2F8NG

2.9 angstrom x-ray structure of hybrid macroh2a nucleosomes
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
108
structure length
108
Chain Sequence
b'STKTSRSAKAGVIFPVGRMLRYIKKGHPKYRIGVGAPVYMAAVLEYLTAEILELAVNAARDNKKGRVTPRHILLAVANDEELNQLLKGVTIASGGVLPNIHPELLAKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords alpha-satellite DNA (146 bp)
publication title Nucleosomes containing the histone domain of macroH2A: In vitro possibilities.
rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 31
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2005-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2f8nG00
1F1EA 4NE6A 3AYWB 3AZLA 3AV2A 1P3AD 4YM6B 4M6BA 2HUEB 1P3FD 1ZLAB 3AYWC 4YM6C 4J8VB 5AVBA 3AZKC 2HUEC 3AZMA 5AV6B 3WTPE 3AZLD 4H9QB 1ZLAC 3LELB 1BH8B 1P3OA 5E5AC 4X23C 1HTAA 4NFTA 5DNMA 3LELC 5AVBD 5JRGA 5CPIA 3UT9D 3MGPC 2PYOA 2F8NA 3W96A 3REHA 3X1VA 1AOIA 4LD9B 3O62A 1P3PD 3NQUB 4KGCC 5DNMD 3AN2C 5CPID 3AZGD 2PYOD 3MGQA 4H9OB 4LD9C 3MNNB 3W96D 1AOID 4J8XB 5BNVB 3WTPB 4JJNB 4J8XC 5B40A 3MGSA 4E44A 1R4VA 4CAYB 4J8VD 2CV5B 5AV6D 1KX5B 3X1TB 5C3IB 1P3GB 1EQZA 3W99B 2CV5C 3A6NB 3B6GB 3MGSD 5KDMA 1TZYA 5C3IC 3LZ0C 1A7WA 5GXQC 4J8UB 3B6GC 3MNNA 1EQZD 2NQBB 5BT1C 3AZNA 2AROA 5B2JA 3B6FA 4WNNA 1TZYD 2RVQD 3UTAB 5BO0B 3KWQC 3W98B 1HQ3B 3VH6W 2YFVB 3MNND 5CP6C 1KX4C 2CWEA 1M18A 5B2JD 3B6FD 5AY8B 3LJAB 4JJND 4Z66A 5GT0C 2BYKB 5B2IB 1P3KB 3TU4C 3MVDB 4Z2MG 3AZFA 3X1TD 3W99D 4Z66D 3A6ND 3WA9A 1ULYA 5B24C 5CHLB 2HIOB 4WU8A 3AZFD 3W98A 5GSUC 5JA4B 2NQBD 5B32C 1F66A 4KUDA 4KHAA 1M1AB 1P3BC 3UTAD 2NZDB 3W98D 1HQ3D 5B31C 3VH5T 1M1AC 3MGRB 5AV9C 3V9RA 1F66D 4KUDD 2BYMB 2NZDC 5AY8D 1WWIA 4EO5C 5AVCB 3LJAD 4J8WA 3AV1A 1S32A 5B2ID 1P3MA 4XUJB 3KXBC 4WU9A 1P3KD 1KX3A 4QLCB 4XUJC 3AV1D 5CPJC 2YFWA 4QLCC 4WU9D 1JFIB 2HIOD 5B1MC 5CPKC 1P3LB 1U35A 3X1UB 2FJ7A 3REJA 3RELB 4ZUXB 5AV8B 4Z2MH 1ID3B 3KUYB 5B1LA 1P3IB 2IO5C 3LZ1A 3AZIB 3X1UC 1P3AA 5GT3A 4ZBJC 3NQJB 1U35D 1P3FA 3AZIC 4H9NB 3MGRD 3REJD 3C1CA 5B1LD 3LZ1D 3C1BA 4WV4B 3WKJA 5GT3D 3AZKB 3AV2C 3C1CD 5E5AB 4X23B 3UT9A 1N1JA 1B6WA 2LY8A 3C1BD 3AZJA 4H9PB 4DRBA 5BS7A 3WKJD 3VH5A 3MGPB 3AZMC 4XZQB 1P3PA 4Z5TB 1P3OC 5B0YB 3AZGA 3R45B 4XZQC 3RELD 3AZJD 4ZUXD 4Z5TC 4KGCB 5B0YC 5JRGC 3AN2B 3KUYD 1ID3D 2PYOC 1P3ID 3AYWA 3AZHC 3W96C 4YM6A 3X1VC 3REHC 5G49B 3O62C 1ZLAA 4HGAC 4J8VA 4H9RB 3MGQC 5AV6A 3AZEB 3AYWD 4H9QA 3LELA 1BH8A 4YM6D 4DRAA 3AZEC 1ZLAD 1H3OB 5E5AD 4X23D 5DNNB 3MGSC 5B40C 4AWLB 3LZ0B 3LELD 5GXQB 4LD9A 5DNNC 3NQUA 4AWLC 1EQZC 1TAFB 1Q9CA 4H9OA 1WWSA 4R8PB 1TZYC 3UTBB 3AN2D 3KWQB 4J8XA 3B0CT 4LD9D 4R8PC 5BNVA 3WTPA 4JJNA 5CP6B 3UTBC 3AZNC 2AROC 1KX4B 3W97B 4CAYA 5GT0B 2CV5A 4J8XD 1KX5A 3X1TA 1P3GA 3WTPD 3W97C 3AFAC 3W99A 2F8NG 1M18C 3TU4B 3A6NA 3B6GA 1BFMA 2CV5D 1KX5D 4J8UA 3LZ0D 1P3GD 2NQBA 5GXQD 5B24B 5F99B 5GSUB 1P34B 3B6GD 4NE3A 5B32B 3UTAA 5BO0A 4E45A 3WA9C 5F99C 4J8UD 1P34C 1HQ3A 1P3BB 2YFVA 3KWQD 4WU8C 3WAAB 5AY8A 5B31B 3LJAA 5CP6D 1KX4D 5AV9B 5B0ZB 2BYKA 5B2IA 3TU4A 4YS3B 3WAAC 4EO5B 1M19B 1P3KA 5BNXB 5B0ZC 5FUGB 3MVDA 4YS3C 3KXBB 1M19C 5B33B 4UUZB 3TU4D 4J8WC 1S32C 5CPJB 3X1SB 2HIOA 1P3MC 5B33C 3MVDD 5JA4A 4WU9C 5B24D 3REIB 4G91C 5B1MB 1KX3C 4NE5A 3X1SC 5CPKB 1M1AA 5AV5B 5B32D 3REKB 2F8NH 3REIC 2NZDA 2IO5B 1P3BD 5AV5C 3REKC 3MGRA 4ZBJB 2BYMA 1M1AD 5AVCA 1BH9B 4H9SA 2FJ7C 5AV9D 5B1LC 2NZDD 4XUJA 4CSRB 1P3AC 5B32G 4QLCA 1B67A 1P3FC 5AVCD 3AZLB 3AV2B 3KXBD 4XUJD 3C1BC 3AZLC 5AVBB 5B31G 1JFIA 3WKJC 3AZMB 4QLCD 1P3LA 3X1UA 1P3OB 3RELA 4ZUXA 5B1MD 5AV8A 5AVBC 5CPKD 3KUYA 3UT9C 1ID3A 1P3IA 3VH5W 3AZIA 5DNMB 5JRGB 5CPIB 2PYOB 3NQJA 1P3LD 3B0DC 1P3PC 3X1UD 2F8NB 4H9NA 3AZHB 5DNMC 3W96B 5AV8D 5CPIC 3REHB 3AZGC 3X1VB 1AOIB 3O62B 3AZID 4HGAB 3MGQB 3AZKA 1AOIC 5E5AA 4X23A 2L5AA 3AV2D 3VH6T 4H9PA 4J8VC 3MGPA 3AZKD 5AV6C 4XZQA 5B40B 3MGSB 4Z5TA 5B0YA 3AZMD 3R45A 1P3OD 3AZHA 1EQZB 3B0BA 4KGCA 3AN2A 3MGPD 4XZQD 5KDMB 1TZYB 4Z5TD 5B0YD 5JRGD 5G49A 2F8ND 2RVQC 3AZHD 4KGCD 3REHD 3AZNB 2AROB 3X1VD 4H9RA 3O62D 5B2JB 3B6FB 4WNNB 3AZEA 3MNNC 3MGQD 5B2JC 3B6FC 3WTPC 4JJNC 3AFAB 1H3OA 1M18B 5DNNA 3AZED 4Z66B 3LZ0A 5GXQA 5B40D 1KX5C 3X1TC 1P3GC 3W99C 4Z66C 2JSSA 1TAFA 3AZFB 3A6NC 5DNND 4R8PA 3UTBA 3KWQA 3WA9B 3AZFC 4J8UC 2F8NK 2NQBC 5CP6A 5BT1D 1KX4A 4WU8B 3VH6A 4R8PD 3W97A 3UTBD 3AFAA 3UTAC 3AZND 2AROD 5GT0A 1F66B 4KUDB 4KHAB 3W98C 1HQ3C 4G92B 1F66C 4KUDC 5AY8C 3LJAC 4G92C 3W97D 3AFAD 3KSYA 3V9RB 5GT0D 1M18D 5B2IC 4J8WB 1S32B 3AV1B 5B24A 1P3KC 1P3MB 5F99A 3MVDC 5GSUA 1P34A 3AV1C 4WU9B 5B32A 4G91B 1KX3B 3B0CW 1P3BA 2YFWB 2HIOC 3WA9D 5F99D 3WAAA 5GSUD 1P34D 5B31A 5AV9A 4WU8D 5B0ZA 4YS3A 1U35B 2FJ7B 3REJB 1M19A 5BNXA 5B1LB 4WZSB 5FUGA 3WAAD 5B31D 3LZ1B 1U35C 1P3AB 3MGRC 3KXBA 3REJC 5GT3B 5B0ZD 5B33A 4UUZA 4YS3D 5AVCC 1P3FB 4H9SC 3LZ1C 5CPJA 1M19D 3C1CB 3X1SA 5GT3C 4J8WD 1S32D 3C1BB 3REIA 3WKJB 1P3MD 5B1MA 3C1CC 5B33D 5CPKA 1KU5A 5AV5A 3REKA 5CPJD 1KX3D 3X1SD 3UT9B 1N1JB 3AZJB 3REID 1P3LC 3B0DB 5AV5D 1P3PB 1BH9A 3REKD 3RELC 4ZUXC 3AZJC 5BS7C 5AV8C 1ID3C 3KUYC 3AZGB 1P3IC 4CSRA 2FJ7D
chains in the Genus database with same CATH superfamily
1F1EA 4NE6A 3AYWB 3AZLA 3AV2A 1P3AD 4YM6B 4M6BA 2HUEB 1P3FD 1ZLAB 3AYWC 4YM6C 4J8VB 2UWXA 5AVBA 2W8SA 2HUEC 3AZKC 3AZMA 5AV6B 3WTPE 3AZLD 4H9QB 1ZLAC 3LELB 1BH8B 1P3OA 2Y2OA 5E5AC 4X23C 1HTAA 2Y2JA 4NFTA 5DNMA 3LELC 5AVBD 5JRGA 5CPIA 3UT9D 3MGPC 2PYOA 2F8NA 3W96A 3REHA 3X1VA 1AOIA 4LD9B 3O62A 1P3PD 3NQUB 4KGCC 5DNMD 3AN2C 5CPID 3AZGD 2PYOD 3MGQA 4H9OB 4LD9C 3MNNB 2ZY5A 3W96D 1AOID 4J8XB 5BNVB 3WTPB 4JJNB 1Z2CB 4J8XC 5B40A 3MGSA 4E44A 1R4VA 4CAYB 4J8VD 2CV5B 5AV6D 1KX5B 3X1TB 5C3IB 1P3GB 1EQZA 3W99B 2CV5C 3A6NB 3B6GB 3MGSD 5KDMA 1TZYA 5C3IC 3LZ0C 1A7WA 5GXQC 4J8UB 3B6GC 3MNNA 1EQZD 2NQBB 5BT1C 3AZNA 2AROA 5B2JA 3B6FA 3AL0C 4WNNA 1TZYD 2RVQD 3UTAB 5BO0B 3KWQC 3W98B 4DQYB 1HQ3B 3VH6W 2YFVB 3MNND 5CP6C 1KX4C 2CWEA 1M18A 5B2JD 3B6FD 5AY8B 3LJAB 4JJND 4Z66A 5GT0C 2BYKB 5B2IB 3EPLA 1W2EA 1P3KB 3TU4C 3MVDB 4Z2MG 3AZFA 3X1TD 3W99D 4Z66D 3A6ND 3WA9A 1ULYA 5B24C 5CHLB 2HIOB 4WU8A 3AZFD 3W98A 5GSUC 5JA4B 2NQBD 5B32C 1F66A 4KUDA 4KHAA 2JE5A 1M1AB 1P3BC 3UTAD 2NZDB 3W98D 1HQ3D 5B31C 3VH5T 1M1AC 3MGRB 5AV9C 3V9RA 1F66D 4KUDD 2BYMB 2NZDC 5AY8D 1WWIA 4EO5C 5AVCB 3LJAD 4J8WA 3AV1A 1S32A 3IP4C 1T3UA 5B2ID 1P3MA 4XUJB 3KXBC 4WU9A 1P3KD 1KX3A 4QLCB 4XUJC 3AV1D 5CPJC 3A1KA 2XD5A 2YFWA 4QLCC 2Y2IA 4WU9D 1JFIB 2HIOD 5B1MC 5CPKC 1P3LB 1U35A 3X1UB 2FJ7A 3REJA 3RELB 4ZUXB 5AV8B 4Z2MH 1ID3B 3KUYB 5B1LA 1P3IB 2IO5C 3LZ1A 3AZIB 3X1UC 1P3AA 5GT3A 4ZBJC 3NQJB 1U35D 1P3FA 3AZIC 4H9NB 3MGRD 4UPKA 3REJD 3C1CA 5B1LD 3A1IA 3LZ1D 3C1BA 4WV4B 3WKJA 5GT3D 3AZKB 3AV2C 3C1CD 2F2AC 5E5AB 4X23B 3UT9A 1N1JA 1B6WA 2LY8A 3C1BD 2VQRA 4H9PB 3AZJA 4DRBA 5BS7A 3WKJD 3VH5A 3MGPB 3AZMC 4XZQB 1P3PA 4Z5TB 1P3OC 5B0YB 3AZGA 3R45B 3KFUG 4XZQC 3RELD 3AZJD 4ZUXD 4Z5TC 4KGCB 5B0YC 5JRGC 3AN2B 3KUYD 1ID3D 2PYOC 1P3ID 3F6TA 3AYWA 3AZHC 3W96C 4YM6A 3X1VC 3REHC 5G49B 3O62C 1ZLAA 4HGAC 4J8VA 4H9RB 3MGQC 5AV6A 3AZEB 3AYWD 4H9QA 3LELA 1BH8A 4YM6D 4DRAA 3AZEC 1ZLAD 1H3OB 5E5AD 4X23D 2Y2HA 5DNNB 3MGSC 5B40C 4AWLB 3LZ0B 3LELD 5GXQB 2XD1A 4LD9A 5DNNC 3NQUA 4AWLC 1EQZC 2DF4C 1TAFB 1Q9CA 4H9OA 1WWSA 4R8PB 1TZYC 3UTBB 3AN2D 3KWQB 4J8XA 3B0CT 4LD9D 3H0MC 4R8PC 5BNVA 3WTPA 4JJNA 5CP6B 3UTBC 3AZNC 2AROC 1KX4B 3W97B 4CAYA 5GT0B 2CV5A 2ZY3A 4J8XD 1KX5A 3X1TA 1P3GA 3WTPD 3W97C 3AFAC 3W99A 2F8NG 1M18C 3TU4B 3A6NA 3B6GA 1BFMA 2CV5D 1KX5D 4J8UA 3LZ0D 2RIQA 1P3GD 2NQBA 5GXQD 5B24B 5F99B 5GSUB 1P34B 3B6GD 4NE3A 2JCHA 5B32B 3UTAA 5BO0A 4E45A 3WA9C 5F99C 4J8UD 1P34C 1HQ3A 1P3BB 2YFVA 2Y2MA 3KWQD 4WU8C 3WAAB 5AY8A 5B31B 3LJAA 5CP6D 1KX4D 5AV9B 5B0ZB 2BYKA 5B2IA 3TU4A 4YS3B 3WAAC 4EO5B 1M19B 1P3KA 5BNXB 5B0ZC 5FUGB 3MVDA 4YS3C 3EPJA 2BG1A 3KXBB 1M19C 3H0RC 5B33B 4UUZB 3TU4D 4J8WC 1S32C 2G5IC 5CPJB 3X1SB 2HIOA 1P3MC 5B33C 3MVDD 5JA4A 4WU9C 5B24D 3REIB 4G91C 4WJ3C 5B1MB 1KX3C 4NE5A 3X1SC 5CPKB 1M1AA 5AV5B 5B32D 2Y2NA 3REKB 2F8NH 3REIC 2NZDA 2IO5B 1P3BD 5AV5C 3REKC 2ZY4A 3MGRA 4ZBJB 2BYMA 1M1AD 5AVCA 1BH9B 4H9SA 2FJ7C 5AV9D 5B1LC 2NZDD 4XUJA 4CSRB 1P3AC 5B32G 4QLCA 1B67A 1P3FC 5AVCD 3AZLB 3AV2B 3KXBD 2Y2GA 4XUJD 3C1BC 3AZLC 5AVBB 5B31G 1JFIA 3WKJC 3AZMB 4QLCD 1P3LA 3X1UA 1P3OB 3RELA 4ZUXA 5B1MD 5AV8A 5AVBC 5CPKD 3KUYA 3UT9C 1ID3A 1P3IA 3VH5W 3AZIA 5DNMB 5JRGB 5CPIB 2PYOB 3NQJA 2J8PA 2FFFB 1P3LD 3B0DC 1P3PC 3X1UD 2F8NB 4H9NA 3AZHB 5DNMC 3W96B 5AV8D 5CPIC 3REHB 3AZGC 3X1VB 1AOIB 3O62B 3AZID 4HGAB 2G5HC 3MGQB 3AZKA 1AOIC 5E5AA 4X23A 2ZY2A 2L5AA 3AV2D 3VH6T 4H9PA 4J8VC 3MGPA 3AZKD 5AV6C 4XZQA 5B40B 3MGSB 4Z5TA 5B0YA 3AZMD 2Y2KA 3R45A 1P3OD 3AZHA 1EQZB 3B0BA 4KGCA 3P5JB 3AN2A 3MGPD 4XZQD 5KDMB 1TZYB 4Z5TD 5B0YD 5JRGD 5G49A 2F8ND 2RVQC 3AZHD 4KGCD 3REHD 3AZNB 2AROB 3X1VD 4H9RA 3O62D 5B2JB 3B6FB 4WNNB 3AZEA 3MNNC 2Y2QA 3MGQD 5B2JC 3B6FC 3WTPC 4JJNC 3AFAB 1H3OA 1M18B 5DNNA 3AZED 4Z66B 3LZ0A 5GXQA 5B40D 1KX5C 3X1TC 1P3GC 3W99C 4Z66C 2JSSA 1TAFA 3AZFB 3A6NC 5DNND 3EG5B 4R8PA 3UTBA 3EPKA 3KWQA 3WA9B 3AZFC 4J8UC 2F8NK 2NQBC 5CP6A 5BT1D 1KX4A 4WU8B 3VH6A 2Y2PA 4R8PD 3W97A 3UTBD 3AFAA 3UTAC 3AZND 2AROD 5GT0A 1F66B 4KUDB 4KHAB 3W98C 1HQ3C 4G92B 3EPHA 3H0LC 1F66C 4KUDC 5AY8C 3LJAC 4G92C 3W97D 3AFAD 3KSYA 3V9RB 5GT0D 1M18D 5B2IC 4J8WB 1S32B 3AV1B 5B24A 1P3KC 1P3MB 5F99A 3MVDC 5GSUA 1P34A 3AV1C 4WU9B 5B32A 4G91B 1KX3B 3B0CW 1P3BA 2YFWB 2HIOC 3WA9D 5F99D 3WAAA 5GSUD 1P34D 5B31A 5AV9A 4WU8D 5B0ZA 4YS3A 1U35B 2FJ7B 3REJB 1M19A 5BNXA 2ZM5A 5B1LB 4WZSB 5FUGA 3WAAD 5B31D 3LZ1B 1U35C 1P3AB 3MGRC 3KXBA 3REJC 5GT3B 5B0ZD 5B33A 4UUZA 4YS3D 5AVCC 1P3FB 4H9SC 3LZ1C 5CPJA 1M19D 3C1CB 3X1SA 5GT3C 4J8WD 1S32D 3C1BB 1PZRA 3REIA 3WKJB 1P3MD 5B1MA 3C1CC 5B33D 5CPKA 3FDDA 1KU5A 5AV5A 3REKA 5CPJD 1KX3D 3X1SD 2DQNC 3UT9B 1N1JB 3AZJB 3REID 2Y2LA 1P3LC 3B0DB 5AV5D 1P3PB 1BH9A 3REKD 3RELC 4ZUXC 3AZJC 5BS7C 5AV8C 1ID3C 3KUYC 3AZGB 1P3IC 4CSRA 2FJ7D
chains in the Genus database with same CATH topology
1F1EA 4NE6A 3AYWB 3AZLA 3AV2A 1P3AD 4YM6B 4M6BA 2HUEB 1P3FD 1ZLAB 3AYWC 4YM6C 4J8VB 2UWXA 5AVBA 2W8SA 2HUEC 3AZKC 3AZMA 5AV6B 3WTPE 3AZLD 4H9QB 1ZLAC 3LELB 1BH8B 1P3OA 2Y2OA 5E5AC 4X23C 1HTAA 2Y2JA 4NFTA 5DNMA 3LELC 5AVBD 5JRGA 5CPIA 3UT9D 3MGPC 2PYOA 2F8NA 3W96A 3REHA 3X1VA 1AOIA 4LD9B 3O62A 1P3PD 3NQUB 4KGCC 5DNMD 3AN2C 5CPID 3AZGD 2PYOD 3MGQA 4H9OB 4LD9C 3MNNB 2ZY5A 3W96D 1AOID 4J8XB 5BNVB 3WTPB 4JJNB 1Z2CB 4J8XC 5B40A 3MGSA 4E44A 1R4VA 4CAYB 4J8VD 2CV5B 5AV6D 1KX5B 3X1TB 5C3IB 1P3GB 1EQZA 3W99B 2CV5C 3A6NB 3B6GB 3MGSD 5KDMA 1TZYA 5C3IC 3LZ0C 1A7WA 5GXQC 4J8UB 3B6GC 3MNNA 1EQZD 2NQBB 5BT1C 3AZNA 2AROA 5B2JA 3B6FA 3AL0C 4WNNA 1TZYD 2RVQD 3UTAB 5BO0B 3KWQC 3W98B 4DQYB 1HQ3B 3VH6W 2YFVB 3MNND 5CP6C 1KX4C 2CWEA 1M18A 5B2JD 3B6FD 5AY8B 3LJAB 4JJND 4Z66A 5GT0C 2BYKB 5B2IB 3EPLA 1W2EA 1P3KB 3TU4C 3MVDB 4Z2MG 3AZFA 3X1TD 3W99D 4Z66D 3A6ND 3WA9A 1ULYA 5B24C 5CHLB 2HIOB 4WU8A 3AZFD 3W98A 5GSUC 5JA4B 2NQBD 5B32C 1F66A 4KUDA 4KHAA 2JE5A 1M1AB 1P3BC 3UTAD 2NZDB 3W98D 1HQ3D 5B31C 3VH5T 1M1AC 3MGRB 5AV9C 3V9RA 1F66D 4KUDD 2BYMB 2NZDC 5AY8D 1WWIA 4EO5C 5AVCB 3LJAD 4J8WA 3AV1A 1S32A 3IP4C 1T3UA 5B2ID 1P3MA 4XUJB 3KXBC 4WU9A 1P3KD 1KX3A 4QLCB 4XUJC 3AV1D 5CPJC 3A1KA 2XD5A 2YFWA 4QLCC 2Y2IA 4WU9D 1JFIB 2HIOD 5B1MC 5CPKC 1P3LB 1U35A 3X1UB 2FJ7A 3REJA 3RELB 4ZUXB 5AV8B 4Z2MH 1ID3B 3KUYB 5B1LA 1P3IB 2IO5C 3LZ1A 3AZIB 3X1UC 1P3AA 5GT3A 4ZBJC 3NQJB 1U35D 1P3FA 3AZIC 4H9NB 3MGRD 4UPKA 3REJD 3C1CA 5B1LD 3A1IA 3LZ1D 3C1BA 4WV4B 3WKJA 5GT3D 3AZKB 3AV2C 3C1CD 2F2AC 5E5AB 4X23B 3UT9A 1N1JA 1B6WA 2LY8A 3C1BD 2VQRA 4H9PB 3AZJA 4DRBA 5BS7A 3WKJD 3VH5A 3MGPB 3AZMC 4XZQB 1P3PA 4Z5TB 1P3OC 5B0YB 3AZGA 3R45B 3KFUG 4XZQC 3RELD 3AZJD 4ZUXD 4Z5TC 4KGCB 5B0YC 5JRGC 3AN2B 3KUYD 1ID3D 2PYOC 1P3ID 3F6TA 3AYWA 3AZHC 3W96C 4YM6A 3X1VC 3REHC 5G49B 3O62C 1ZLAA 4HGAC 4J8VA 4H9RB 3MGQC 5AV6A 3AZEB 3AYWD 4H9QA 3LELA 1BH8A 4YM6D 4DRAA 3AZEC 1ZLAD 1H3OB 5E5AD 4X23D 2Y2HA 5DNNB 3MGSC 5B40C 4AWLB 3LZ0B 3LELD 5GXQB 2XD1A 4LD9A 5DNNC 3NQUA 4AWLC 1EQZC 2DF4C 1TAFB 1Q9CA 4H9OA 1WWSA 4R8PB 1TZYC 3UTBB 3AN2D 3KWQB 4J8XA 3B0CT 4LD9D 3H0MC 4R8PC 5BNVA 3WTPA 4JJNA 5CP6B 3UTBC 3AZNC 2AROC 1KX4B 3W97B 4CAYA 5GT0B 2CV5A 2ZY3A 4J8XD 1KX5A 3X1TA 1P3GA 3WTPD 3W97C 3AFAC 3W99A 2F8NG 1M18C 3TU4B 3A6NA 3B6GA 1BFMA 2CV5D 1KX5D 4J8UA 3LZ0D 2RIQA 1P3GD 2NQBA 5GXQD 5B24B 5F99B 5GSUB 1P34B 3B6GD 4NE3A 2JCHA 5B32B 3UTAA 5BO0A 4E45A 3WA9C 5F99C 4J8UD 1P34C 1HQ3A 1P3BB 2YFVA 2Y2MA 3KWQD 4WU8C 3WAAB 5AY8A 5B31B 3LJAA 5CP6D 1KX4D 5AV9B 5B0ZB 2BYKA 5B2IA 3TU4A 4YS3B 3WAAC 4EO5B 1M19B 1P3KA 5BNXB 5B0ZC 5FUGB 3MVDA 4YS3C 3EPJA 2BG1A 3KXBB 1M19C 3H0RC 5B33B 4UUZB 3TU4D 4J8WC 1S32C 2G5IC 5CPJB 3X1SB 2HIOA 1P3MC 5B33C 3MVDD 5JA4A 4WU9C 5B24D 3REIB 4G91C 4WJ3C 5B1MB 1KX3C 4NE5A 3X1SC 5CPKB 1M1AA 5AV5B 5B32D 2Y2NA 3REKB 2F8NH 3REIC 2NZDA 2IO5B 1P3BD 5AV5C 3REKC 2ZY4A 3MGRA 4ZBJB 2BYMA 1M1AD 5AVCA 1BH9B 4H9SA 2FJ7C 5AV9D 5B1LC 2NZDD 4XUJA 4CSRB 1P3AC 5B32G 4QLCA 1B67A 1P3FC 5AVCD 3AZLB 3AV2B 3KXBD 2Y2GA 4XUJD 3C1BC 3AZLC 5AVBB 5B31G 1JFIA 3WKJC 3AZMB 4QLCD 1P3LA 3X1UA 1P3OB 3RELA 4ZUXA 5B1MD 5AV8A 5AVBC 5CPKD 3KUYA 3UT9C 1ID3A 1P3IA 3VH5W 3AZIA 5DNMB 5JRGB 5CPIB 2PYOB 3NQJA 2J8PA 2FFFB 1P3LD 3B0DC 1P3PC 3X1UD 2F8NB 4H9NA 3AZHB 5DNMC 3W96B 5AV8D 5CPIC 3REHB 3AZGC 3X1VB 1AOIB 3O62B 3AZID 4HGAB 2G5HC 3MGQB 3AZKA 1AOIC 5E5AA 4X23A 2ZY2A 2L5AA 3AV2D 3VH6T 4H9PA 4J8VC 3MGPA 3AZKD 5AV6C 4XZQA 5B40B 3MGSB 4Z5TA 5B0YA 3AZMD 2Y2KA 3R45A 1P3OD 3AZHA 1EQZB 3B0BA 4KGCA 3P5JB 3AN2A 3MGPD 4XZQD 5KDMB 1TZYB 4Z5TD 5B0YD 5JRGD 5G49A 2F8ND 2RVQC 3AZHD 4KGCD 3REHD 3AZNB 2AROB 3X1VD 4H9RA 3O62D 5B2JB 3B6FB 4WNNB 3AZEA 3MNNC 2Y2QA 3MGQD 5B2JC 3B6FC 3WTPC 4JJNC 3AFAB 1H3OA 1M18B 5DNNA 3AZED 4Z66B 3LZ0A 5GXQA 5B40D 1KX5C 3X1TC 1P3GC 3W99C 4Z66C 2JSSA 1TAFA 3AZFB 3A6NC 5DNND 3EG5B 4R8PA 3UTBA 3EPKA 3KWQA 3WA9B 3AZFC 4J8UC 2F8NK 2NQBC 5CP6A 5BT1D 1KX4A 4WU8B 3VH6A 2Y2PA 4R8PD 3W97A 3UTBD 3AFAA 3UTAC 3AZND 2AROD 5GT0A 1F66B 4KUDB 4KHAB 3W98C 1HQ3C 4G92B 3EPHA 3H0LC 1F66C 4KUDC 5AY8C 3LJAC 4G92C 3W97D 3AFAD 3KSYA 3V9RB 5GT0D 1M18D 5B2IC 4J8WB 1S32B 3AV1B 5B24A 1P3KC 1P3MB 5F99A 3MVDC 5GSUA 1P34A 3AV1C 4WU9B 5B32A 4G91B 1KX3B 3B0CW 1P3BA 2YFWB 2HIOC 3WA9D 5F99D 3WAAA 5GSUD 1P34D 5B31A 5AV9A 4WU8D 5B0ZA 4YS3A 1U35B 2FJ7B 3REJB 1M19A 5BNXA 2ZM5A 5B1LB 4WZSB 5FUGA 3WAAD 5B31D 3LZ1B 1U35C 1P3AB 3MGRC 3KXBA 3REJC 5GT3B 5B0ZD 5B33A 4UUZA 4YS3D 5AVCC 1P3FB 4H9SC 3LZ1C 5CPJA 1M19D 3C1CB 3X1SA 5GT3C 4J8WD 1S32D 3C1BB 1PZRA 3REIA 3WKJB 1P3MD 5B1MA 3C1CC 5B33D 5CPKA 3FDDA 1KU5A 5AV5A 3REKA 5CPJD 1KX3D 3X1SD 2DQNC 3UT9B 1N1JB 3AZJB 3REID 2Y2LA 1P3LC 3B0DB 5AV5D 1P3PB 1BH9A 3REKD 3RELC 4ZUXC 3AZJC 5BS7C 5AV8C 1ID3C 3KUYC 3AZGB 1P3IC 4CSRA 2FJ7D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F1E A;  4NE6 A;  3AYW B;  3AZL A;  3AV2 A;  1P3A D;  4YM6 B;  4M6B A;  2HUE B;  1P3F D;  1ZLA B;  3AYW C;  4YM6 C;  4J8V B;  5AVB A;  3AZK C;  2HUE C;  3AZM A;  5AV6 B;  3WTP E;  3AZL D;  4H9Q B;  1ZLA C;  3LEL B;  1BH8 B;  1P3O A;  5E5A C;  4X23 C;  1HTA A;  4NFT A;  5DNM A;  3LEL C;  5AVB D;  5JRG A;  5CPI A;  3UT9 D;  3MGP C;  2PYO A;  2F8N A;  3W96 A;  3REH A;  3X1V A;  1AOI A;  4LD9 B;  3O62 A;  1P3P D;  3NQU B;  4KGC C;  5DNM D;  3AN2 C;  5CPI D;  3AZG D;  2PYO D;  3MGQ A;  4H9O B;  4LD9 C;  3MNN B;  3W96 D;  1AOI D;  4J8X B;  5BNV B;  3WTP B;  4JJN B;  4J8X C;  5B40 A;  3MGS A;  4E44 A;  1R4V A;  4CAY B;  4J8V D;  2CV5 B;  5AV6 D;  1KX5 B;  3X1T B;  5C3I B;  1P3G B;  1EQZ A;  3W99 B;  2CV5 C;  3A6N B;  3B6G B;  3MGS D;  5KDM A;  1TZY A;  5C3I C;  3LZ0 C;  1A7W A;  5GXQ C;  4J8U B;  3B6G C;  3MNN A;  1EQZ D;  2NQB B;  5BT1 C;  3AZN A;  2ARO A;  5B2J A;  3B6F A;  4WNN A;  1TZY D;  2RVQ D;  3UTA B;  5BO0 B;  3KWQ C;  3W98 B;  1HQ3 B;  3VH6 W;  2YFV B;  3MNN D;  5CP6 C;  1KX4 C;  2CWE A;  1M18 A;  5B2J D;  3B6F D;  5AY8 B;  3LJA B;  4JJN D;  4Z66 A;  5GT0 C;  2BYK B;  5B2I B;  1P3K B;  3TU4 C;  3MVD B;  4Z2M G;  3AZF A;  3X1T D;  3W99 D;  4Z66 D;  3A6N D;  3WA9 A;  1ULY A;  5B24 C;  5CHL B;  2HIO B;  4WU8 A;  3AZF D;  3W98 A;  5GSU C;  5JA4 B;  2NQB D;  5B32 C;  1F66 A;  4KUD A;  4KHA A;  1M1A B;  1P3B C;  3UTA D;  2NZD B;  3W98 D;  1HQ3 D;  5B31 C;  3VH5 T;  1M1A C;  3MGR B;  5AV9 C;  3V9R A;  1F66 D;  4KUD D;  2BYM B;  2NZD C;  5AY8 D;  1WWI A;  4EO5 C;  5AVC B;  3LJA D;  4J8W A;  3AV1 A;  1S32 A;  5B2I D;  1P3M A;  4XUJ B;  3KXB C;  4WU9 A;  1P3K D;  1KX3 A;  4QLC B;  4XUJ C;  3AV1 D;  5CPJ C;  2YFW A;  4QLC C;  4WU9 D;  1JFI B;  2HIO D;  5B1M C;  5CPK C;  1P3L B;  1U35 A;  3X1U B;  2FJ7 A;  3REJ A;  3REL B;  4ZUX B;  5AV8 B;  4Z2M H;  1ID3 B;  3KUY B;  5B1L A;  1P3I B;  2IO5 C;  3LZ1 A;  3AZI B;  3X1U C;  1P3A A;  5GT3 A;  4ZBJ C;  3NQJ B;  1U35 D;  1P3F A;  3AZI C;  4H9N B;  3MGR D;  3REJ D;  3C1C A;  5B1L D;  3LZ1 D;  3C1B A;  4WV4 B;  3WKJ A;  5GT3 D;  3AZK B;  3AV2 C;  3C1C D;  5E5A B;  4X23 B;  3UT9 A;  1N1J A;  1B6W A;  2LY8 A;  3C1B D;  3AZJ A;  4H9P B;  4DRB A;  5BS7 A;  3WKJ D;  3VH5 A;  3MGP B;  3AZM C;  4XZQ B;  1P3P A;  4Z5T B;  1P3O C;  5B0Y B;  3AZG A;  3R45 B;  4XZQ C;  3REL D;  3AZJ D;  4ZUX D;  4Z5T C;  4KGC B;  5B0Y C;  5JRG C;  3AN2 B;  3KUY D;  1ID3 D;  2PYO C;  1P3I D;  3AYW A;  3AZH C;  3W96 C;  4YM6 A;  3X1V C;  3REH C;  5G49 B;  3O62 C;  1ZLA A;  4HGA C;  4J8V A;  4H9R B;  3MGQ C;  5AV6 A;  3AZE B;  3AYW D;  4H9Q A;  3LEL A;  1BH8 A;  4YM6 D;  4DRA A;  3AZE C;  1ZLA D;  1H3O B;  5E5A D;  4X23 D;  5DNN B;  3MGS C;  5B40 C;  4AWL B;  3LZ0 B;  3LEL D;  5GXQ B;  4LD9 A;  5DNN C;  3NQU A;  4AWL C;  1EQZ C;  1TAF B;  1Q9C A;  4H9O A;  1WWS A;  4R8P B;  1TZY C;  3UTB B;  3AN2 D;  3KWQ B;  4J8X A;  3B0C T;  4LD9 D;  4R8P C;  5BNV A;  3WTP A;  4JJN A;  5CP6 B;  3UTB C;  3AZN C;  2ARO C;  1KX4 B;  3W97 B;  4CAY A;  5GT0 B;  2CV5 A;  4J8X D;  1KX5 A;  3X1T A;  1P3G A;  3WTP D;  3W97 C;  3AFA C;  3W99 A;  2F8N G;  1M18 C;  3TU4 B;  3A6N A;  3B6G A;  1BFM A;  2CV5 D;  1KX5 D;  4J8U A;  3LZ0 D;  1P3G D;  2NQB A;  5GXQ D;  5B24 B;  5F99 B;  5GSU B;  1P34 B;  3B6G D;  4NE3 A;  5B32 B;  3UTA A;  5BO0 A;  4E45 A;  3WA9 C;  5F99 C;  4J8U D;  1P34 C;  1HQ3 A;  1P3B B;  2YFV A;  3KWQ D;  4WU8 C;  3WAA B;  5AY8 A;  5B31 B;  3LJA A;  5CP6 D;  1KX4 D;  5AV9 B;  5B0Z B;  2BYK A;  5B2I A;  3TU4 A;  4YS3 B;  3WAA C;  4EO5 B;  1M19 B;  1P3K A;  5BNX B;  5B0Z C;  5FUG B;  3MVD A;  4YS3 C;  3KXB B;  1M19 C;  5B33 B;  4UUZ B;  3TU4 D;  4J8W C;  1S32 C;  5CPJ B;  3X1S B;  2HIO A;  1P3M C;  5B33 C;  3MVD D;  5JA4 A;  4WU9 C;  5B24 D;  3REI B;  4G91 C;  5B1M B;  1KX3 C;  4NE5 A;  3X1S C;  5CPK B;  1M1A A;  5AV5 B;  5B32 D;  3REK B;  2F8N H;  3REI C;  2NZD A;  2IO5 B;  1P3B D;  5AV5 C;  3REK C;  3MGR A;  4ZBJ B;  2BYM A;  1M1A D;  5AVC A;  1BH9 B;  4H9S A;  2FJ7 C;  5AV9 D;  5B1L C;  2NZD D;  4XUJ A;  4CSR B;  1P3A C;  5B32 G;  4QLC A;  1B67 A;  1P3F C;  5AVC D;  3AZL B;  3AV2 B;  3KXB D;  4XUJ D;  3C1B C;  3AZL C;  5AVB B;  5B31 G;  1JFI A;  3WKJ C;  3AZM B;  4QLC D;  1P3L A;  3X1U A;  1P3O B;  3REL A;  4ZUX A;  5B1M D;  5AV8 A;  5AVB C;  5CPK D;  3KUY A;  3UT9 C;  1ID3 A;  1P3I A;  3VH5 W;  3AZI A;  5DNM B;  5JRG B;  5CPI B;  2PYO B;  3NQJ A;  1P3L D;  3B0D C;  1P3P C;  3X1U D;  2F8N B;  4H9N A;  3AZH B;  5DNM C;  3W96 B;  5AV8 D;  5CPI C;  3REH B;  3AZG C;  3X1V B;  1AOI B;  3O62 B;  3AZI D;  4HGA B;  3MGQ B;  3AZK A;  1AOI C;  5E5A A;  4X23 A;  2L5A A;  3AV2 D;  3VH6 T;  4H9P A;  4J8V C;  3MGP A;  3AZK D;  5AV6 C;  4XZQ A;  5B40 B;  3MGS B;  4Z5T A;  5B0Y A;  3AZM D;  3R45 A;  1P3O D;  3AZH A;  1EQZ B;  3B0B A;  4KGC A;  3AN2 A;  3MGP D;  4XZQ D;  5KDM B;  1TZY B;  4Z5T D;  5B0Y D;  5JRG D;  5G49 A;  2F8N D;  2RVQ C;  3AZH D;  4KGC D;  3REH D;  3AZN B;  2ARO B;  3X1V D;  4H9R A;  3O62 D;  5B2J B;  3B6F B;  4WNN B;  3AZE A;  3MNN C;  3MGQ D;  5B2J C;  3B6F C;  3WTP C;  4JJN C;  3AFA B;  1H3O A;  1M18 B;  5DNN A;  3AZE D;  4Z66 B;  3LZ0 A;  5GXQ A;  5B40 D;  1KX5 C;  3X1T C;  1P3G C;  3W99 C;  4Z66 C;  2JSS A;  1TAF A;  3AZF B;  3A6N C;  5DNN D;  4R8P A;  3UTB A;  3KWQ A;  3WA9 B;  3AZF C;  4J8U C;  2F8N K;  2NQB C;  5CP6 A;  5BT1 D;  1KX4 A;  4WU8 B;  3VH6 A;  4R8P D;  3W97 A;  3UTB D;  3AFA A;  3UTA C;  3AZN D;  2ARO D;  5GT0 A;  1F66 B;  4KUD B;  4KHA B;  3W98 C;  1HQ3 C;  4G92 B;  1F66 C;  4KUD C;  5AY8 C;  3LJA C;  4G92 C;  3W97 D;  3AFA D;  3KSY A;  3V9R B;  5GT0 D;  1M18 D;  5B2I C;  4J8W B;  1S32 B;  3AV1 B;  5B24 A;  1P3K C;  1P3M B;  5F99 A;  3MVD C;  5GSU A;  1P34 A;  3AV1 C;  4WU9 B;  5B32 A;  4G91 B;  1KX3 B;  3B0C W;  1P3B A;  2YFW B;  2HIO C;  3WA9 D;  5F99 D;  3WAA A;  5GSU D;  1P34 D;  5B31 A;  5AV9 A;  4WU8 D;  5B0Z A;  4YS3 A;  1U35 B;  2FJ7 B;  3REJ B;  1M19 A;  5BNX A;  5B1L B;  4WZS B;  5FUG A;  3WAA D;  5B31 D;  3LZ1 B;  1U35 C;  1P3A B;  3MGR C;  3KXB A;  3REJ C;  5GT3 B;  5B0Z D;  5B33 A;  4UUZ A;  4YS3 D;  5AVC C;  1P3F B;  4H9S C;  3LZ1 C;  5CPJ A;  1M19 D;  3C1C B;  3X1S A;  5GT3 C;  4J8W D;  1S32 D;  3C1B B;  3REI A;  3WKJ B;  1P3M D;  5B1M A;  3C1C C;  5B33 D;  5CPK A;  1KU5 A;  5AV5 A;  3REK A;  5CPJ D;  1KX3 D;  3X1S D;  3UT9 B;  1N1J B;  3AZJ B;  3REI D;  1P3L C;  3B0D B;  5AV5 D;  1P3P B;  1BH9 A;  3REK D;  3REL C;  4ZUX C;  3AZJ C;  5BS7 C;  5AV8 C;  1ID3 C;  3KUY C;  3AZG B;  1P3I C;  4CSR A;  2FJ7 D; 
#chains in the Genus database with same CATH topology
 1F1E A;  4NE6 A;  3AYW B;  3AZL A;  3AV2 A;  1P3A D;  4YM6 B;  4M6B A;  2HUE B;  1P3F D;  1ZLA B;  3AYW C;  4YM6 C;  4J8V B;  2UWX A;  5AVB A;  2W8S A;  2HUE C;  3AZK C;  3AZM A;  5AV6 B;  3WTP E;  3AZL D;  4H9Q B;  1ZLA C;  3LEL B;  1BH8 B;  1P3O A;  2Y2O A;  5E5A C;  4X23 C;  1HTA A;  2Y2J A;  4NFT A;  5DNM A;  3LEL C;  5AVB D;  5JRG A;  5CPI A;  3UT9 D;  3MGP C;  2PYO A;  2F8N A;  3W96 A;  3REH A;  3X1V A;  1AOI A;  4LD9 B;  3O62 A;  1P3P D;  3NQU B;  4KGC C;  5DNM D;  3AN2 C;  5CPI D;  3AZG D;  2PYO D;  3MGQ A;  4H9O B;  4LD9 C;  3MNN B;  2ZY5 A;  3W96 D;  1AOI D;  4J8X B;  5BNV B;  3WTP B;  4JJN B;  1Z2C B;  4J8X C;  5B40 A;  3MGS A;  4E44 A;  1R4V A;  4CAY B;  4J8V D;  2CV5 B;  5AV6 D;  1KX5 B;  3X1T B;  5C3I B;  1P3G B;  1EQZ A;  3W99 B;  2CV5 C;  3A6N B;  3B6G B;  3MGS D;  5KDM A;  1TZY A;  5C3I C;  3LZ0 C;  1A7W A;  5GXQ C;  4J8U B;  3B6G C;  3MNN A;  1EQZ D;  2NQB B;  5BT1 C;  3AZN A;  2ARO A;  5B2J A;  3B6F A;  3AL0 C;  4WNN A;  1TZY D;  2RVQ D;  3UTA B;  5BO0 B;  3KWQ C;  3W98 B;  4DQY B;  1HQ3 B;  3VH6 W;  2YFV B;  3MNN D;  5CP6 C;  1KX4 C;  2CWE A;  1M18 A;  5B2J D;  3B6F D;  5AY8 B;  3LJA B;  4JJN D;  4Z66 A;  5GT0 C;  2BYK B;  5B2I B;  3EPL A;  1W2E A;  1P3K B;  3TU4 C;  3MVD B;  4Z2M G;  3AZF A;  3X1T D;  3W99 D;  4Z66 D;  3A6N D;  3WA9 A;  1ULY A;  5B24 C;  5CHL B;  2HIO B;  4WU8 A;  3AZF D;  3W98 A;  5GSU C;  5JA4 B;  2NQB D;  5B32 C;  1F66 A;  4KUD A;  4KHA A;  2JE5 A;  1M1A B;  1P3B C;  3UTA D;  2NZD B;  3W98 D;  1HQ3 D;  5B31 C;  3VH5 T;  1M1A C;  3MGR B;  5AV9 C;  3V9R A;  1F66 D;  4KUD D;  2BYM B;  2NZD C;  5AY8 D;  1WWI A;  4EO5 C;  5AVC B;  3LJA D;  4J8W A;  3AV1 A;  1S32 A;  3IP4 C;  1T3U A;  5B2I D;  1P3M A;  4XUJ B;  3KXB C;  4WU9 A;  1P3K D;  1KX3 A;  4QLC B;  4XUJ C;  3AV1 D;  5CPJ C;  3A1K A;  2XD5 A;  2YFW A;  4QLC C;  2Y2I A;  4WU9 D;  1JFI B;  2HIO D;  5B1M C;  5CPK C;  1P3L B;  1U35 A;  3X1U B;  2FJ7 A;  3REJ A;  3REL B;  4ZUX B;  5AV8 B;  4Z2M H;  1ID3 B;  3KUY B;  5B1L A;  1P3I B;  2IO5 C;  3LZ1 A;  3AZI B;  3X1U C;  1P3A A;  5GT3 A;  4ZBJ C;  3NQJ B;  1U35 D;  1P3F A;  3AZI C;  4H9N B;  3MGR D;  4UPK A;  3REJ D;  3C1C A;  5B1L D;  3A1I A;  3LZ1 D;  3C1B A;  4WV4 B;  3WKJ A;  5GT3 D;  3AZK B;  3AV2 C;  3C1C D;  2F2A C;  5E5A B;  4X23 B;  3UT9 A;  1N1J A;  1B6W A;  2LY8 A;  3C1B D;  2VQR A;  4H9P B;  3AZJ A;  4DRB A;  5BS7 A;  3WKJ D;  3VH5 A;  3MGP B;  3AZM C;  4XZQ B;  1P3P A;  4Z5T B;  1P3O C;  5B0Y B;  3AZG A;  3R45 B;  3KFU G;  4XZQ C;  3REL D;  3AZJ D;  4ZUX D;  4Z5T C;  4KGC B;  5B0Y C;  5JRG C;  3AN2 B;  3KUY D;  1ID3 D;  2PYO C;  1P3I D;  3F6T A;  3AYW A;  3AZH C;  3W96 C;  4YM6 A;  3X1V C;  3REH C;  5G49 B;  3O62 C;  1ZLA A;  4HGA C;  4J8V A;  4H9R B;  3MGQ C;  5AV6 A;  3AZE B;  3AYW D;  4H9Q A;  3LEL A;  1BH8 A;  4YM6 D;  4DRA A;  3AZE C;  1ZLA D;  1H3O B;  5E5A D;  4X23 D;  2Y2H A;  5DNN B;  3MGS C;  5B40 C;  4AWL B;  3LZ0 B;  3LEL D;  5GXQ B;  2XD1 A;  4LD9 A;  5DNN C;  3NQU A;  4AWL C;  1EQZ C;  2DF4 C;  1TAF B;  1Q9C A;  4H9O A;  1WWS A;  4R8P B;  1TZY C;  3UTB B;  3AN2 D;  3KWQ B;  4J8X A;  3B0C T;  4LD9 D;  3H0M C;  4R8P C;  5BNV A;  3WTP A;  4JJN A;  5CP6 B;  3UTB C;  3AZN C;  2ARO C;  1KX4 B;  3W97 B;  4CAY A;  5GT0 B;  2CV5 A;  2ZY3 A;  4J8X D;  1KX5 A;  3X1T A;  1P3G A;  3WTP D;  3W97 C;  3AFA C;  3W99 A;  2F8N G;  1M18 C;  3TU4 B;  3A6N A;  3B6G A;  1BFM A;  2CV5 D;  1KX5 D;  4J8U A;  3LZ0 D;  2RIQ A;  1P3G D;  2NQB A;  5GXQ D;  5B24 B;  5F99 B;  5GSU B;  1P34 B;  3B6G D;  4NE3 A;  2JCH A;  5B32 B;  3UTA A;  5BO0 A;  4E45 A;  3WA9 C;  5F99 C;  4J8U D;  1P34 C;  1HQ3 A;  1P3B B;  2YFV A;  2Y2M A;  3KWQ D;  4WU8 C;  3WAA B;  5AY8 A;  5B31 B;  3LJA A;  5CP6 D;  1KX4 D;  5AV9 B;  5B0Z B;  2BYK A;  5B2I A;  3TU4 A;  4YS3 B;  3WAA C;  4EO5 B;  1M19 B;  1P3K A;  5BNX B;  5B0Z C;  5FUG B;  3MVD A;  4YS3 C;  3EPJ A;  2BG1 A;  3KXB B;  1M19 C;  3H0R C;  5B33 B;  4UUZ B;  3TU4 D;  4J8W C;  1S32 C;  2G5I C;  5CPJ B;  3X1S B;  2HIO A;  1P3M C;  5B33 C;  3MVD D;  5JA4 A;  4WU9 C;  5B24 D;  3REI B;  4G91 C;  4WJ3 C;  5B1M B;  1KX3 C;  4NE5 A;  3X1S C;  5CPK B;  1M1A A;  5AV5 B;  5B32 D;  2Y2N A;  3REK B;  2F8N H;  3REI C;  2NZD A;  2IO5 B;  1P3B D;  5AV5 C;  3REK C;  2ZY4 A;  3MGR A;  4ZBJ B;  2BYM A;  1M1A D;  5AVC A;  1BH9 B;  4H9S A;  2FJ7 C;  5AV9 D;  5B1L C;  2NZD D;  4XUJ A;  4CSR B;  1P3A C;  5B32 G;  4QLC A;  1B67 A;  1P3F C;  5AVC D;  3AZL B;  3AV2 B;  3KXB D;  2Y2G A;  4XUJ D;  3C1B C;  3AZL C;  5AVB B;  5B31 G;  1JFI A;  3WKJ C;  3AZM B;  4QLC D;  1P3L A;  3X1U A;  1P3O B;  3REL A;  4ZUX A;  5B1M D;  5AV8 A;  5AVB C;  5CPK D;  3KUY A;  3UT9 C;  1ID3 A;  1P3I A;  3VH5 W;  3AZI A;  5DNM B;  5JRG B;  5CPI B;  2PYO B;  3NQJ A;  2J8P A;  2FFF B;  1P3L D;  3B0D C;  1P3P C;  3X1U D;  2F8N B;  4H9N A;  3AZH B;  5DNM C;  3W96 B;  5AV8 D;  5CPI C;  3REH B;  3AZG C;  3X1V B;  1AOI B;  3O62 B;  3AZI D;  4HGA B;  2G5H C;  3MGQ B;  3AZK A;  1AOI C;  5E5A A;  4X23 A;  2ZY2 A;  2L5A A;  3AV2 D;  3VH6 T;  4H9P A;  4J8V C;  3MGP A;  3AZK D;  5AV6 C;  4XZQ A;  5B40 B;  3MGS B;  4Z5T A;  5B0Y A;  3AZM D;  2Y2K A;  3R45 A;  1P3O D;  3AZH A;  1EQZ B;  3B0B A;  4KGC A;  3P5J B;  3AN2 A;  3MGP D;  4XZQ D;  5KDM B;  1TZY B;  4Z5T D;  5B0Y D;  5JRG D;  5G49 A;  2F8N D;  2RVQ C;  3AZH D;  4KGC D;  3REH D;  3AZN B;  2ARO B;  3X1V D;  4H9R A;  3O62 D;  5B2J B;  3B6F B;  4WNN B;  3AZE A;  3MNN C;  2Y2Q A;  3MGQ D;  5B2J C;  3B6F C;  3WTP C;  4JJN C;  3AFA B;  1H3O A;  1M18 B;  5DNN A;  3AZE D;  4Z66 B;  3LZ0 A;  5GXQ A;  5B40 D;  1KX5 C;  3X1T C;  1P3G C;  3W99 C;  4Z66 C;  2JSS A;  1TAF A;  3AZF B;  3A6N C;  5DNN D;  3EG5 B;  4R8P A;  3UTB A;  3EPK A;  3KWQ A;  3WA9 B;  3AZF C;  4J8U C;  2F8N K;  2NQB C;  5CP6 A;  5BT1 D;  1KX4 A;  4WU8 B;  3VH6 A;  2Y2P A;  4R8P D;  3W97 A;  3UTB D;  3AFA A;  3UTA C;  3AZN D;  2ARO D;  5GT0 A;  1F66 B;  4KUD B;  4KHA B;  3W98 C;  1HQ3 C;  4G92 B;  3EPH A;  3H0L C;  1F66 C;  4KUD C;  5AY8 C;  3LJA C;  4G92 C;  3W97 D;  3AFA D;  3KSY A;  3V9R B;  5GT0 D;  1M18 D;  5B2I C;  4J8W B;  1S32 B;  3AV1 B;  5B24 A;  1P3K C;  1P3M B;  5F99 A;  3MVD C;  5GSU A;  1P34 A;  3AV1 C;  4WU9 B;  5B32 A;  4G91 B;  1KX3 B;  3B0C W;  1P3B A;  2YFW B;  2HIO C;  3WA9 D;  5F99 D;  3WAA A;  5GSU D;  1P34 D;  5B31 A;  5AV9 A;  4WU8 D;  5B0Z A;  4YS3 A;  1U35 B;  2FJ7 B;  3REJ B;  1M19 A;  5BNX A;  2ZM5 A;  5B1L B;  4WZS B;  5FUG A;  3WAA D;  5B31 D;  3LZ1 B;  1U35 C;  1P3A B;  3MGR C;  3KXB A;  3REJ C;  5GT3 B;  5B0Z D;  5B33 A;  4UUZ A;  4YS3 D;  5AVC C;  1P3F B;  4H9S C;  3LZ1 C;  5CPJ A;  1M19 D;  3C1C B;  3X1S A;  5GT3 C;  4J8W D;  1S32 D;  3C1B B;  1PZR A;  3REI A;  3WKJ B;  1P3M D;  5B1M A;  3C1C C;  5B33 D;  5CPK A;  3FDD A;  1KU5 A;  5AV5 A;  3REK A;  5CPJ D;  1KX3 D;  3X1S D;  2DQN C;  3UT9 B;  1N1J B;  3AZJ B;  3REI D;  2Y2L A;  1P3L C;  3B0D B;  5AV5 D;  1P3P B;  1BH9 A;  3REK D;  3REL C;  4ZUX C;  3AZJ C;  5BS7 C;  5AV8 C;  1ID3 C;  3KUY C;  3AZG B;  1P3I C;  4CSR A;  2FJ7 D; 
#chains in the Genus database with same CATH homology
 1F1E A;  4NE6 A;  3AYW B;  3AZL A;  3AV2 A;  1P3A D;  4YM6 B;  4M6B A;  2HUE B;  1P3F D;  1ZLA B;  3AYW C;  4YM6 C;  4J8V B;  2UWX A;  5AVB A;  2W8S A;  2HUE C;  3AZK C;  3AZM A;  5AV6 B;  3WTP E;  3AZL D;  4H9Q B;  1ZLA C;  3LEL B;  1BH8 B;  1P3O A;  2Y2O A;  5E5A C;  4X23 C;  1HTA A;  2Y2J A;  4NFT A;  5DNM A;  3LEL C;  5AVB D;  5JRG A;  5CPI A;  3UT9 D;  3MGP C;  2PYO A;  2F8N A;  3W96 A;  3REH A;  3X1V A;  1AOI A;  4LD9 B;  3O62 A;  1P3P D;  3NQU B;  4KGC C;  5DNM D;  3AN2 C;  5CPI D;  3AZG D;  2PYO D;  3MGQ A;  4H9O B;  4LD9 C;  3MNN B;  2ZY5 A;  3W96 D;  1AOI D;  4J8X B;  5BNV B;  3WTP B;  4JJN B;  1Z2C B;  4J8X C;  5B40 A;  3MGS A;  4E44 A;  1R4V A;  4CAY B;  4J8V D;  2CV5 B;  5AV6 D;  1KX5 B;  3X1T B;  5C3I B;  1P3G B;  1EQZ A;  3W99 B;  2CV5 C;  3A6N B;  3B6G B;  3MGS D;  5KDM A;  1TZY A;  5C3I C;  3LZ0 C;  1A7W A;  5GXQ C;  4J8U B;  3B6G C;  3MNN A;  1EQZ D;  2NQB B;  5BT1 C;  3AZN A;  2ARO A;  5B2J A;  3B6F A;  3AL0 C;  4WNN A;  1TZY D;  2RVQ D;  3UTA B;  5BO0 B;  3KWQ C;  3W98 B;  4DQY B;  1HQ3 B;  3VH6 W;  2YFV B;  3MNN D;  5CP6 C;  1KX4 C;  2CWE A;  1M18 A;  5B2J D;  3B6F D;  5AY8 B;  3LJA B;  4JJN D;  4Z66 A;  5GT0 C;  2BYK B;  5B2I B;  3EPL A;  1W2E A;  1P3K B;  3TU4 C;  3MVD B;  4Z2M G;  3AZF A;  3X1T D;  3W99 D;  4Z66 D;  3A6N D;  3WA9 A;  1ULY A;  5B24 C;  5CHL B;  2HIO B;  4WU8 A;  3AZF D;  3W98 A;  5GSU C;  5JA4 B;  2NQB D;  5B32 C;  1F66 A;  4KUD A;  4KHA A;  2JE5 A;  1M1A B;  1P3B C;  3UTA D;  2NZD B;  3W98 D;  1HQ3 D;  5B31 C;  3VH5 T;  1M1A C;  3MGR B;  5AV9 C;  3V9R A;  1F66 D;  4KUD D;  2BYM B;  2NZD C;  5AY8 D;  1WWI A;  4EO5 C;  5AVC B;  3LJA D;  4J8W A;  3AV1 A;  1S32 A;  3IP4 C;  1T3U A;  5B2I D;  1P3M A;  4XUJ B;  3KXB C;  4WU9 A;  1P3K D;  1KX3 A;  4QLC B;  4XUJ C;  3AV1 D;  5CPJ C;  3A1K A;  2XD5 A;  2YFW A;  4QLC C;  2Y2I A;  4WU9 D;  1JFI B;  2HIO D;  5B1M C;  5CPK C;  1P3L B;  1U35 A;  3X1U B;  2FJ7 A;  3REJ A;  3REL B;  4ZUX B;  5AV8 B;  4Z2M H;  1ID3 B;  3KUY B;  5B1L A;  1P3I B;  2IO5 C;  3LZ1 A;  3AZI B;  3X1U C;  1P3A A;  5GT3 A;  4ZBJ C;  3NQJ B;  1U35 D;  1P3F A;  3AZI C;  4H9N B;  3MGR D;  4UPK A;  3REJ D;  3C1C A;  5B1L D;  3A1I A;  3LZ1 D;  3C1B A;  4WV4 B;  3WKJ A;  5GT3 D;  3AZK B;  3AV2 C;  3C1C D;  2F2A C;  5E5A B;  4X23 B;  3UT9 A;  1N1J A;  1B6W A;  2LY8 A;  3C1B D;  2VQR A;  4H9P B;  3AZJ A;  4DRB A;  5BS7 A;  3WKJ D;  3VH5 A;  3MGP B;  3AZM C;  4XZQ B;  1P3P A;  4Z5T B;  1P3O C;  5B0Y B;  3AZG A;  3R45 B;  3KFU G;  4XZQ C;  3REL D;  3AZJ D;  4ZUX D;  4Z5T C;  4KGC B;  5B0Y C;  5JRG C;  3AN2 B;  3KUY D;  1ID3 D;  2PYO C;  1P3I D;  3F6T A;  3AYW A;  3AZH C;  3W96 C;  4YM6 A;  3X1V C;  3REH C;  5G49 B;  3O62 C;  1ZLA A;  4HGA C;  4J8V A;  4H9R B;  3MGQ C;  5AV6 A;  3AZE B;  3AYW D;  4H9Q A;  3LEL A;  1BH8 A;  4YM6 D;  4DRA A;  3AZE C;  1ZLA D;  1H3O B;  5E5A D;  4X23 D;  2Y2H A;  5DNN B;  3MGS C;  5B40 C;  4AWL B;  3LZ0 B;  3LEL D;  5GXQ B;  2XD1 A;  4LD9 A;  5DNN C;  3NQU A;  4AWL C;  1EQZ C;  2DF4 C;  1TAF B;  1Q9C A;  4H9O A;  1WWS A;  4R8P B;  1TZY C;  3UTB B;  3AN2 D;  3KWQ B;  4J8X A;  3B0C T;  4LD9 D;  3H0M C;  4R8P C;  5BNV A;  3WTP A;  4JJN A;  5CP6 B;  3UTB C;  3AZN C;  2ARO C;  1KX4 B;  3W97 B;  4CAY A;  5GT0 B;  2CV5 A;  2ZY3 A;  4J8X D;  1KX5 A;  3X1T A;  1P3G A;  3WTP D;  3W97 C;  3AFA C;  3W99 A;  2F8N G;  1M18 C;  3TU4 B;  3A6N A;  3B6G A;  1BFM A;  2CV5 D;  1KX5 D;  4J8U A;  3LZ0 D;  2RIQ A;  1P3G D;  2NQB A;  5GXQ D;  5B24 B;  5F99 B;  5GSU B;  1P34 B;  3B6G D;  4NE3 A;  2JCH A;  5B32 B;  3UTA A;  5BO0 A;  4E45 A;  3WA9 C;  5F99 C;  4J8U D;  1P34 C;  1HQ3 A;  1P3B B;  2YFV A;  2Y2M A;  3KWQ D;  4WU8 C;  3WAA B;  5AY8 A;  5B31 B;  3LJA A;  5CP6 D;  1KX4 D;  5AV9 B;  5B0Z B;  2BYK A;  5B2I A;  3TU4 A;  4YS3 B;  3WAA C;  4EO5 B;  1M19 B;  1P3K A;  5BNX B;  5B0Z C;  5FUG B;  3MVD A;  4YS3 C;  3EPJ A;  2BG1 A;  3KXB B;  1M19 C;  3H0R C;  5B33 B;  4UUZ B;  3TU4 D;  4J8W C;  1S32 C;  2G5I C;  5CPJ B;  3X1S B;  2HIO A;  1P3M C;  5B33 C;  3MVD D;  5JA4 A;  4WU9 C;  5B24 D;  3REI B;  4G91 C;  4WJ3 C;  5B1M B;  1KX3 C;  4NE5 A;  3X1S C;  5CPK B;  1M1A A;  5AV5 B;  5B32 D;  2Y2N A;  3REK B;  2F8N H;  3REI C;  2NZD A;  2IO5 B;  1P3B D;  5AV5 C;  3REK C;  2ZY4 A;  3MGR A;  4ZBJ B;  2BYM A;  1M1A D;  5AVC A;  1BH9 B;  4H9S A;  2FJ7 C;  5AV9 D;  5B1L C;  2NZD D;  4XUJ A;  4CSR B;  1P3A C;  5B32 G;  4QLC A;  1B67 A;  1P3F C;  5AVC D;  3AZL B;  3AV2 B;  3KXB D;  2Y2G A;  4XUJ D;  3C1B C;  3AZL C;  5AVB B;  5B31 G;  1JFI A;  3WKJ C;  3AZM B;  4QLC D;  1P3L A;  3X1U A;  1P3O B;  3REL A;  4ZUX A;  5B1M D;  5AV8 A;  5AVB C;  5CPK D;  3KUY A;  3UT9 C;  1ID3 A;  1P3I A;  3VH5 W;  3AZI A;  5DNM B;  5JRG B;  5CPI B;  2PYO B;  3NQJ A;  2J8P A;  2FFF B;  1P3L D;  3B0D C;  1P3P C;  3X1U D;  2F8N B;  4H9N A;  3AZH B;  5DNM C;  3W96 B;  5AV8 D;  5CPI C;  3REH B;  3AZG C;  3X1V B;  1AOI B;  3O62 B;  3AZI D;  4HGA B;  2G5H C;  3MGQ B;  3AZK A;  1AOI C;  5E5A A;  4X23 A;  2ZY2 A;  2L5A A;  3AV2 D;  3VH6 T;  4H9P A;  4J8V C;  3MGP A;  3AZK D;  5AV6 C;  4XZQ A;  5B40 B;  3MGS B;  4Z5T A;  5B0Y A;  3AZM D;  2Y2K A;  3R45 A;  1P3O D;  3AZH A;  1EQZ B;  3B0B A;  4KGC A;  3P5J B;  3AN2 A;  3MGP D;  4XZQ D;  5KDM B;  1TZY B;  4Z5T D;  5B0Y D;  5JRG D;  5G49 A;  2F8N D;  2RVQ C;  3AZH D;  4KGC D;  3REH D;  3AZN B;  2ARO B;  3X1V D;  4H9R A;  3O62 D;  5B2J B;  3B6F B;  4WNN B;  3AZE A;  3MNN C;  2Y2Q A;  3MGQ D;  5B2J C;  3B6F C;  3WTP C;  4JJN C;  3AFA B;  1H3O A;  1M18 B;  5DNN A;  3AZE D;  4Z66 B;  3LZ0 A;  5GXQ A;  5B40 D;  1KX5 C;  3X1T C;  1P3G C;  3W99 C;  4Z66 C;  2JSS A;  1TAF A;  3AZF B;  3A6N C;  5DNN D;  3EG5 B;  4R8P A;  3UTB A;  3EPK A;  3KWQ A;  3WA9 B;  3AZF C;  4J8U C;  2F8N K;  2NQB C;  5CP6 A;  5BT1 D;  1KX4 A;  4WU8 B;  3VH6 A;  2Y2P A;  4R8P D;  3W97 A;  3UTB D;  3AFA A;  3UTA C;  3AZN D;  2ARO D;  5GT0 A;  1F66 B;  4KUD B;  4KHA B;  3W98 C;  1HQ3 C;  4G92 B;  3EPH A;  3H0L C;  1F66 C;  4KUD C;  5AY8 C;  3LJA C;  4G92 C;  3W97 D;  3AFA D;  3KSY A;  3V9R B;  5GT0 D;  1M18 D;  5B2I C;  4J8W B;  1S32 B;  3AV1 B;  5B24 A;  1P3K C;  1P3M B;  5F99 A;  3MVD C;  5GSU A;  1P34 A;  3AV1 C;  4WU9 B;  5B32 A;  4G91 B;  1KX3 B;  3B0C W;  1P3B A;  2YFW B;  2HIO C;  3WA9 D;  5F99 D;  3WAA A;  5GSU D;  1P34 D;  5B31 A;  5AV9 A;  4WU8 D;  5B0Z A;  4YS3 A;  1U35 B;  2FJ7 B;  3REJ B;  1M19 A;  5BNX A;  2ZM5 A;  5B1L B;  4WZS B;  5FUG A;  3WAA D;  5B31 D;  3LZ1 B;  1U35 C;  1P3A B;  3MGR C;  3KXB A;  3REJ C;  5GT3 B;  5B0Z D;  5B33 A;  4UUZ A;  4YS3 D;  5AVC C;  1P3F B;  4H9S C;  3LZ1 C;  5CPJ A;  1M19 D;  3C1C B;  3X1S A;  5GT3 C;  4J8W D;  1S32 D;  3C1B B;  1PZR A;  3REI A;  3WKJ B;  1P3M D;  5B1M A;  3C1C C;  5B33 D;  5CPK A;  3FDD A;  1KU5 A;  5AV5 A;  3REK A;  5CPJ D;  1KX3 D;  3X1S D;  2DQN C;  3UT9 B;  1N1J B;  3AZJ B;  3REI D;  2Y2L A;  1P3L C;  3B0D B;  5AV5 D;  1P3P B;  1BH9 A;  3REK D;  3REL C;  4ZUX C;  3AZJ C;  5BS7 C;  5AV8 C;  1ID3 C;  3KUY C;  3AZG B;  1P3I C;  4CSR A;  2FJ7 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...