 5BT1D 4Z66A 5AV6B 1KX5A 1P3OC 1KU5A 4E45A 4NE5A 3A6NB 3B0DB 5E5AD 3AZEB 5JA4A 5DNNB 1TAFB 4Z66C 4WU8B 5JRGB 3REJA 3AV1B 5CP6C 3UTBD 4Z5TA 3AZJC 5GT0D 3WA9A 5B2ID 4WU9A 4YM6B 3AZGB 3AN2D 4XUJD 1EQZB 4G91C 3C1CD 3REJC 3LELD 1P3LB 3AFAA 4ZBJC 3X1VA 1P3FD 3WTPE 5GSUD 5B40A 5B24A 2AROB 4YS3D 4WU9C 4LD9D 3REIC 3REKD 4H9OA 5B0ZD 5B32D 3B6FC 4R8PB 5AV8D 1S32B 1P34A 3AZFD 1KX4D 3X1VC 5G49A 3AFAC 4QLCA 5CPIB 1P3PB 5AVBD 5B40C 2NQBC 1H3OB 2JSSA 2RVQC 4H9NB 4XZQD 5B1MA 4KGCC 4J8XB 3MGRA 1N1JA 3VH5W 1P34C 3C1BD 1M18B 3REIA 4KUDD 4J8VB 4QLCC 5B1LA 3AZND 3X1SB 5B2JA 4H9SA 5BO0A 5B1MC 1P3OD 3X1TD 3MGRC 3MVDB 1AOIA 4H9PB 1HQ3B 5B31C 5B1LC 5B2JC 4Z66D 5AV9A 5CP6D 4NFTA 3NQUA 3AV2B 3KUYB 1AOIC 4J8UA 3MNNA 3AZJD 5AY8C 2HUEB 3REJD 1B6WA 5AV9C 3W96C 1ULYA 5CPJB 3V9RA 1P3IA 3O62A 4J8UC 3AYWA 1P3KA 4JJNA 1ZLAB 2YFVB 4WU9D 3B6FD 3MGPB 4G92C 1BH8A 1P3AB 3TU4C 3X1UB 5AV5B 3AFAD 3X1VD 3O62C 1P3GA 3AYWC 3AZKA 1P3KC 5B40D 2NQBD 3LJAB 2RVQD 2YFWA 4KGCD 3WAAA 2IO5C 1U35A 3LZ1B 2CWEA 5CPKB 5AVCA 5F99B 3B6GA 3VH5T 4X23C 4EO5C 4QLCD 5FUGB 2PYOC 1P3MC 4H9QB 2F8NA 3WTPA 5B1MD 3WAAC 3MGRD 2BYMB 5E5AB 5B31D 5B1LD 4M6BA 5B2JD 5KDMB 1BH9A 1TZYA 3AZHA 3VH6A 1JFIB 3WTPC 1P3BA 2FJ7A 4WNNA 3UTBB 1F66A 3B0CW 3W98C 1AOID 5B2IB 4UUZA 3AN2B 5AY8D 4XUJB 3C1CB 3AZHC 3RELC 3LELB 5AV9D 5B0YA 3W96D 1F66C 3VH5A 3W99C 3A6NA 1P3FB 4J8UD 3UT9C 5GSUB 2F8NK 4YS3B 4LD9B 4NE6A 3AZIC 2NZDC 3KWQC 3REKB 1TAFA 5B32B 5B0ZB 5JRGA 3AV1A 3KXBC 5AV8B 5GXQA 5B0YC 3AZFB 3TU4D 1KX4B 5BS7A 3REHA 1WWIA 3A6NC 3O62D 3AYWD 5AVBB 1P3KD 4YM6A 1EQZA 1KX5C 4XZQB 5JRGC 3AV1C 5GXQC 1P3LA 3WKJA 3C1BB 5BS7C 3REHC 4KUDB 4X23D 1M19A 2CV5B 2AROA 3AZNB 2PYOD 1P3MD 1P3OB 3X1TB 4R8PA 3WAAD 4Z5TC 3MGSA 3WKJC 3WA9C 5CPIA 4CSRB 1M19C 4ZUXB 4H9NA 4Z66B 2F8ND 5CP6B 3WTPD 1M1AD 3MGSC 1F1EA 3AZJB 3W98D 3B0CT 5B24C 2BYKB 3X1SA 5BNXA 4G91B 3REJB 3R45A 4WZSB 3RELD 4H9RA 1F66D 4ZBJB 3W99D 1HQ3A 3UT9D 4WU9B 2NZDD 3AZID 3KWQD 3B6FB 3KXBD 3AV2A 4KHAB 5B0YD 1Q9CA 3KUYA 1B67A
chains in the Genus database with same CATH superfamily
3AFAB 3X1VB 2LY8A 2HIOA 3A6ND 5B40B 2NQBB 4H9OB 1KX5D 4H9SC 2XD1A 4KGCB 5JRGD 3UTAB 3AV1D 3AV2C 5GXQD 3AZLA 3KUYC 3REHD 2HIOC 4QLCB 2YFVA 2XD5A 2HUEC 3MGPA 5B1MB 3MGRB 1N1JB 4Z5TD 3WKJD 5AV5A 3AZLC 5C3IC 3MNNC 3WA9D 5B31B 1M19D 3W97A 5B1LB 3MGQA 5B2JB 4HGAC 5DNMA 5BO0B 5B33A 1P3IC 5F99A 3MGSD 4CAYA 5AV5C 4JJNC 5B24D 1ID3B 3W97C 2L5AA 5AY8B 3MGQC 4AWLC 3AZMA 5GT3A 5DNMC 5AV9B 5B33C 3W96B 2BYMA 3NQUB 1P34D 5B32G 2ZY2A 5BNVA 1P3GC 5E5AA 4J8UB 3AZKC 4J8WA 3AZMC 1KX3A 5GT3C 1U35C 3TU4B 5AVCC 3V9RB 3B6GC 3REID 3O62B 2Y2KA 3AYWB 1P3KB 4J8WC 4XUJA 3LZ0A 1KX3C 4Z2MH 2IO5B 1P3FA 5GT0B 4X23B 3NQJA 2HIOD 4EO5B 5GSUA 4YS3A 2PYOB 3P5JB 5AV6A 5B32A 5B0ZA 3LZ0C 1P3MB 1TZYC 1BFMA 2YFWB 1P3BC 2FJ7C 1KX4A 3AZLD 3MNND 5AVBA 5GSUC 3AZEA 5DNNA 5AV6C 4WU8A 2F8NB 3WTPB 1M1AB 1P3ID 3W98B 3B0DC 2CV5A 3KSYA 4JJND 3AZGA 3AZEC 3W97D 5DNNC 3MGQD 4WU8C 1BH9B 3X1TA 3RELB 5DNMD 5B33D 4NE3A 1F66B 3W99B 1P3GD 4CSRA 3UT9B 3AZKD 2CV5C 4YM6C 3AZGC 4UUZB 3AZIB 2NZDB 3KWQB 4ZUXA 1EQZC 3KXBB 5CP6A 3AZMD 3X1TC 1S32A 5GT3D 2FFFB 5B0YB 1U35D 1P3LC 5AVCD 3AZJA 3B6GD 1P3PA 3FDDA 2AROC 2BYKA 1H3OA 2Y2LA 2Y2PA 4J8WD 4ZUXC 2F8NH 4J8XA 1KX5B 4R8PC 1S32C 1KX3D 2UWXA 5GXQB 1M18A 4J8VA 3REHB 5CPIC 1P3PC 2RIQA 5JA4B 2Y2JA 3LZ0D 3B6FA 5B31G 4J8XC 1TZYD 3AZHD 1P3BD 4KHAA 2FJ7D 4Z5TB 3MVDA 1M18C 3WKJB 4H9PA 4J8VC 3WA9B 3EPHA 1M19B 4Z2MG 3EPLA 3X1SC 2NQBA 3A1IA 3VH6W 5AV6D 4KGCA 3UTAA 4E44A 4WJ3C 3MGSB 3MVDC 2DQNC 1HQ3C 5B24B 3AZED 5DNND 4WU8D 3UTAC 5CPJA 1P34B 1A7WA 5G49B 5B31A 1ZLAA 3B0BA 2CV5D 4YM6D 3AZGD 1EQZD 5BNXB 1P3AA 1WWSA 3X1UA 3R45B 5CPJC 1P3LD 4H9RB 3REIB 1ZLAC 1ID3A 2AROD 5AY8A 3LJAA 4ZUXD 3MGPC 1P3AC 4R8PD 3W96A 3LZ1A 3X1UC 5CPKA 1S32D 1AOIB 2HIOB 5CPID 1P3PD 5FUGA 5CHLB 1ID3C 4H9QA 3LJAC 1R4VA 4J8XD 3LZ1C 5CPKC 3TU4A 5F99C 1M18D 3AZLB 5C3IB 2F8NG 3MNNB 4J8VD 4WV4B 3X1SD 5BT1C 5KDMA 4HGAB 1JFIA 2Y2GA 4G92B 3UTBA 3VH6T 1P3IB 3MVDD 5GT0A 4X23A 1HQ3D 5E5AC 5B2IA 4JJNB 3AN2A 3W97B 2PYOA 3MGQB 1P3MA 2Y2MA 3C1CA 4AWLB 3LELA 5DNMB 3UTAD 3UTBC 1BH8B 5B33B 3AV2D 1HTAA 3KUYD 4CAYB 5GT0C 1P3GB 5B2IC 4LD9A 3AZKB 3AN2C 3REKA 4XUJC 3C1CC 3A1KA 5AV8A 3LELC 3AZMB 3WAAB 5GT3B 3AZFA 1M1AA 2Y2QA 1U35B 5CPJD 5AVCB 1P3FC 3B6GB 3W98A 4DRAA 5BNVB 2JCHA 4YS3C 1ZLAD 4LD9C 4J8WB 3REKC 5B0ZC 5B32C 4XZQA 3H0MC 3MGPD 3RELA 5AV8C 1KX3B 1P3AD 3AZFC 3C1BA 3X1UD 1M1AC 1KX4C 4KUDA 5AV5D 3W99A 5AVBC 3UT9A 3AZNA 2NZDA 3AZIA 1ID3D 3KWQA 3LZ0B 4XZQC 3LJAD 1P3OA 3KXBA 1TZYB 3AZHB 1P3BB 2Y2OA 2FJ7B 4WNNB 3LZ1D 5CPKD 3C1BC 5F99D 4KUDC 3NQJB 3AZNC 4DRBA 5BT1D 4Z66A 5AV6B 1KX5A 1P3OC 3F6TA 1KU5A 4E45A 4NE5A 3A6NB 3B0DB 5E5AD 3AZEB 5JA4A 5DNNB 1TAFB 4Z66C 4WU8B 5JRGB 3REJA 3AV1B 5CP6C 3UTBD 4Z5TA 3AZJC 5GT0D 3WA9A 5B2ID 4WU9A 4YM6B 3AZGB 3AN2D 4XUJD 1EQZB 2ZY4A 4G91C 3C1CD 3IP4C 3REJC 3LELD 1P3LB 3AFAA 4ZBJC 1Z2CB 2W8SA 3X1VA 3WTPE 1P3FD 2Y2IA 5GSUD 5B40A 5B24A 2AROB 4YS3D 4WU9C 4LD9D 3REIC 1PZRA 4H9OA 5B0ZD 5B32D 3REKD 3B6FC 4R8PB 5AV8D 1S32B 1P34A 3AZFD 2J8PA 1KX4D 3X1VC 5G49A 3AFAC 4QLCA 5CPIB 1P3PB 5AVBD 5B40C 2NQBC 1H3OB 2JSSA 2RVQC 2ZM5A 4H9NB 4XZQD 5B1MA 4KGCC 4J8XB 3EPKA 3MGRA 1N1JA 3VH5W 1P34C 3C1BD 1M18B 3REIA 4KUDD 4J8VB 4QLCC 5B1LA 3AZND 3X1SB 5B2JA 4H9SA 5BO0A 5B1MC 1P3OD 3X1TD 3MGRC 3MVDB 1AOIA 4H9PB 1HQ3B 5B31C 5B1LC 5B2JC 4Z66D 5AV9A 5CP6D 4NFTA 3NQUA 3AV2B 3EPJA 3KUYB 1AOIC 2G5IC 3MNNA 4J8UA 3AZJD 5AY8C 2HUEB 3REJD 1B6WA 5AV9C 3W96C 1ULYA 5CPJB 3V9RA 1P3IA 2BG1A 3O62A 4J8UC 3AYWA 1P3KA 3H0RC 4JJNA 1ZLAB 2YFVB 4WU9D 1T3UA 3B6FD 3MGPB 4G92C 1BH8A 1P3AB 3TU4C 3X1UB 2ZY3A 5AV5B 3AFAD 3X1VD 3O62C 1P3GA 3AYWC 3AZKA 1P3KC 5B40D 2NQBD 3LJAB 2RVQD 2YFWA 4KGCD 2Y2HA 2IO5C 3WAAA 2VQRA 3LZ1B 2CWEA 5CPKB 1U35A 5AVCA 5F99B 2G5HC 3VH5T 2DF4C 3B6GA 4X23C 4EO5C 4QLCD 5FUGB 2PYOC 1P3MC 4H9QB 2F8NA 3WTPA 5B1MD 3WAAC 3MGRD 2BYMB 5E5AB 5B31D 5B1LD 4M6BA 5B2JD 5KDMB 1BH9A 3H0LC 1TZYA 3AZHA 3VH6A 1JFIB 3WTPC 1P3BA 2FJ7A 4WNNA 3UTBB 1F66A 3B0CW 3W98C 1AOID 5B2IB 4UUZA 3AN2B 5AY8D 4XUJB 2F2AC 3C1CB 3AZHC 2JE5A 3RELC 3LELB 1W2EA 5AV9D 5B0YA 3W96D 1F66C 3VH5A 3W99C 3A6NA 1P3FB 4J8UD 3UT9C 5GSUB 2F8NK 4YS3B 4LD9B 4NE6A 3AZIC 2NZDC 3KWQC 3REKB 1TAFA 5B32B 5B0ZB 5JRGA 3AV1A 3KXBC 5AV8B 5GXQA 5B0YC 3AZFB 3TU4D 1KX4B 5BS7A 3KFUG 3REHA 1WWIA 3A6NC 3O62D 3AYWD 5AVBB 1P3KD 4YM6A 1EQZA 1KX5C 4XZQB 5JRGC 3AV1C 5GXQC 1P3LA 3WKJA 3C1BB 5BS7C 3REHC 4KUDB 2Y2NA 4X23D 1M19A 2CV5B 2AROA 4DQYB 3AZNB 2PYOD 1P3MD 1P3OB 3X1TB 2ZY5A 4R8PA 3WAAD 4Z5TC 3MGSA 3WKJC 4UPKA 3WA9C 5CPIA 4CSRB 1M19C 3EG5B 4ZUXB 4H9NA 4Z66B 2F8ND 5CP6B 3WTPD 1M1AD 3MGSC 1F1EA 3AZJB 3W98D 3B0CT 5B24C 2BYKB 3X1SA 5BNXA 4G91B 3REJB 3R45A 4WZSB 3RELD 4H9RA 1F66D 4ZBJB 3W99D 1HQ3A 3UT9D 4WU9B 2NZDD 3AZID 3KWQD 3B6FB 3KXBD 3AV2A 4KHAB 5B0YD 3AL0C 1Q9CA 3KUYA 1B67A
chains in the Genus database with same CATH topology
3AFAB 3X1VB 2LY8A 2HIOA 3A6ND 5B40B 2NQBB 4H9OB 1KX5D 4H9SC 2XD1A 4KGCB 5JRGD 3UTAB 3AV1D 3AV2C 5GXQD 3AZLA 3KUYC 3REHD 2HIOC 4QLCB 2YFVA 2XD5A 2HUEC 3MGPA 5B1MB 3MGRB 1N1JB 4Z5TD 3WKJD 5AV5A 3AZLC 5C3IC 3MNNC 3WA9D 5B31B 1M19D 3W97A 5B1LB 3MGQA 5B2JB 4HGAC 5DNMA 5BO0B 5B33A 1P3IC 5F99A 3MGSD 4CAYA 5AV5C 4JJNC 5B24D 1ID3B 3W97C 2L5AA 5AY8B 3MGQC 4AWLC 3AZMA 5GT3A 5DNMC 5AV9B 5B33C 3W96B 2BYMA 3NQUB 1P34D 5B32G 2ZY2A 5BNVA 1P3GC 5E5AA 4J8UB 3AZKC 4J8WA 3AZMC 1KX3A 5GT3C 1U35C 3TU4B 5AVCC 3V9RB 3B6GC 3REID 3O62B 2Y2KA 3AYWB 1P3KB 4J8WC 4XUJA 3LZ0A 1KX3C 4Z2MH 2IO5B 1P3FA 5GT0B 4X23B 3NQJA 2HIOD 4EO5B 5GSUA 4YS3A 2PYOB 3P5JB 5AV6A 5B32A 5B0ZA 3LZ0C 1P3MB 1TZYC 1BFMA 2YFWB 1P3BC 2FJ7C 1KX4A 3AZLD 3MNND 5AVBA 5GSUC 3AZEA 5DNNA 5AV6C 4WU8A 2F8NB 3WTPB 1M1AB 1P3ID 3W98B 3B0DC 2CV5A 3KSYA 4JJND 3AZGA 3AZEC 3W97D 5DNNC 3MGQD 4WU8C 1BH9B 3X1TA 3RELB 5DNMD 5B33D 4NE3A 1F66B 3W99B 1P3GD 4CSRA 3UT9B 3AZKD 2CV5C 4YM6C 3AZGC 4UUZB 3AZIB 2NZDB 3KWQB 4ZUXA 1EQZC 3KXBB 5CP6A 3AZMD 3X1TC 1S32A 5GT3D 2FFFB 5B0YB 1U35D 1P3LC 5AVCD 3AZJA 3B6GD 1P3PA 3FDDA 2AROC 2BYKA 1H3OA 2Y2LA 2Y2PA 4J8WD 4ZUXC 2F8NH 4J8XA 1KX5B 4R8PC 1S32C 1KX3D 2UWXA 5GXQB 1M18A 4J8VA 3REHB 5CPIC 1P3PC 2RIQA 5JA4B 2Y2JA 3LZ0D 3B6FA 5B31G 4J8XC 1TZYD 3AZHD 1P3BD 4KHAA 2FJ7D 4Z5TB 3MVDA 1M18C 3WKJB 4H9PA 4J8VC 3WA9B 3EPHA 1M19B 4Z2MG 3EPLA 3X1SC 2NQBA 3A1IA 3VH6W 5AV6D 4KGCA 3UTAA 4E44A 4WJ3C 3MGSB 3MVDC 2DQNC 1HQ3C 5B24B 3AZED 5DNND 4WU8D 3UTAC 5CPJA 1P34B 1A7WA 5G49B 5B31A 1ZLAA 3B0BA 2CV5D 4YM6D 3AZGD 1EQZD 5BNXB 1P3AA 1WWSA 3X1UA 3R45B 5CPJC 1P3LD 4H9RB 3REIB 1ZLAC 1ID3A 2AROD 5AY8A 3LJAA 4ZUXD 3MGPC 1P3AC 4R8PD 3W96A 3LZ1A 3X1UC 5CPKA 1S32D 1AOIB 2HIOB 5CPID 1P3PD 5FUGA 5CHLB 1ID3C 4H9QA 3LJAC 1R4VA 4J8XD 3LZ1C 5CPKC 3TU4A 5F99C 1M18D 3AZLB 5C3IB 2F8NG 3MNNB 4J8VD 4WV4B 3X1SD 5BT1C 5KDMA 4HGAB 1JFIA 2Y2GA 4G92B 3UTBA 3VH6T 1P3IB 3MVDD 5GT0A 4X23A 1HQ3D 5E5AC 5B2IA 4JJNB 3AN2A 3W97B 2PYOA 3MGQB 1P3MA 2Y2MA 3C1CA 4AWLB 3LELA 5DNMB 3UTAD 3UTBC 1BH8B 5B33B 3AV2D 1HTAA 3KUYD 4CAYB 5GT0C 1P3GB 5B2IC 4LD9A 3AZKB 3AN2C 3REKA 4XUJC 3C1CC 3A1KA 5AV8A 3LELC 3AZMB 3WAAB 5GT3B 3AZFA 1M1AA 2Y2QA 1U35B 5CPJD 5AVCB 1P3FC 3B6GB 3W98A 4DRAA 5BNVB 2JCHA 4YS3C 1ZLAD 4LD9C 4J8WB 3REKC 5B0ZC 5B32C 4XZQA 3H0MC 3MGPD 3RELA 5AV8C 1KX3B 1P3AD 3AZFC 3C1BA 3X1UD 1M1AC 1KX4C 4KUDA 5AV5D 3W99A 5AVBC 3UT9A 3AZNA 2NZDA 3AZIA 1ID3D 3KWQA 3LZ0B 4XZQC 3LJAD 1P3OA 3KXBA 1TZYB 3AZHB 1P3BB 2Y2OA 2FJ7B 4WNNB 3LZ1D 5CPKD 3C1BC 5F99D 4KUDC 3NQJB 3AZNC 4DRBA 5BT1D 4Z66A 5AV6B 1KX5A 1P3OC 3F6TA 1KU5A 4E45A 4NE5A 3A6NB 3B0DB 5E5AD 3AZEB 5JA4A 5DNNB 1TAFB 4Z66C 4WU8B 5JRGB 3REJA 3AV1B 5CP6C 3UTBD 4Z5TA 3AZJC 5GT0D 3WA9A 5B2ID 4WU9A 4YM6B 3AZGB 3AN2D 4XUJD 1EQZB 2ZY4A 4G91C 3C1CD 3IP4C 3REJC 3LELD 1P3LB 3AFAA 4ZBJC 1Z2CB 2W8SA 3X1VA 3WTPE 1P3FD 2Y2IA 5GSUD 5B40A 5B24A 2AROB 4YS3D 4WU9C 4LD9D 3REIC 1PZRA 4H9OA 5B0ZD 5B32D 3REKD 3B6FC 4R8PB 5AV8D 1S32B 1P34A 3AZFD 2J8PA 1KX4D 3X1VC 5G49A 3AFAC 4QLCA 5CPIB 1P3PB 5AVBD 5B40C 2NQBC 1H3OB 2JSSA 2RVQC 2ZM5A 4H9NB 4XZQD 5B1MA 4KGCC 4J8XB 3EPKA 3MGRA 1N1JA 3VH5W 1P34C 3C1BD 1M18B 3REIA 4KUDD 4J8VB 4QLCC 5B1LA 3AZND 3X1SB 5B2JA 4H9SA 5BO0A 5B1MC 1P3OD 3X1TD 3MGRC 3MVDB 1AOIA 4H9PB 1HQ3B 5B31C 5B1LC 5B2JC 4Z66D 5AV9A 5CP6D 4NFTA 3NQUA 3AV2B 3EPJA 3KUYB 1AOIC 2G5IC 3MNNA 4J8UA 3AZJD 5AY8C 2HUEB 3REJD 1B6WA 5AV9C 3W96C 1ULYA 5CPJB 3V9RA 1P3IA 2BG1A 3O62A 4J8UC 3AYWA 1P3KA 3H0RC 4JJNA 1ZLAB 2YFVB 4WU9D 1T3UA 3B6FD 3MGPB 4G92C 1BH8A 1P3AB 3TU4C 3X1UB 2ZY3A 5AV5B 3AFAD 3X1VD 3O62C 1P3GA 3AYWC 3AZKA 1P3KC 5B40D 2NQBD 3LJAB 2RVQD 2YFWA 4KGCD 2Y2HA 2IO5C 3WAAA 2VQRA 3LZ1B 2CWEA 5CPKB 1U35A 5AVCA 5F99B 2G5HC 3VH5T 2DF4C 3B6GA 4X23C 4EO5C 4QLCD 5FUGB 2PYOC 1P3MC 4H9QB 2F8NA 3WTPA 5B1MD 3WAAC 3MGRD 2BYMB 5E5AB 5B31D 5B1LD 4M6BA 5B2JD 5KDMB 1BH9A 3H0LC 1TZYA 3AZHA 3VH6A 1JFIB 3WTPC 1P3BA 2FJ7A 4WNNA 3UTBB 1F66A 3B0CW 3W98C 1AOID 5B2IB 4UUZA 3AN2B 5AY8D 4XUJB 2F2AC 3C1CB 3AZHC 2JE5A 3RELC 3LELB 1W2EA 5AV9D 5B0YA 3W96D 1F66C 3VH5A 3W99C 3A6NA 1P3FB 4J8UD 3UT9C 5GSUB 2F8NK 4YS3B 4LD9B 4NE6A 3AZIC 2NZDC 3KWQC 3REKB 1TAFA 5B32B 5B0ZB 5JRGA 3AV1A 3KXBC 5AV8B 5GXQA 5B0YC 3AZFB 3TU4D 1KX4B 5BS7A 3KFUG 3REHA 1WWIA 3A6NC 3O62D 3AYWD 5AVBB 1P3KD 4YM6A 1EQZA 1KX5C 4XZQB 5JRGC 3AV1C 5GXQC 1P3LA 3WKJA 3C1BB 5BS7C 3REHC 4KUDB 2Y2NA 4X23D 1M19A 2CV5B 2AROA 4DQYB 3AZNB 2PYOD 1P3MD 1P3OB 3X1TB 2ZY5A 4R8PA 3WAAD 4Z5TC 3MGSA 3WKJC 4UPKA 3WA9C 5CPIA 4CSRB 1M19C 3EG5B 4ZUXB 4H9NA 4Z66B 2F8ND 5CP6B 3WTPD 1M1AD 3MGSC 1F1EA 3AZJB 3W98D 3B0CT 5B24C 2BYKB 3X1SA 5BNXA 4G91B 3REJB 3R45A 4WZSB 3RELD 4H9RA 1F66D 4ZBJB 3W99D 1HQ3A 3UT9D 4WU9B 2NZDD 3AZID 3KWQD 3B6FB 3KXBD 3AV2A 4KHAB 5B0YD 3AL0C 1Q9CA 3KUYA 1B67A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AFA B;  3X1V B;  2LY8 A;  2HIO A;  3A6N D;  5B40 B;  2NQB B;  4H9O B;  1KX5 D;  4H9S C;  4KGC B;  5JRG D;  3UTA B;  3AV1 D;  3AV2 C;  5GXQ D;  3AZL A;  3KUY C;  3REH D;  2HIO C;  4QLC B;  2YFV A;  2HUE C;  3MGP A;  5B1M B;  3MGR B;  1N1J B;  4Z5T D;  3WKJ D;  5AV5 A;  3AZL C;  5C3I C;  3MNN C;  3WA9 D;  5B31 B;  1M19 D;  3W97 A;  5B1L B;  3MGQ A;  5B2J B;  4HGA C;  5DNM A;  5BO0 B;  5B33 A;  1P3I C;  5F99 A;  3MGS D;  4CAY A;  5AV5 C;  4JJN C;  5B24 D;  1ID3 B;  3W97 C;  2L5A A;  5AY8 B;  3MGQ C;  4AWL C;  3AZM A;  5GT3 A;  5DNM C;  5AV9 B;  5B33 C;  3W96 B;  2BYM A;  3NQU B;  1P34 D;  5B32 G;  5BNV A;  1P3G C;  5E5A A;  4J8U B;  3AZK C;  4J8W A;  3AZM C;  1KX3 A;  5GT3 C;  1U35 C;  3TU4 B;  5AVC C;  3V9R B;  3B6G C;  3REI D;  3O62 B;  3AYW B;  1P3K B;  4J8W C;  4XUJ A;  3LZ0 A;  1KX3 C;  4Z2M H;  2IO5 B;  1P3F A;  5GT0 B;  4X23 B;  3NQJ A;  2HIO D;  4EO5 B;  5GSU A;  4YS3 A;  2PYO B;  5AV6 A;  5B32 A;  5B0Z A;  3LZ0 C;  1P3M B;  1TZY C;  1BFM A;  2YFW B;  1P3B C;  2FJ7 C;  1KX4 A;  3AZL D;  3MNN D;  5AVB A;  5GSU C;  3AZE A;  5DNN A;  5AV6 C;  4WU8 A;  2F8N B;  3WTP B;  1M1A B;  1P3I D;  3W98 B;  3B0D C;  2CV5 A;  3KSY A;  4JJN D;  3AZG A;  3AZE C;  3W97 D;  5DNN C;  3MGQ D;  4WU8 C;  1BH9 B;  3X1T A;  3REL B;  5DNM D;  5B33 D;  4NE3 A;  1F66 B;  3W99 B;  1P3G D;  4CSR A;  3UT9 B;  3AZK D;  2CV5 C;  4YM6 C;  3AZG C;  4UUZ B;  3AZI B;  2NZD B;  3KWQ B;  4ZUX A;  1EQZ C;  3KXB B;  5CP6 A;  3AZM D;  3X1T C;  1S32 A;  5GT3 D;  1U35 D;  5B0Y B;  1P3L C;  5AVC D;  3AZJ A;  3B6G D;  1P3P A;  2ARO C;  2BYK A;  1H3O A;  4J8W D;  4ZUX C;  2F8N H;  4J8X A;  1KX5 B;  4R8P C;  1S32 C;  1KX3 D;  5GXQ B;  1M18 A;  4J8V A;  3REH B;  5CPI C;  1P3P C;  5JA4 B;  3LZ0 D;  3B6F A;  5B31 G;  4J8X C;  1TZY D;  3AZH D;  1P3B D;  4KHA A;  2FJ7 D;  4Z5T B;  3MVD A;  1M18 C;  3WKJ B;  4H9P A;  4J8V C;  3WA9 B;  1M19 B;  4Z2M G;  3X1S C;  2NQB A;  3VH6 W;  5AV6 D;  4KGC A;  3UTA A;  4E44 A;  3MGS B;  3MVD C;  1HQ3 C;  5B24 B;  3AZE D;  5DNN D;  4WU8 D;  3UTA C;  5CPJ A;  1P34 B;  1A7W A;  5G49 B;  5B31 A;  1ZLA A;  3B0B A;  2CV5 D;  4YM6 D;  3AZG D;  1EQZ D;  5BNX B;  1P3A A;  1WWS A;  3X1U A;  3R45 B;  5CPJ C;  1P3L D;  4H9R B;  3REI B;  1ZLA C;  1ID3 A;  2ARO D;  5AY8 A;  3LJA A;  4ZUX D;  3MGP C;  1P3A C;  4R8P D;  3W96 A;  3LZ1 A;  3X1U C;  5CPK A;  1S32 D;  1AOI B;  2HIO B;  5CPI D;  1P3P D;  5FUG A;  5CHL B;  1ID3 C;  4H9Q A;  3LJA C;  1R4V A;  4J8X D;  3LZ1 C;  5CPK C;  3TU4 A;  5F99 C;  1M18 D;  3AZL B;  5C3I B;  2F8N G;  3MNN B;  4J8V D;  4WV4 B;  3X1S D;  5BT1 C;  5KDM A;  4HGA B;  1JFI A;  4G92 B;  3UTB A;  3VH6 T;  1P3I B;  3MVD D;  5GT0 A;  4X23 A;  1HQ3 D;  5E5A C;  5B2I A;  4JJN B;  3AN2 A;  3W97 B;  2PYO A;  3MGQ B;  1P3M A;  3C1C A;  4AWL B;  3LEL A;  5DNM B;  3UTA D;  3UTB C;  1BH8 B;  5B33 B;  3AV2 D;  1HTA A;  3KUY D;  4CAY B;  5GT0 C;  1P3G B;  5B2I C;  4LD9 A;  3AZK B;  3AN2 C;  3REK A;  4XUJ C;  3C1C C;  5AV8 A;  3AZM B;  3LEL C;  3WAA B;  5GT3 B;  3AZF A;  1M1A A;  1U35 B;  5CPJ D;  5AVC B;  1P3F C;  3B6G B;  3W98 A;  4DRA A;  5BNV B;  4YS3 C;  1ZLA D;  4LD9 C;  4J8W B;  3REK C;  5B0Z C;  5B32 C;  4XZQ A;  3MGP D;  3REL A;  5AV8 C;  1KX3 B;  1P3A D;  3AZF C;  3C1B A;  3X1U D;  1M1A C;  1KX4 C;  4KUD A;  5AV5 D;  3W99 A;  5AVB C;  3UT9 A;  3AZN A;  2NZD A;  3AZI A;  1ID3 D;  3KWQ A;  3LZ0 B;  4XZQ C;  3LJA D;  1P3O A;  3KXB A;  1TZY B;  3AZH B;  1P3B B;  2FJ7 B;  4WNN B;  3LZ1 D;  5CPK D;  3C1B C;  5F99 D;  4KUD C;  3NQJ B;  3AZN C;  4DRB A;  5BT1 D;  4Z66 A;  5AV6 B;  1KX5 A;  1P3O C;  1KU5 A;  4E45 A;  4NE5 A;  3A6N B;  3B0D B;  5E5A D;  3AZE B;  5JA4 A;  5DNN B;  1TAF B;  4Z66 C;  4WU8 B;  5JRG B;  3REJ A;  3AV1 B;  5CP6 C;  3UTB D;  4Z5T A;  3AZJ C;  5GT0 D;  3WA9 A;  5B2I D;  4WU9 A;  4YM6 B;  3AZG B;  3AN2 D;  4XUJ D;  1EQZ B;  4G91 C;  3C1C D;  3REJ C;  3LEL D;  1P3L B;  3AFA A;  4ZBJ C;  3X1V A;  1P3F D;  3WTP E;  5GSU D;  5B40 A;  5B24 A;  2ARO B;  4YS3 D;  4WU9 C;  4LD9 D;  3REI C;  3REK D;  4H9O A;  5B0Z D;  5B32 D;  3B6F C;  4R8P B;  5AV8 D;  1S32 B;  1P34 A;  3AZF D;  1KX4 D;  3X1V C;  5G49 A;  3AFA C;  4QLC A;  5CPI B;  1P3P B;  5AVB D;  5B40 C;  2NQB C;  1H3O B;  2JSS A;  2RVQ C;  4H9N B;  4XZQ D;  5B1M A;  4KGC C;  4J8X B;  3MGR A;  1N1J A;  3VH5 W;  1P34 C;  3C1B D;  1M18 B;  3REI A;  4KUD D;  4J8V B;  4QLC C;  5B1L A;  3AZN D;  3X1S B;  5B2J A;  4H9S A;  5BO0 A;  5B1M C;  1P3O D;  3X1T D;  3MGR C;  3MVD B;  1AOI A;  4H9P B;  1HQ3 B;  5B31 C;  5B1L C;  5B2J C;  4Z66 D;  5AV9 A;  5CP6 D;  4NFT A;  3NQU A;  3AV2 B;  3KUY B;  1AOI C;  4J8U A;  3MNN A;  3AZJ D;  5AY8 C;  2HUE B;  3REJ D;  1B6W A;  5AV9 C;  3W96 C;  1ULY A;  5CPJ B;  3V9R A;  1P3I A;  3O62 A;  4J8U C;  3AYW A;  1P3K A;  4JJN A;  1ZLA B;  2YFV B;  4WU9 D;  3B6F D;  3MGP B;  4G92 C;  1BH8 A;  1P3A B;  3TU4 C;  3X1U B;  5AV5 B;  3AFA D;  3X1V D;  3O62 C;  1P3G A;  3AYW C;  3AZK A;  1P3K C;  5B40 D;  2NQB D;  3LJA B;  2RVQ D;  2YFW A;  4KGC D;  3WAA A;  2IO5 C;  1U35 A;  3LZ1 B;  2CWE A;  5CPK B;  5AVC A;  5F99 B;  3B6G A;  3VH5 T;  4X23 C;  4EO5 C;  4QLC D;  5FUG B;  2PYO C;  1P3M C;  4H9Q B;  2F8N A;  3WTP A;  5B1M D;  3WAA C;  3MGR D;  2BYM B;  5E5A B;  5B31 D;  5B1L D;  4M6B A;  5B2J D;  5KDM B;  1BH9 A;  1TZY A;  3AZH A;  3VH6 A;  1JFI B;  3WTP C;  1P3B A;  2FJ7 A;  4WNN A;  3UTB B;  1F66 A;  3B0C W;  3W98 C;  1AOI D;  5B2I B;  4UUZ A;  3AN2 B;  5AY8 D;  4XUJ B;  3C1C B;  3AZH C;  3REL C;  3LEL B;  5AV9 D;  5B0Y A;  3W96 D;  1F66 C;  3VH5 A;  3W99 C;  3A6N A;  1P3F B;  4J8U D;  3UT9 C;  5GSU B;  2F8N K;  4YS3 B;  4LD9 B;  4NE6 A;  3AZI C;  2NZD C;  3KWQ C;  3REK B;  1TAF A;  5B32 B;  5B0Z B;  5JRG A;  3AV1 A;  3KXB C;  5AV8 B;  5GXQ A;  5B0Y C;  3AZF B;  3TU4 D;  1KX4 B;  5BS7 A;  3REH A;  1WWI A;  3A6N C;  3O62 D;  3AYW D;  5AVB B;  1P3K D;  4YM6 A;  1EQZ A;  1KX5 C;  4XZQ B;  5JRG C;  3AV1 C;  5GXQ C;  1P3L A;  3WKJ A;  3C1B B;  5BS7 C;  3REH C;  4KUD B;  4X23 D;  1M19 A;  2CV5 B;  2ARO A;  3AZN B;  2PYO D;  1P3M D;  1P3O B;  3X1T B;  4R8P A;  3WAA D;  4Z5T C;  3MGS A;  3WKJ C;  3WA9 C;  5CPI A;  4CSR B;  1M19 C;  4ZUX B;  4H9N A;  4Z66 B;  2F8N D;  5CP6 B;  3WTP D;  1M1A D;  3MGS C;  1F1E A;  3AZJ B;  3W98 D;  3B0C T;  5B24 C;  2BYK B;  3X1S A;  5BNX A;  4G91 B;  3REJ B;  3R45 A;  4WZS B;  3REL D;  4H9R A;  1F66 D;  4ZBJ B;  3W99 D;  1HQ3 A;  3UT9 D;  4WU9 B;  2NZD D;  3AZI D;  3KWQ D;  3B6F B;  3KXB D;  3AV2 A;  4KHA B;  5B0Y D;  1Q9C A;  3KUY A;  1B67 A; 
#chains in the Genus database with same CATH topology
 3AFA B;  3X1V B;  2LY8 A;  2HIO A;  3A6N D;  5B40 B;  2NQB B;  4H9O B;  1KX5 D;  4H9S C;  2XD1 A;  4KGC B;  5JRG D;  3UTA B;  3AV1 D;  3AV2 C;  5GXQ D;  3AZL A;  3KUY C;  3REH D;  2HIO C;  4QLC B;  2YFV A;  2XD5 A;  2HUE C;  3MGP A;  5B1M B;  3MGR B;  1N1J B;  4Z5T D;  3WKJ D;  5AV5 A;  3AZL C;  5C3I C;  3MNN C;  3WA9 D;  5B31 B;  1M19 D;  3W97 A;  5B1L B;  3MGQ A;  5B2J B;  4HGA C;  5DNM A;  5BO0 B;  5B33 A;  1P3I C;  5F99 A;  3MGS D;  4CAY A;  5AV5 C;  4JJN C;  5B24 D;  1ID3 B;  3W97 C;  2L5A A;  5AY8 B;  3MGQ C;  4AWL C;  3AZM A;  5GT3 A;  5DNM C;  5AV9 B;  5B33 C;  3W96 B;  2BYM A;  3NQU B;  1P34 D;  5B32 G;  2ZY2 A;  5BNV A;  1P3G C;  5E5A A;  4J8U B;  3AZK C;  4J8W A;  3AZM C;  1KX3 A;  5GT3 C;  1U35 C;  3TU4 B;  5AVC C;  3V9R B;  3B6G C;  3REI D;  3O62 B;  2Y2K A;  3AYW B;  1P3K B;  4J8W C;  4XUJ A;  3LZ0 A;  1KX3 C;  4Z2M H;  2IO5 B;  1P3F A;  5GT0 B;  4X23 B;  3NQJ A;  2HIO D;  4EO5 B;  5GSU A;  4YS3 A;  2PYO B;  3P5J B;  5AV6 A;  5B32 A;  5B0Z A;  3LZ0 C;  1P3M B;  1TZY C;  1BFM A;  2YFW B;  1P3B C;  2FJ7 C;  1KX4 A;  3AZL D;  3MNN D;  5AVB A;  5GSU C;  3AZE A;  5DNN A;  5AV6 C;  4WU8 A;  2F8N B;  3WTP B;  1M1A B;  1P3I D;  3W98 B;  3B0D C;  2CV5 A;  3KSY A;  4JJN D;  3AZG A;  3AZE C;  3W97 D;  5DNN C;  3MGQ D;  4WU8 C;  1BH9 B;  3X1T A;  3REL B;  5DNM D;  5B33 D;  4NE3 A;  1F66 B;  3W99 B;  1P3G D;  4CSR A;  3UT9 B;  3AZK D;  2CV5 C;  4YM6 C;  3AZG C;  4UUZ B;  3AZI B;  2NZD B;  3KWQ B;  4ZUX A;  1EQZ C;  3KXB B;  5CP6 A;  3AZM D;  3X1T C;  1S32 A;  5GT3 D;  2FFF B;  5B0Y B;  1U35 D;  1P3L C;  5AVC D;  3AZJ A;  3B6G D;  1P3P A;  3FDD A;  2ARO C;  2BYK A;  1H3O A;  2Y2L A;  2Y2P A;  4J8W D;  4ZUX C;  2F8N H;  4J8X A;  1KX5 B;  4R8P C;  1S32 C;  1KX3 D;  2UWX A;  5GXQ B;  1M18 A;  4J8V A;  3REH B;  5CPI C;  1P3P C;  2RIQ A;  5JA4 B;  2Y2J A;  3LZ0 D;  3B6F A;  5B31 G;  4J8X C;  1TZY D;  3AZH D;  1P3B D;  4KHA A;  2FJ7 D;  4Z5T B;  3MVD A;  1M18 C;  3WKJ B;  4H9P A;  4J8V C;  3WA9 B;  3EPH A;  1M19 B;  4Z2M G;  3EPL A;  3X1S C;  2NQB A;  3A1I A;  3VH6 W;  5AV6 D;  4KGC A;  3UTA A;  4E44 A;  4WJ3 C;  3MGS B;  3MVD C;  2DQN C;  1HQ3 C;  5B24 B;  3AZE D;  5DNN D;  4WU8 D;  3UTA C;  5CPJ A;  1P34 B;  1A7W A;  5G49 B;  5B31 A;  1ZLA A;  3B0B A;  2CV5 D;  4YM6 D;  3AZG D;  1EQZ D;  5BNX B;  1P3A A;  1WWS A;  3X1U A;  3R45 B;  5CPJ C;  1P3L D;  4H9R B;  3REI B;  1ZLA C;  1ID3 A;  2ARO D;  5AY8 A;  3LJA A;  4ZUX D;  3MGP C;  1P3A C;  4R8P D;  3W96 A;  3LZ1 A;  3X1U C;  5CPK A;  1S32 D;  1AOI B;  2HIO B;  5CPI D;  1P3P D;  5FUG A;  5CHL B;  1ID3 C;  4H9Q A;  3LJA C;  1R4V A;  4J8X D;  3LZ1 C;  5CPK C;  3TU4 A;  5F99 C;  1M18 D;  3AZL B;  5C3I B;  2F8N G;  3MNN B;  4J8V D;  4WV4 B;  3X1S D;  5BT1 C;  5KDM A;  4HGA B;  1JFI A;  2Y2G A;  4G92 B;  3UTB A;  3VH6 T;  1P3I B;  3MVD D;  5GT0 A;  4X23 A;  1HQ3 D;  5E5A C;  5B2I A;  4JJN B;  3AN2 A;  3W97 B;  2PYO A;  3MGQ B;  1P3M A;  2Y2M A;  3C1C A;  4AWL B;  3LEL A;  5DNM B;  3UTA D;  3UTB C;  1BH8 B;  5B33 B;  3AV2 D;  1HTA A;  3KUY D;  4CAY B;  5GT0 C;  1P3G B;  5B2I C;  4LD9 A;  3AZK B;  3AN2 C;  3REK A;  4XUJ C;  3C1C C;  3A1K A;  5AV8 A;  3LEL C;  3AZM B;  3WAA B;  5GT3 B;  3AZF A;  1M1A A;  2Y2Q A;  1U35 B;  5CPJ D;  5AVC B;  1P3F C;  3B6G B;  3W98 A;  4DRA A;  5BNV B;  2JCH A;  4YS3 C;  1ZLA D;  4LD9 C;  4J8W B;  3REK C;  5B0Z C;  5B32 C;  4XZQ A;  3H0M C;  3MGP D;  3REL A;  5AV8 C;  1KX3 B;  1P3A D;  3AZF C;  3C1B A;  3X1U D;  1M1A C;  1KX4 C;  4KUD A;  5AV5 D;  3W99 A;  5AVB C;  3UT9 A;  3AZN A;  2NZD A;  3AZI A;  1ID3 D;  3KWQ A;  3LZ0 B;  4XZQ C;  3LJA D;  1P3O A;  3KXB A;  1TZY B;  3AZH B;  1P3B B;  2Y2O A;  2FJ7 B;  4WNN B;  3LZ1 D;  5CPK D;  3C1B C;  5F99 D;  4KUD C;  3NQJ B;  3AZN C;  4DRB A;  5BT1 D;  4Z66 A;  5AV6 B;  1KX5 A;  1P3O C;  3F6T A;  1KU5 A;  4E45 A;  4NE5 A;  3A6N B;  3B0D B;  5E5A D;  3AZE B;  5JA4 A;  5DNN B;  1TAF B;  4Z66 C;  4WU8 B;  5JRG B;  3REJ A;  3AV1 B;  5CP6 C;  3UTB D;  4Z5T A;  3AZJ C;  5GT0 D;  3WA9 A;  5B2I D;  4WU9 A;  4YM6 B;  3AZG B;  3AN2 D;  4XUJ D;  1EQZ B;  2ZY4 A;  4G91 C;  3C1C D;  3IP4 C;  3REJ C;  3LEL D;  1P3L B;  3AFA A;  4ZBJ C;  1Z2C B;  2W8S A;  3X1V A;  3WTP E;  1P3F D;  2Y2I A;  5GSU D;  5B40 A;  5B24 A;  2ARO B;  4YS3 D;  4WU9 C;  4LD9 D;  3REI C;  1PZR A;  4H9O A;  5B0Z D;  5B32 D;  3REK D;  3B6F C;  4R8P B;  5AV8 D;  1S32 B;  1P34 A;  3AZF D;  2J8P A;  1KX4 D;  3X1V C;  5G49 A;  3AFA C;  4QLC A;  5CPI B;  1P3P B;  5AVB D;  5B40 C;  2NQB C;  1H3O B;  2JSS A;  2RVQ C;  2ZM5 A;  4H9N B;  4XZQ D;  5B1M A;  4KGC C;  4J8X B;  3EPK A;  3MGR A;  1N1J A;  3VH5 W;  1P34 C;  3C1B D;  1M18 B;  3REI A;  4KUD D;  4J8V B;  4QLC C;  5B1L A;  3AZN D;  3X1S B;  5B2J A;  4H9S A;  5BO0 A;  5B1M C;  1P3O D;  3X1T D;  3MGR C;  3MVD B;  1AOI A;  4H9P B;  1HQ3 B;  5B31 C;  5B1L C;  5B2J C;  4Z66 D;  5AV9 A;  5CP6 D;  4NFT A;  3NQU A;  3AV2 B;  3EPJ A;  3KUY B;  1AOI C;  2G5I C;  3MNN A;  4J8U A;  3AZJ D;  5AY8 C;  2HUE B;  3REJ D;  1B6W A;  5AV9 C;  3W96 C;  1ULY A;  5CPJ B;  3V9R A;  1P3I A;  2BG1 A;  3O62 A;  4J8U C;  3AYW A;  1P3K A;  3H0R C;  4JJN A;  1ZLA B;  2YFV B;  4WU9 D;  1T3U A;  3B6F D;  3MGP B;  4G92 C;  1BH8 A;  1P3A B;  3TU4 C;  3X1U B;  2ZY3 A;  5AV5 B;  3AFA D;  3X1V D;  3O62 C;  1P3G A;  3AYW C;  3AZK A;  1P3K C;  5B40 D;  2NQB D;  3LJA B;  2RVQ D;  2YFW A;  4KGC D;  2Y2H A;  2IO5 C;  3WAA A;  2VQR A;  3LZ1 B;  2CWE A;  5CPK B;  1U35 A;  5AVC A;  5F99 B;  2G5H C;  3VH5 T;  2DF4 C;  3B6G A;  4X23 C;  4EO5 C;  4QLC D;  5FUG B;  2PYO C;  1P3M C;  4H9Q B;  2F8N A;  3WTP A;  5B1M D;  3WAA C;  3MGR D;  2BYM B;  5E5A B;  5B31 D;  5B1L D;  4M6B A;  5B2J D;  5KDM B;  1BH9 A;  3H0L C;  1TZY A;  3AZH A;  3VH6 A;  1JFI B;  3WTP C;  1P3B A;  2FJ7 A;  4WNN A;  3UTB B;  1F66 A;  3B0C W;  3W98 C;  1AOI D;  5B2I B;  4UUZ A;  3AN2 B;  5AY8 D;  4XUJ B;  2F2A C;  3C1C B;  3AZH C;  2JE5 A;  3REL C;  3LEL B;  1W2E A;  5AV9 D;  5B0Y A;  3W96 D;  1F66 C;  3VH5 A;  3W99 C;  3A6N A;  1P3F B;  4J8U D;  3UT9 C;  5GSU B;  2F8N K;  4YS3 B;  4LD9 B;  4NE6 A;  3AZI C;  2NZD C;  3KWQ C;  3REK B;  1TAF A;  5B32 B;  5B0Z B;  5JRG A;  3AV1 A;  3KXB C;  5AV8 B;  5GXQ A;  5B0Y C;  3AZF B;  3TU4 D;  1KX4 B;  5BS7 A;  3KFU G;  3REH A;  1WWI A;  3A6N C;  3O62 D;  3AYW D;  5AVB B;  1P3K D;  4YM6 A;  1EQZ A;  1KX5 C;  4XZQ B;  5JRG C;  3AV1 C;  5GXQ C;  1P3L A;  3WKJ A;  3C1B B;  5BS7 C;  3REH C;  4KUD B;  2Y2N A;  4X23 D;  1M19 A;  2CV5 B;  2ARO A;  4DQY B;  3AZN B;  2PYO D;  1P3M D;  1P3O B;  3X1T B;  2ZY5 A;  4R8P A;  3WAA D;  4Z5T C;  3MGS A;  3WKJ C;  4UPK A;  3WA9 C;  5CPI A;  4CSR B;  1M19 C;  3EG5 B;  4ZUX B;  4H9N A;  4Z66 B;  2F8N D;  5CP6 B;  3WTP D;  1M1A D;  3MGS C;  1F1E A;  3AZJ B;  3W98 D;  3B0C T;  5B24 C;  2BYK B;  3X1S A;  5BNX A;  4G91 B;  3REJ B;  3R45 A;  4WZS B;  3REL D;  4H9R A;  1F66 D;  4ZBJ B;  3W99 D;  1HQ3 A;  3UT9 D;  4WU9 B;  2NZD D;  3AZI D;  3KWQ D;  3B6F B;  3KXB D;  3AV2 A;  4KHA B;  5B0Y D;  3AL0 C;  1Q9C A;  3KUY A;  1B67 A; 
#chains in the Genus database with same CATH homology
 3AFA B;  3X1V B;  2LY8 A;  2HIO A;  3A6N D;  5B40 B;  2NQB B;  4H9O B;  1KX5 D;  4H9S C;  2XD1 A;  4KGC B;  5JRG D;  3UTA B;  3AV1 D;  3AV2 C;  5GXQ D;  3AZL A;  3KUY C;  3REH D;  2HIO C;  4QLC B;  2YFV A;  2XD5 A;  2HUE C;  3MGP A;  5B1M B;  3MGR B;  1N1J B;  4Z5T D;  3WKJ D;  5AV5 A;  3AZL C;  5C3I C;  3MNN C;  3WA9 D;  5B31 B;  1M19 D;  3W97 A;  5B1L B;  3MGQ A;  5B2J B;  4HGA C;  5DNM A;  5BO0 B;  5B33 A;  1P3I C;  5F99 A;  3MGS D;  4CAY A;  5AV5 C;  4JJN C;  5B24 D;  1ID3 B;  3W97 C;  2L5A A;  5AY8 B;  3MGQ C;  4AWL C;  3AZM A;  5GT3 A;  5DNM C;  5AV9 B;  5B33 C;  3W96 B;  2BYM A;  3NQU B;  1P34 D;  5B32 G;  2ZY2 A;  5BNV A;  1P3G C;  5E5A A;  4J8U B;  3AZK C;  4J8W A;  3AZM C;  1KX3 A;  5GT3 C;  1U35 C;  3TU4 B;  5AVC C;  3V9R B;  3B6G C;  3REI D;  3O62 B;  2Y2K A;  3AYW B;  1P3K B;  4J8W C;  4XUJ A;  3LZ0 A;  1KX3 C;  4Z2M H;  2IO5 B;  1P3F A;  5GT0 B;  4X23 B;  3NQJ A;  2HIO D;  4EO5 B;  5GSU A;  4YS3 A;  2PYO B;  3P5J B;  5AV6 A;  5B32 A;  5B0Z A;  3LZ0 C;  1P3M B;  1TZY C;  1BFM A;  2YFW B;  1P3B C;  2FJ7 C;  1KX4 A;  3AZL D;  3MNN D;  5AVB A;  5GSU C;  3AZE A;  5DNN A;  5AV6 C;  4WU8 A;  2F8N B;  3WTP B;  1M1A B;  1P3I D;  3W98 B;  3B0D C;  2CV5 A;  3KSY A;  4JJN D;  3AZG A;  3AZE C;  3W97 D;  5DNN C;  3MGQ D;  4WU8 C;  1BH9 B;  3X1T A;  3REL B;  5DNM D;  5B33 D;  4NE3 A;  1F66 B;  3W99 B;  1P3G D;  4CSR A;  3UT9 B;  3AZK D;  2CV5 C;  4YM6 C;  3AZG C;  4UUZ B;  3AZI B;  2NZD B;  3KWQ B;  4ZUX A;  1EQZ C;  3KXB B;  5CP6 A;  3AZM D;  3X1T C;  1S32 A;  5GT3 D;  2FFF B;  5B0Y B;  1U35 D;  1P3L C;  5AVC D;  3AZJ A;  3B6G D;  1P3P A;  3FDD A;  2ARO C;  2BYK A;  1H3O A;  2Y2L A;  2Y2P A;  4J8W D;  4ZUX C;  2F8N H;  4J8X A;  1KX5 B;  4R8P C;  1S32 C;  1KX3 D;  2UWX A;  5GXQ B;  1M18 A;  4J8V A;  3REH B;  5CPI C;  1P3P C;  2RIQ A;  5JA4 B;  2Y2J A;  3LZ0 D;  3B6F A;  5B31 G;  4J8X C;  1TZY D;  3AZH D;  1P3B D;  4KHA A;  2FJ7 D;  4Z5T B;  3MVD A;  1M18 C;  3WKJ B;  4H9P A;  4J8V C;  3WA9 B;  3EPH A;  1M19 B;  4Z2M G;  3EPL A;  3X1S C;  2NQB A;  3A1I A;  3VH6 W;  5AV6 D;  4KGC A;  3UTA A;  4E44 A;  4WJ3 C;  3MGS B;  3MVD C;  2DQN C;  1HQ3 C;  5B24 B;  3AZE D;  5DNN D;  4WU8 D;  3UTA C;  5CPJ A;  1P34 B;  1A7W A;  5G49 B;  5B31 A;  1ZLA A;  3B0B A;  2CV5 D;  4YM6 D;  3AZG D;  1EQZ D;  5BNX B;  1P3A A;  1WWS A;  3X1U A;  3R45 B;  5CPJ C;  1P3L D;  4H9R B;  3REI B;  1ZLA C;  1ID3 A;  2ARO D;  5AY8 A;  3LJA A;  4ZUX D;  3MGP C;  1P3A C;  4R8P D;  3W96 A;  3LZ1 A;  3X1U C;  5CPK A;  1S32 D;  1AOI B;  2HIO B;  5CPI D;  1P3P D;  5FUG A;  5CHL B;  1ID3 C;  4H9Q A;  3LJA C;  1R4V A;  4J8X D;  3LZ1 C;  5CPK C;  3TU4 A;  5F99 C;  1M18 D;  3AZL B;  5C3I B;  2F8N G;  3MNN B;  4J8V D;  4WV4 B;  3X1S D;  5BT1 C;  5KDM A;  4HGA B;  1JFI A;  2Y2G A;  4G92 B;  3UTB A;  3VH6 T;  1P3I B;  3MVD D;  5GT0 A;  4X23 A;  1HQ3 D;  5E5A C;  5B2I A;  4JJN B;  3AN2 A;  3W97 B;  2PYO A;  3MGQ B;  1P3M A;  2Y2M A;  3C1C A;  4AWL B;  3LEL A;  5DNM B;  3UTA D;  3UTB C;  1BH8 B;  5B33 B;  3AV2 D;  1HTA A;  3KUY D;  4CAY B;  5GT0 C;  1P3G B;  5B2I C;  4LD9 A;  3AZK B;  3AN2 C;  3REK A;  4XUJ C;  3C1C C;  3A1K A;  5AV8 A;  3LEL C;  3AZM B;  3WAA B;  5GT3 B;  3AZF A;  1M1A A;  2Y2Q A;  1U35 B;  5CPJ D;  5AVC B;  1P3F C;  3B6G B;  3W98 A;  4DRA A;  5BNV B;  2JCH A;  4YS3 C;  1ZLA D;  4LD9 C;  4J8W B;  3REK C;  5B0Z C;  5B32 C;  4XZQ A;  3H0M C;  3MGP D;  3REL A;  5AV8 C;  1KX3 B;  1P3A D;  3AZF C;  3C1B A;  3X1U D;  1M1A C;  1KX4 C;  4KUD A;  5AV5 D;  3W99 A;  5AVB C;  3UT9 A;  3AZN A;  2NZD A;  3AZI A;  1ID3 D;  3KWQ A;  3LZ0 B;  4XZQ C;  3LJA D;  1P3O A;  3KXB A;  1TZY B;  3AZH B;  1P3B B;  2Y2O A;  2FJ7 B;  4WNN B;  3LZ1 D;  5CPK D;  3C1B C;  5F99 D;  4KUD C;  3NQJ B;  3AZN C;  4DRB A;  5BT1 D;  4Z66 A;  5AV6 B;  1KX5 A;  1P3O C;  3F6T A;  1KU5 A;  4E45 A;  4NE5 A;  3A6N B;  3B0D B;  5E5A D;  3AZE B;  5JA4 A;  5DNN B;  1TAF B;  4Z66 C;  4WU8 B;  5JRG B;  3REJ A;  3AV1 B;  5CP6 C;  3UTB D;  4Z5T A;  3AZJ C;  5GT0 D;  3WA9 A;  5B2I D;  4WU9 A;  4YM6 B;  3AZG B;  3AN2 D;  4XUJ D;  1EQZ B;  2ZY4 A;  4G91 C;  3C1C D;  3IP4 C;  3REJ C;  3LEL D;  1P3L B;  3AFA A;  4ZBJ C;  1Z2C B;  2W8S A;  3X1V A;  3WTP E;  1P3F D;  2Y2I A;  5GSU D;  5B40 A;  5B24 A;  2ARO B;  4YS3 D;  4WU9 C;  4LD9 D;  3REI C;  1PZR A;  4H9O A;  5B0Z D;  5B32 D;  3REK D;  3B6F C;  4R8P B;  5AV8 D;  1S32 B;  1P34 A;  3AZF D;  2J8P A;  1KX4 D;  3X1V C;  5G49 A;  3AFA C;  4QLC A;  5CPI B;  1P3P B;  5AVB D;  5B40 C;  2NQB C;  1H3O B;  2JSS A;  2RVQ C;  2ZM5 A;  4H9N B;  4XZQ D;  5B1M A;  4KGC C;  4J8X B;  3EPK A;  3MGR A;  1N1J A;  3VH5 W;  1P34 C;  3C1B D;  1M18 B;  3REI A;  4KUD D;  4J8V B;  4QLC C;  5B1L A;  3AZN D;  3X1S B;  5B2J A;  4H9S A;  5BO0 A;  5B1M C;  1P3O D;  3X1T D;  3MGR C;  3MVD B;  1AOI A;  4H9P B;  1HQ3 B;  5B31 C;  5B1L C;  5B2J C;  4Z66 D;  5AV9 A;  5CP6 D;  4NFT A;  3NQU A;  3AV2 B;  3EPJ A;  3KUY B;  1AOI C;  2G5I C;  3MNN A;  4J8U A;  3AZJ D;  5AY8 C;  2HUE B;  3REJ D;  1B6W A;  5AV9 C;  3W96 C;  1ULY A;  5CPJ B;  3V9R A;  1P3I A;  2BG1 A;  3O62 A;  4J8U C;  3AYW A;  1P3K A;  3H0R C;  4JJN A;  1ZLA B;  2YFV B;  4WU9 D;  1T3U A;  3B6F D;  3MGP B;  4G92 C;  1BH8 A;  1P3A B;  3TU4 C;  3X1U B;  2ZY3 A;  5AV5 B;  3AFA D;  3X1V D;  3O62 C;  1P3G A;  3AYW C;  3AZK A;  1P3K C;  5B40 D;  2NQB D;  3LJA B;  2RVQ D;  2YFW A;  4KGC D;  2Y2H A;  2IO5 C;  3WAA A;  2VQR A;  3LZ1 B;  2CWE A;  5CPK B;  1U35 A;  5AVC A;  5F99 B;  2G5H C;  3VH5 T;  2DF4 C;  3B6G A;  4X23 C;  4EO5 C;  4QLC D;  5FUG B;  2PYO C;  1P3M C;  4H9Q B;  2F8N A;  3WTP A;  5B1M D;  3WAA C;  3MGR D;  2BYM B;  5E5A B;  5B31 D;  5B1L D;  4M6B A;  5B2J D;  5KDM B;  1BH9 A;  3H0L C;  1TZY A;  3AZH A;  3VH6 A;  1JFI B;  3WTP C;  1P3B A;  2FJ7 A;  4WNN A;  3UTB B;  1F66 A;  3B0C W;  3W98 C;  1AOI D;  5B2I B;  4UUZ A;  3AN2 B;  5AY8 D;  4XUJ B;  2F2A C;  3C1C B;  3AZH C;  2JE5 A;  3REL C;  3LEL B;  1W2E A;  5AV9 D;  5B0Y A;  3W96 D;  1F66 C;  3VH5 A;  3W99 C;  3A6N A;  1P3F B;  4J8U D;  3UT9 C;  5GSU B;  2F8N K;  4YS3 B;  4LD9 B;  4NE6 A;  3AZI C;  2NZD C;  3KWQ C;  3REK B;  1TAF A;  5B32 B;  5B0Z B;  5JRG A;  3AV1 A;  3KXB C;  5AV8 B;  5GXQ A;  5B0Y C;  3AZF B;  3TU4 D;  1KX4 B;  5BS7 A;  3KFU G;  3REH A;  1WWI A;  3A6N C;  3O62 D;  3AYW D;  5AVB B;  1P3K D;  4YM6 A;  1EQZ A;  1KX5 C;  4XZQ B;  5JRG C;  3AV1 C;  5GXQ C;  1P3L A;  3WKJ A;  3C1B B;  5BS7 C;  3REH C;  4KUD B;  2Y2N A;  4X23 D;  1M19 A;  2CV5 B;  2ARO A;  4DQY B;  3AZN B;  2PYO D;  1P3M D;  1P3O B;  3X1T B;  2ZY5 A;  4R8P A;  3WAA D;  4Z5T C;  3MGS A;  3WKJ C;  4UPK A;  3WA9 C;  5CPI A;  4CSR B;  1M19 C;  3EG5 B;  4ZUX B;  4H9N A;  4Z66 B;  2F8N D;  5CP6 B;  3WTP D;  1M1A D;  3MGS C;  1F1E A;  3AZJ B;  3W98 D;  3B0C T;  5B24 C;  2BYK B;  3X1S A;  5BNX A;  4G91 B;  3REJ B;  3R45 A;  4WZS B;  3REL D;  4H9R A;  1F66 D;  4ZBJ B;  3W99 D;  1HQ3 A;  3UT9 D;  4WU9 B;  2NZD D;  3AZI D;  3KWQ D;  3B6F B;  3KXB D;  3AV2 A;  4KHA B;  5B0Y D;  3AL0 C;  1Q9C A;  3KUY A;  1B67 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...