2F8NG

2.9 angstrom x-ray structure of hybrid macroh2a nucleosomes
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
108
structure length
108
Chain Sequence
STKTSRSAKAGVIFPVGRMLRYIKKGHPKYRIGVGAPVYMAAVLEYLTAEILELAVNAARDNKKGRVTPRHILLAVANDEELNQLLKGVTIASGGVLPNIHPELLAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein/dna
molecule keywords alpha-satellite DNA (146 bp)
publication title Nucleosomes containing the histone domain of macroH2A: In vitro possibilities.
rcsb
source organism Homo sapiens
total genus 31
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2005-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2f8nG00
2JSSA 5E5AC 4H9QA 5F99A 3MVDA 1P3FB 5CP6D 3REJB 3UT9A 3W99C 3WKJC 5AVBB 3AZNA 3AZEC 2RVQC 3KWQB 5B32D 4AWLC 2F8NK 5GT0B 3LJAB 4KGCD 1B67A 5G49A 4WU9D 5B40C 5AV5C 5B33C 5AV8B 1M19A 2AROB 3O62B 3KUYD 2HIOA 3W98D 3AFAC 5B0YC 5CPKC 2FJ7C 3AYWC 3MNNB 2PYOC 1P3IC 3TU4B 1P3KB 5GSUC 1TZYD 3VH5T 1R4VA 4DRBA 3AZJD 3WA9D 1F66C 3AZMA 2NQBC 3X1SD 1U35B 3WTPA 5AV6A 3KUYB 5DNMA 2L5AA 5B0ZC 3REKD 1P3GD 1KU5A 4X23A 4E45A 3UTBC 1M18A 3REIA 3WAAD 5B2JD 4H9QB 5JRGD 3B6GA 2F8NH 2F8NG 1P3LD 3AZJB 3AV1D 3RELA 5FUGA 5DNNC 3AZNB 1P3AC 1BH8A 3B6FA 3LZ0A 3MGPA 1P34C 1S32C 4ZUXD 3AN2C 3W97A 2CV5C 3AZGA 1P3MD 2NZDB 1AOIA 3AZIA 1P3BD 1P3PC 1KX3C 4UUZA 3C1BB 5CPJD 5B2JB 4H9RB 4NE5A 4Z66B 1M19B 1P3LB 1EQZC 4YM6D 4J8WD 3A6NA 3X1UB 5B31A 3X1VC 4HGAB 1M1AA 3AZHB 3NQUA 3AZFC 5AV9C 4XZQC 5B2IB 1P3OB 4J8VC 4NE3A 3W96D 4YS3A 2YFWA 5E5AD 5AY8C 4QLCC 3AV2C 4KUDC 4LD9C 1P3FA 3W99D 3WKJD 5AV6B 5AVBA 3AZED 5B1LA 2RVQD 4Z5TB 3X1TC 4H9SC 5CPIA 4CAYA 3MGSC 3AZKD 5GT0A 3REIB 3UTAC 5B40D 1ZLAC 5AV5D 5B33D 5E5AB 3C1CC 3RELB 4WU8C 1BH8B 5F99C 5B24D 3MVDC 5AV8A 4ZBJB 2AROA 5BT1C 3O62A 3AFAD 5B0YD 5CPKD 4AWLB 3AYWD 2HUEB 5B32A 2PYOD 3AZKB 1P3ID 4UUZB 3LZ1D 5C3IC 4KGCA 5GSUD 5B40B 5B33B 4WU9A 1F66D 3B0CW 5B24B 2NQBD 3NQUB 3LELD 3KUYA 5B0ZD 3AFAB 3AZLB 1WWSA 2HIOC 3AYWB 2PYOB 3UTBD 1P3IB 3LZ1B 2YFWB 1TZYA 2IO5C 5GXQB 3AZJA 5DNND 1P3AD 3WA9A 2NQBB 3AZMC 5B1LB 3X1SA 3LELB 1P34D 3WTPC 3KXBB 5CPIB 5DNMC 4CAYB 3AN2D 4X23C 2CV5D 5AVCC 2NZDA 1KX3D 1P3PD 1BFMA 2F8ND 1F1EA 3C1BA 3WAAA 5B2JA 4H9RA 5CP6B 4Z66A 1HTAA 1EQZD 1P3LA 4EO5B 1P3AB 3X1UA 3B6FC 3LZ0C 3MGPC 3AZFD 5B32B 1B6WA 3AZHA 5AV9D 4J8UC 4JJNC 1ID3C 4Z2MH 3AN2B 4ZUXA 2CV5B 4KGCB 4J8VD 1HQ3C 5B2IA 1P3OA 3W97C 4WU9B 1P3BA 3AZIC 1AOIC 3NQJB 5B1MC 4QLCD 3MGRC 5AY8D 4G92C 3AV2D 1JFIB 4LD9D 1EQZB 4YM6A 4J8WA 1KX5C 3W98B 2BYKA 3X1TD 5B31C 4Z5TA 3AZFB 1M1AC 3VH5A 3MGSD 3MGQC 3V9RA 3REHC 3UTAD 1TZYB 4R8PD 1ZLAD 3VH6A 1KX4C 3C1CD 3AV2B 3WA9B 5E5AA 4WU8D 3X1SB 1P3FC 3REJC 5BT1D 3REKB 5AVBC 1P3GB 3KWQC 3AZKA 3WAAB 3LJAC 5JRGB 3UTAB 4R8PB 5B40A 5B33A 4J8XC 4WU8B 3AV1B 3KSYA 5B24A 5AV8C 1N1JB 2AROC 2HIOD 3O62C 3AFAA 5B0YA 3AZLA 4ZUXB 4WNNB 3AYWA 1P3MB 2PYOA 1P3IA 1P3BB 4XUJC 4WZSB 3MNNC 5CPJB 3LZ1A 1Q9CA 3TU4C 1P3KC 4YM6B 4J8WB 5GXQA 1F66A 2BYKB 3AZMD 2NQBA 1U35C 3WTPD 3LELA 4KHAB 5DNMD 5B0ZA 3KXBA 3KUYC 5BS7A 2YFVB 3V9RB 5AVCD 4H9NB 3W96B 5GT3C 5CP6A 3W99B 3WKJB 3UT9C 1P3AA 4DRAA 3AZEB 3AZNC 3B6FD 3MGPD 2FJ7D 1A7WA 4J8UD 4JJND 5BO0B 1ID3D 4NE6A 3AN2A 5AVCB 2CV5A 1HQ3D 3W97D 1KX3A 1P3PA 5AV5B 3AZID 1AOID 2NZDC 2CWEA 5B1MD 3MGRD 3NQJA 3C1BC 1JFIA 3B0CT 4H9OA 1EQZA 4Z66C 1M19C 1KX5D 3W98A 4E44A 5B0YB 3X1UC 5CPKB 5B31D 2FJ7B 4HGAC 3AZFA 4JJNB 3AZHC 3MGQD 3REHD 5GSUB 4J8VA 5B2IC 1P3OC 1KX4D 3MGRB 4QLCA 3AV2A 1F66B 4WV4B 4H9PA 4G91C 5JA4A 3REJD 1P3FD 3B0DC 5B0ZB 1BH9B 5AV6C 1S32D 5AVBD 2BYMB 3X1TA 3REKA 4H9SA 5BNXB 1P3GA 5CHLB 4Z5TC 3UTBB 3KWQD 1TAFB 1M18C 3REHB 3LJAD 5JRGA 3REIC 3UTAA 4R8PA 1KX4B 1ZLAA 3B6GC 4CSRB 3C1CA 4J8XD 5DNNB 4WU8A 3AV1A 3RELC 3X1VD 5BNVB 5AV8D 2AROD 1P34B 4ZBJC 1N1JA 1S32B 3O62D 5B31G 4XZQD 4Z2MG 4WNNA 1P3MA 1ULYA 1P3PB 2HUEC 4XUJD 3MNND 3AZGC 1KX3B 2F8NB 3AZKC 3TU4D 5CPJA 1P3KD 4KUDD 4H9OB 5KDMB 4J8XB 3A6NC 3X1VB 5B24C 1U35D 5AV9B 4KHAA 2YFVA 4XZQB 3AZLC 4J8VB 4XUJB 4H9NA 5GT3D 3W96A 4QLCB 4KUDB 5AY8B 4LD9B 3LZ1C 4YS3C 3VH5W 4H9PB 5F99D 2LY8A 3MVDD 5JA4B 3UT9D 3W99A 3WKJA 5GXQC 3AZND 3X1TB 3AZEA 3VH6W 5B1LC 3VH6T 3R45A 3LELC 3MGSB 3KXBC 5CPIC 5BO0A 1H3OB 5BS7C 5GT0C 5AVCA 5B32G 1ZLAB 5GT3B 2NZDD 5AV5A 3C1CB 3C1BD 4M6BA 5F99B 3MVDB 4Z66D 4NFTA 3UT9B 5CP6C 1M19D 4EO5C 3X1UD 5CPKA 2FJ7A 3AZHD 4J8UA 4JJNA 5B32C 1ID3A 5C3IB 1HQ3A 5G49B 5GSUA 4KGCC 5B2ID 1P3OD 5B1MA 3MGRA 4WU9C 1KX5A 5AV6D 2HIOB 1BH9A 3W98C 2BYMA 4Z5TD 5BNXA 4X23D 3UTBA 1M18D 3MGQA 1TAFA 3REHA 3REID 3B6GD 2IO5B 1KX4A 1TZYC 3WTPE 4CSRA 5DNNA 3AZJC 3AZMB 3RELD 3WA9C 4G91B 5BNVA 3REJA 3B0DB 3WTPB 3X1SC 3LZ0D 3R45B 1P34A 1S32A 5DNMB 3REKC 4X23B 1P3GC 1M18B 3KWQA 3AZGD 2F8NA 3LJAA 3B6GB 3WAAC 5B2JC 5JRGC 4R8PC 5KDMA 4J8XA 1P3LC 5FUGB 3A6ND 3AV1C 3X1VA 3B6FB 3LZ0B 3MGPB 1M1AD 4J8UB 5AV9A 1ID3B 3AZLD 4XZQA 1HQ3B 4ZUXC 3W97B 3AZGB 1AOIB 3AZIB 4XUJA 3MNNA 1P3MC 5B1MB 1P3BC 4G92B 1WWIA 3TU4A 1P3KA 5AY8A 4YS3D 3B0BA 5CPJC 4KUDA 4LD9A 1KX5B 4YM6C 4J8WC 3A6NB 5GXQD 5B31B 5B1LD 1U35A 1M1AB 3KXBD 5CPID 3MGSA 3MGQB 1H3OA 5GT0D 5GT3A 3W96C 4YS3B
chains in the Genus database with same CATH superfamily
2JSSA 5E5AC 3EPJA 4H9QA 4UPKA 2RIQA 5F99A 3MVDA 5CP6D 2Y2KA 3REJB 3UT9A 1P3FB 3W99C 3WKJC 2Y2LA 5AVBB 3AZNA 2W8SA 2J8PA 3AZEC 2RVQC 4DQYB 3KWQB 5B32D 4AWLC 2F8NK 5GT0B 3LJAB 4KGCD 1B67A 5G49A 3A1KA 4WU9D 5B40C 5AV5C 5B33C 5AV8B 1M19A 2AROB 3P5JB 3O62B 3KUYD 2HIOA 3W98D 3AFAC 5B0YC 5CPKC 2FJ7C 3AYWC 3MNNB 2PYOC 1P3IC 3TU4B 1P3KB 5GSUC 1TZYD 3VH5T 1R4VA 4DRBA 3AZJD 3WA9D 1F66C 3AZMA 2NQBC 3X1SD 1U35B 3IP4C 3WTPA 5AV6A 3KUYB 5DNMA 2L5AA 5B0ZC 3REKD 1P3GD 2JE5A 1KU5A 4X23A 4E45A 3UTBC 1M18A 1T3UA 3REIA 3WAAD 5B2JD 4H9QB 5JRGD 3B6GA 2F8NH 2F8NG 1P3LD 3AZJB 3AV1D 3RELA 5FUGA 5DNNC 3AZNB 1P3AC 1BH8A 3B6FA 3LZ0A 3MGPA 1P34C 1S32C 4ZUXD 3AN2C 3W97A 2CV5C 3AZGA 1P3MD 2NZDB 1AOIA 3AZIA 1P3BD 1P3PC 1KX3C 4UUZA 3C1BB 5CPJD 5B2JB 4H9RB 4NE5A 2ZY3A 4Z66B 1M19B 1P3LB 2XD5A 1EQZC 4YM6D 4J8WD 3A6NA 3X1UB 5B31A 3X1VC 4HGAB 1M1AA 3AZHB 3NQUA 3AZFC 5AV9C 4XZQC 5B2IB 1P3OB 4J8VC 4NE3A 3W96D 4YS3A 2YFWA 5E5AD 5AY8C 4QLCC 3AV2C 4KUDC 4LD9C 2JCHA 1P3FA 3W99D 3WKJD 5AV6B 5AVBA 3AZED 5B1LA 2RVQD 4Z5TB 3X1TC 4H9SC 5CPIA 4CAYA 3MGSC 3AZKD 5GT0A 3REIB 4WJ3C 3UTAC 5B40D 1ZLAC 5AV5D 5B33D 5E5AB 3C1CC 3RELB 4WU8C 1BH8B 5B24D 5F99C 3MVDC 5AV8A 4ZBJB 2AROA 5BT1C 3O62A 3AFAD 5B0YD 5CPKD 4AWLB 3AYWD 2HUEB 5B32A 2PYOD 3AZKB 1P3ID 4UUZB 2VQRA 3LZ1D 5C3IC 4KGCA 5GSUD 5B40B 5B33B 4WU9A 1F66D 3B0CW 5B24B 2NQBD 3NQUB 3LELD 3KUYA 5B0ZD 3AFAB 3AZLB 1WWSA 2HIOC 2Y2MA 3AYWB 2PYOB 3UTBD 1P3IB 3LZ1B 2YFWB 1TZYA 2IO5C 5GXQB 3AZJA 5DNND 1P3AD 3WA9A 2NQBB 3AZMC 5B1LB 3X1SA 3EPHA 3LELB 1P34D 3WTPC 3KXBB 5CPIB 5DNMC 4CAYB 3AN2D 4X23C 2CV5D 5AVCC 2NZDA 1KX3D 1P3PD 1BFMA 2F8ND 1F1EA 3C1BA 2ZY5A 5B2JA 3WAAA 4H9RA 3EPLA 5CP6B 4Z66A 1HTAA 1EQZD 1P3LA 4EO5B 1P3AB 3X1UA 3B6FC 3LZ0C 3MGPC 3AZFD 3FDDA 1B6WA 5B32B 3EPKA 5AV9D 4J8UC 3AZHA 4JJNC 1ID3C 4Z2MH 3AN2B 4ZUXA 2CV5B 4KGCB 3A1IA 4J8VD 1HQ3C 5B2IA 1P3OA 3W97C 4WU9B 1P3BA 3AZIC 1AOIC 3NQJB 5B1MC 4QLCD 3MGRC 5AY8D 4G92C 3AV2D 1JFIB 4LD9D 1EQZB 4YM6A 4J8WA 1KX5C 3W98B 2BYKA 3X1TD 5B31C 4Z5TA 3AZFB 1M1AC 3VH5A 3MGSD 3MGQC 3V9RA 3REHC 3UTAD 1TZYB 4R8PD 1ZLAD 3VH6A 1KX4C 3C1CD 3AV2B 3WA9B 5E5AA 4WU8D 3X1SB 1P3FC 3REJC 5BT1D 3REKB 5AVBC 1P3GB 3KWQC 3AZKA 3WAAB 3LJAC 3H0LC 5JRGB 2Y2IA 3UTAB 4R8PB 5B40A 5B33A 4J8XC 4WU8B 3AV1B 3KSYA 2Y2HA 3H0RC 5B24A 5AV8C 1N1JB 2AROC 2HIOD 3O62C 3AFAA 5B0YA 3AZLA 4ZUXB 4WNNB 3AYWA 1P3MB 2PYOA 1P3IA 1P3BB 4XUJC 4WZSB 3MNNC 5CPJB 3LZ1A 1Q9CA 3TU4C 1P3KC 4YM6B 4J8WB 2F2AC 5GXQA 1F66A 2BYKB 3AZMD 2NQBA 1U35C 3WTPD 3LELA 4KHAB 5DNMD 5B0ZA 3KXBA 3KUYC 5BS7A 2YFVB 3V9RB 5AVCD 4H9NB 3W96B 5GT3C 2FFFB 5CP6A 3W99B 3WKJB 3UT9C 1P3AA 4DRAA 3AZEB 3AZNC 3B6FD 3MGPD 3H0MC 2FJ7D 1A7WA 4J8UD 4JJND 5BO0B 1ID3D 4NE6A 3AN2A 5AVCB 2CV5A 1HQ3D 3W97D 3F6TA 1P3PA 5AV5B 3AZID 1KX3A 1AOID 2CWEA 5B1MD 3MGRD 3NQJA 2NZDC 3C1BC 1JFIA 3B0CT 4H9OA 1EQZA 4Z66C 2Y2NA 1M19C 1KX5D 3W98A 4E44A 5B0YB 3X1UC 5CPKB 5B31D 2FJ7B 4HGAC 3AZFA 4JJNB 3AZHC 3MGQD 3REHD 5GSUB 4J8VA 5B2IC 2ZM5A 1P3OC 1KX4D 3MGRB 4QLCA 3AV2A 1F66B 4WV4B 4H9PA 4G91C 5JA4A 3REJD 1P3FD 3B0DC 5B0ZB 1BH9B 5AV6C 2Y2QA 1S32D 5AVBD 2BYMB 3X1TA 3REKA 4H9SA 5BNXB 1P3GA 5CHLB 4Z5TC 3UTBB 3KWQD 1TAFB 1M18C 3REHB 3LJAD 2G5HC 5JRGA 3REIC 3UTAA 4R8PA 1KX4B 1ZLAA 3B6GC 4CSRB 3C1CA 4J8XD 5DNNB 4WU8A 3AV1A 3RELC 3X1VD 5BNVB 5AV8D 2AROD 1P34B 4ZBJC 1N1JA 1S32B 3O62D 5B31G 1PZRA 2DF4C 4XZQD 4Z2MG 4WNNA 1P3MA 1ULYA 1P3PB 2HUEC 4XUJD 3MNND 3AZGC 1KX3B 2F8NB 3AZKC 3TU4D 5CPJA 1P3KD 4KUDD 4H9OB 5KDMB 4J8XB 3A6NC 3X1VB 2DQNC 5B24C 1U35D 2Y2GA 5AV9B 3EG5B 4KHAA 2YFVA 4XZQB 3AZLC 2BG1A 4J8VB 4XUJB 3KFUG 4H9NA 5GT3D 3W96A 4QLCB 4KUDB 5AY8B 4LD9B 3LZ1C 4YS3C 3VH5W 4H9PB 5F99D 2LY8A 3MVDD 5JA4B 2ZY2A 3UT9D 3W99A 3WKJA 5GXQC 3AZND 3X1TB 3AZEA 3VH6W 2Y2PA 5B1LC 3AL0C 3VH6T 2Y2JA 3R45A 3LELC 1W2EA 3MGSB 3KXBC 5CPIC 5BO0A 1H3OB 5BS7C 5GT0C 5AVCA 5B32G 1ZLAB 5GT3B 2NZDD 5AV5A 3C1CB 3C1BD 4M6BA 5F99B 3MVDB 4Z66D 4NFTA 3UT9B 5CP6C 1M19D 2Y2OA 4EO5C 3X1UD 5CPKA 2FJ7A 3AZHD 4J8UA 4JJNA 5B32C 1ID3A 5C3IB 1HQ3A 5G49B 5GSUA 4KGCC 5B2ID 1P3OD 2G5IC 5B1MA 3MGRA 4WU9C 1KX5A 5AV6D 2HIOB 1BH9A 3W98C 2BYMA 4Z5TD 5BNXA 4X23D 3UTBA 1M18D 3MGQA 1TAFA 3REHA 3REID 3B6GD 2IO5B 1KX4A 1TZYC 3WTPE 4CSRA 5DNNA 3AZJC 3AZMB 3RELD 3WA9C 4G91B 5BNVA 3REJA 3B0DB 3WTPB 3X1SC 3LZ0D 3R45B 1P34A 1S32A 5DNMB 2UWXA 3REKC 4X23B 2XD1A 1P3GC 1M18B 3KWQA 3AZGD 2F8NA 3LJAA 3B6GB 3WAAC 5B2JC 5JRGC 4R8PC 5KDMA 4J8XA 1P3LC 5FUGB 3A6ND 3AV1C 3X1VA 3B6FB 3LZ0B 3MGPB 1M1AD 4J8UB 5AV9A 1ID3B 3AZLD 4XZQA 1HQ3B 4ZUXC 3W97B 3AZGB 1AOIB 3AZIB 4XUJA 3MNNA 1P3MC 5B1MB 1P3BC 4G92B 1WWIA 3TU4A 1P3KA 5AY8A 4YS3D 3B0BA 5CPJC 4KUDA 4LD9A 1KX5B 4YM6C 4J8WC 3A6NB 5GXQD 5B31B 5B1LD 1U35A 1M1AB 3KXBD 5CPID 3MGSA 3MGQB 1H3OA 5GT0D 1Z2CB 5GT3A 2ZY4A 3W96C 4YS3B
chains in the Genus database with same CATH topology
2JSSA 5E5AC 3EPJA 4H9QA 4UPKA 2RIQA 5F99A 3MVDA 5CP6D 2Y2KA 3REJB 3UT9A 1P3FB 3W99C 3WKJC 2Y2LA 5AVBB 3AZNA 2W8SA 2J8PA 3AZEC 2RVQC 4DQYB 3KWQB 5B32D 4AWLC 2F8NK 5GT0B 3LJAB 4KGCD 1B67A 5G49A 3A1KA 4WU9D 5B40C 5AV5C 5B33C 5AV8B 1M19A 2AROB 3P5JB 3O62B 3KUYD 2HIOA 3W98D 3AFAC 5B0YC 5CPKC 2FJ7C 3AYWC 3MNNB 2PYOC 1P3IC 3TU4B 1P3KB 5GSUC 1TZYD 3VH5T 1R4VA 4DRBA 3AZJD 3WA9D 1F66C 3AZMA 2NQBC 3X1SD 1U35B 3IP4C 3WTPA 5AV6A 3KUYB 5DNMA 2L5AA 5B0ZC 3REKD 1P3GD 2JE5A 1KU5A 4X23A 4E45A 3UTBC 1M18A 1T3UA 3REIA 3WAAD 5B2JD 4H9QB 5JRGD 3B6GA 2F8NH 2F8NG 1P3LD 3AZJB 3AV1D 3RELA 5FUGA 5DNNC 3AZNB 1P3AC 1BH8A 3B6FA 3LZ0A 3MGPA 1P34C 1S32C 4ZUXD 3AN2C 3W97A 2CV5C 3AZGA 1P3MD 2NZDB 1AOIA 3AZIA 1P3BD 1P3PC 1KX3C 4UUZA 3C1BB 5CPJD 5B2JB 4H9RB 4NE5A 2ZY3A 4Z66B 1M19B 1P3LB 2XD5A 1EQZC 4YM6D 4J8WD 3A6NA 3X1UB 5B31A 3X1VC 4HGAB 1M1AA 3AZHB 3NQUA 3AZFC 5AV9C 4XZQC 5B2IB 1P3OB 4J8VC 4NE3A 3W96D 4YS3A 2YFWA 5E5AD 5AY8C 4QLCC 3AV2C 4KUDC 4LD9C 2JCHA 1P3FA 3W99D 3WKJD 5AV6B 5AVBA 3AZED 5B1LA 2RVQD 4Z5TB 3X1TC 4H9SC 5CPIA 4CAYA 3MGSC 3AZKD 5GT0A 3REIB 4WJ3C 3UTAC 5B40D 1ZLAC 5AV5D 5B33D 5E5AB 3C1CC 3RELB 4WU8C 1BH8B 5B24D 5F99C 3MVDC 5AV8A 4ZBJB 2AROA 5BT1C 3O62A 3AFAD 5B0YD 5CPKD 4AWLB 3AYWD 2HUEB 5B32A 2PYOD 3AZKB 1P3ID 4UUZB 2VQRA 3LZ1D 5C3IC 4KGCA 5GSUD 5B40B 5B33B 4WU9A 1F66D 3B0CW 5B24B 2NQBD 3NQUB 3LELD 3KUYA 5B0ZD 3AFAB 3AZLB 1WWSA 2HIOC 2Y2MA 3AYWB 2PYOB 3UTBD 1P3IB 3LZ1B 2YFWB 1TZYA 2IO5C 5GXQB 3AZJA 5DNND 1P3AD 3WA9A 2NQBB 3AZMC 5B1LB 3X1SA 3EPHA 3LELB 1P34D 3WTPC 3KXBB 5CPIB 5DNMC 4CAYB 3AN2D 4X23C 2CV5D 5AVCC 2NZDA 1KX3D 1P3PD 1BFMA 2F8ND 1F1EA 3C1BA 2ZY5A 5B2JA 3WAAA 4H9RA 3EPLA 5CP6B 4Z66A 1HTAA 1EQZD 1P3LA 4EO5B 1P3AB 3X1UA 3B6FC 3LZ0C 3MGPC 3AZFD 3FDDA 1B6WA 5B32B 3EPKA 5AV9D 4J8UC 3AZHA 4JJNC 1ID3C 4Z2MH 3AN2B 4ZUXA 2CV5B 4KGCB 3A1IA 4J8VD 1HQ3C 5B2IA 1P3OA 3W97C 4WU9B 1P3BA 3AZIC 1AOIC 3NQJB 5B1MC 4QLCD 3MGRC 5AY8D 4G92C 3AV2D 1JFIB 4LD9D 1EQZB 4YM6A 4J8WA 1KX5C 3W98B 2BYKA 3X1TD 5B31C 4Z5TA 3AZFB 1M1AC 3VH5A 3MGSD 3MGQC 3V9RA 3REHC 3UTAD 1TZYB 4R8PD 1ZLAD 3VH6A 1KX4C 3C1CD 3AV2B 3WA9B 5E5AA 4WU8D 3X1SB 1P3FC 3REJC 5BT1D 3REKB 5AVBC 1P3GB 3KWQC 3AZKA 3WAAB 3LJAC 3H0LC 5JRGB 2Y2IA 3UTAB 4R8PB 5B40A 5B33A 4J8XC 4WU8B 3AV1B 3KSYA 2Y2HA 3H0RC 5B24A 5AV8C 1N1JB 2AROC 2HIOD 3O62C 3AFAA 5B0YA 3AZLA 4ZUXB 4WNNB 3AYWA 1P3MB 2PYOA 1P3IA 1P3BB 4XUJC 4WZSB 3MNNC 5CPJB 3LZ1A 1Q9CA 3TU4C 1P3KC 4YM6B 4J8WB 2F2AC 5GXQA 1F66A 2BYKB 3AZMD 2NQBA 1U35C 3WTPD 3LELA 4KHAB 5DNMD 5B0ZA 3KXBA 3KUYC 5BS7A 2YFVB 3V9RB 5AVCD 4H9NB 3W96B 5GT3C 2FFFB 5CP6A 3W99B 3WKJB 3UT9C 1P3AA 4DRAA 3AZEB 3AZNC 3B6FD 3MGPD 3H0MC 2FJ7D 1A7WA 4J8UD 4JJND 5BO0B 1ID3D 4NE6A 3AN2A 5AVCB 2CV5A 1HQ3D 3W97D 3F6TA 1P3PA 5AV5B 3AZID 1KX3A 1AOID 2CWEA 5B1MD 3MGRD 3NQJA 2NZDC 3C1BC 1JFIA 3B0CT 4H9OA 1EQZA 4Z66C 2Y2NA 1M19C 1KX5D 3W98A 4E44A 5B0YB 3X1UC 5CPKB 5B31D 2FJ7B 4HGAC 3AZFA 4JJNB 3AZHC 3MGQD 3REHD 5GSUB 4J8VA 5B2IC 2ZM5A 1P3OC 1KX4D 3MGRB 4QLCA 3AV2A 1F66B 4WV4B 4H9PA 4G91C 5JA4A 3REJD 1P3FD 3B0DC 5B0ZB 1BH9B 5AV6C 2Y2QA 1S32D 5AVBD 2BYMB 3X1TA 3REKA 4H9SA 5BNXB 1P3GA 5CHLB 4Z5TC 3UTBB 3KWQD 1TAFB 1M18C 3REHB 3LJAD 2G5HC 5JRGA 3REIC 3UTAA 4R8PA 1KX4B 1ZLAA 3B6GC 4CSRB 3C1CA 4J8XD 5DNNB 4WU8A 3AV1A 3RELC 3X1VD 5BNVB 5AV8D 2AROD 1P34B 4ZBJC 1N1JA 1S32B 3O62D 5B31G 1PZRA 2DF4C 4XZQD 4Z2MG 4WNNA 1P3MA 1ULYA 1P3PB 2HUEC 4XUJD 3MNND 3AZGC 1KX3B 2F8NB 3AZKC 3TU4D 5CPJA 1P3KD 4KUDD 4H9OB 5KDMB 4J8XB 3A6NC 3X1VB 2DQNC 5B24C 1U35D 2Y2GA 5AV9B 3EG5B 4KHAA 2YFVA 4XZQB 3AZLC 2BG1A 4J8VB 4XUJB 3KFUG 4H9NA 5GT3D 3W96A 4QLCB 4KUDB 5AY8B 4LD9B 3LZ1C 4YS3C 3VH5W 4H9PB 5F99D 2LY8A 3MVDD 5JA4B 2ZY2A 3UT9D 3W99A 3WKJA 5GXQC 3AZND 3X1TB 3AZEA 3VH6W 2Y2PA 5B1LC 3AL0C 3VH6T 2Y2JA 3R45A 3LELC 1W2EA 3MGSB 3KXBC 5CPIC 5BO0A 1H3OB 5BS7C 5GT0C 5AVCA 5B32G 1ZLAB 5GT3B 2NZDD 5AV5A 3C1CB 3C1BD 4M6BA 5F99B 3MVDB 4Z66D 4NFTA 3UT9B 5CP6C 1M19D 2Y2OA 4EO5C 3X1UD 5CPKA 2FJ7A 3AZHD 4J8UA 4JJNA 5B32C 1ID3A 5C3IB 1HQ3A 5G49B 5GSUA 4KGCC 5B2ID 1P3OD 2G5IC 5B1MA 3MGRA 4WU9C 1KX5A 5AV6D 2HIOB 1BH9A 3W98C 2BYMA 4Z5TD 5BNXA 4X23D 3UTBA 1M18D 3MGQA 1TAFA 3REHA 3REID 3B6GD 2IO5B 1KX4A 1TZYC 3WTPE 4CSRA 5DNNA 3AZJC 3AZMB 3RELD 3WA9C 4G91B 5BNVA 3REJA 3B0DB 3WTPB 3X1SC 3LZ0D 3R45B 1P34A 1S32A 5DNMB 2UWXA 3REKC 4X23B 2XD1A 1P3GC 1M18B 3KWQA 3AZGD 2F8NA 3LJAA 3B6GB 3WAAC 5B2JC 5JRGC 4R8PC 5KDMA 4J8XA 1P3LC 5FUGB 3A6ND 3AV1C 3X1VA 3B6FB 3LZ0B 3MGPB 1M1AD 4J8UB 5AV9A 1ID3B 3AZLD 4XZQA 1HQ3B 4ZUXC 3W97B 3AZGB 1AOIB 3AZIB 4XUJA 3MNNA 1P3MC 5B1MB 1P3BC 4G92B 1WWIA 3TU4A 1P3KA 5AY8A 4YS3D 3B0BA 5CPJC 4KUDA 4LD9A 1KX5B 4YM6C 4J8WC 3A6NB 5GXQD 5B31B 5B1LD 1U35A 1M1AB 3KXBD 5CPID 3MGSA 3MGQB 1H3OA 5GT0D 1Z2CB 5GT3A 2ZY4A 3W96C 4YS3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JSS A;  5E5A C;  4H9Q A;  5F99 A;  3MVD A;  1P3F B;  5CP6 D;  3REJ B;  3UT9 A;  3W99 C;  3WKJ C;  5AVB B;  3AZN A;  3AZE C;  2RVQ C;  3KWQ B;  5B32 D;  4AWL C;  2F8N K;  5GT0 B;  3LJA B;  4KGC D;  1B67 A;  5G49 A;  4WU9 D;  5B40 C;  5AV5 C;  5B33 C;  5AV8 B;  1M19 A;  2ARO B;  3O62 B;  3KUY D;  2HIO A;  3W98 D;  3AFA C;  5B0Y C;  5CPK C;  2FJ7 C;  3AYW C;  3MNN B;  2PYO C;  1P3I C;  3TU4 B;  1P3K B;  5GSU C;  1TZY D;  3VH5 T;  1R4V A;  4DRB A;  3AZJ D;  3WA9 D;  1F66 C;  3AZM A;  2NQB C;  3X1S D;  1U35 B;  3WTP A;  5AV6 A;  3KUY B;  5DNM A;  2L5A A;  5B0Z C;  3REK D;  1P3G D;  1KU5 A;  4X23 A;  4E45 A;  3UTB C;  1M18 A;  3REI A;  3WAA D;  5B2J D;  4H9Q B;  5JRG D;  3B6G A;  2F8N H;  2F8N G;  1P3L D;  3AZJ B;  3AV1 D;  3REL A;  5FUG A;  5DNN C;  3AZN B;  1P3A C;  1BH8 A;  3B6F A;  3LZ0 A;  3MGP A;  1P34 C;  1S32 C;  4ZUX D;  3AN2 C;  3W97 A;  2CV5 C;  3AZG A;  1P3M D;  2NZD B;  1AOI A;  3AZI A;  1P3B D;  1P3P C;  1KX3 C;  4UUZ A;  3C1B B;  5CPJ D;  5B2J B;  4H9R B;  4NE5 A;  4Z66 B;  1M19 B;  1P3L B;  1EQZ C;  4YM6 D;  4J8W D;  3A6N A;  3X1U B;  5B31 A;  3X1V C;  4HGA B;  1M1A A;  3AZH B;  3NQU A;  3AZF C;  5AV9 C;  4XZQ C;  5B2I B;  1P3O B;  4J8V C;  4NE3 A;  3W96 D;  4YS3 A;  2YFW A;  5E5A D;  5AY8 C;  4QLC C;  3AV2 C;  4KUD C;  4LD9 C;  1P3F A;  3W99 D;  3WKJ D;  5AV6 B;  5AVB A;  3AZE D;  5B1L A;  2RVQ D;  4Z5T B;  3X1T C;  4H9S C;  5CPI A;  4CAY A;  3MGS C;  3AZK D;  5GT0 A;  3REI B;  3UTA C;  5B40 D;  1ZLA C;  5AV5 D;  5B33 D;  5E5A B;  3C1C C;  3REL B;  4WU8 C;  1BH8 B;  5F99 C;  5B24 D;  3MVD C;  5AV8 A;  4ZBJ B;  2ARO A;  5BT1 C;  3O62 A;  3AFA D;  5B0Y D;  5CPK D;  4AWL B;  3AYW D;  2HUE B;  5B32 A;  2PYO D;  3AZK B;  1P3I D;  4UUZ B;  3LZ1 D;  5C3I C;  4KGC A;  5GSU D;  5B40 B;  5B33 B;  4WU9 A;  1F66 D;  3B0C W;  5B24 B;  2NQB D;  3NQU B;  3LEL D;  3KUY A;  5B0Z D;  3AFA B;  3AZL B;  1WWS A;  2HIO C;  3AYW B;  2PYO B;  3UTB D;  1P3I B;  3LZ1 B;  2YFW B;  1TZY A;  2IO5 C;  5GXQ B;  3AZJ A;  5DNN D;  1P3A D;  3WA9 A;  2NQB B;  3AZM C;  5B1L B;  3X1S A;  3LEL B;  1P34 D;  3WTP C;  3KXB B;  5CPI B;  5DNM C;  4CAY B;  3AN2 D;  4X23 C;  2CV5 D;  5AVC C;  2NZD A;  1KX3 D;  1P3P D;  1BFM A;  2F8N D;  1F1E A;  3C1B A;  3WAA A;  5B2J A;  4H9R A;  5CP6 B;  4Z66 A;  1HTA A;  1EQZ D;  1P3L A;  4EO5 B;  1P3A B;  3X1U A;  3B6F C;  3LZ0 C;  3MGP C;  3AZF D;  5B32 B;  1B6W A;  3AZH A;  5AV9 D;  4J8U C;  4JJN C;  1ID3 C;  4Z2M H;  3AN2 B;  4ZUX A;  2CV5 B;  4KGC B;  4J8V D;  1HQ3 C;  5B2I A;  1P3O A;  3W97 C;  4WU9 B;  1P3B A;  3AZI C;  1AOI C;  3NQJ B;  5B1M C;  4QLC D;  3MGR C;  5AY8 D;  4G92 C;  3AV2 D;  1JFI B;  4LD9 D;  1EQZ B;  4YM6 A;  4J8W A;  1KX5 C;  3W98 B;  2BYK A;  3X1T D;  5B31 C;  4Z5T A;  3AZF B;  1M1A C;  3VH5 A;  3MGS D;  3MGQ C;  3V9R A;  3REH C;  3UTA D;  1TZY B;  4R8P D;  1ZLA D;  3VH6 A;  1KX4 C;  3C1C D;  3AV2 B;  3WA9 B;  5E5A A;  4WU8 D;  3X1S B;  1P3F C;  3REJ C;  5BT1 D;  3REK B;  5AVB C;  1P3G B;  3KWQ C;  3AZK A;  3WAA B;  3LJA C;  5JRG B;  3UTA B;  4R8P B;  5B40 A;  5B33 A;  4J8X C;  4WU8 B;  3AV1 B;  3KSY A;  5B24 A;  5AV8 C;  1N1J B;  2ARO C;  2HIO D;  3O62 C;  3AFA A;  5B0Y A;  3AZL A;  4ZUX B;  4WNN B;  3AYW A;  1P3M B;  2PYO A;  1P3I A;  1P3B B;  4XUJ C;  4WZS B;  3MNN C;  5CPJ B;  3LZ1 A;  1Q9C A;  3TU4 C;  1P3K C;  4YM6 B;  4J8W B;  5GXQ A;  1F66 A;  2BYK B;  3AZM D;  2NQB A;  1U35 C;  3WTP D;  3LEL A;  4KHA B;  5DNM D;  5B0Z A;  3KXB A;  3KUY C;  5BS7 A;  2YFV B;  3V9R B;  5AVC D;  4H9N B;  3W96 B;  5GT3 C;  5CP6 A;  3W99 B;  3WKJ B;  3UT9 C;  1P3A A;  4DRA A;  3AZE B;  3AZN C;  3B6F D;  3MGP D;  2FJ7 D;  1A7W A;  4J8U D;  4JJN D;  5BO0 B;  1ID3 D;  4NE6 A;  3AN2 A;  5AVC B;  2CV5 A;  1HQ3 D;  3W97 D;  1KX3 A;  1P3P A;  5AV5 B;  3AZI D;  1AOI D;  2NZD C;  2CWE A;  5B1M D;  3MGR D;  3NQJ A;  3C1B C;  1JFI A;  3B0C T;  4H9O A;  1EQZ A;  4Z66 C;  1M19 C;  1KX5 D;  3W98 A;  4E44 A;  5B0Y B;  3X1U C;  5CPK B;  5B31 D;  2FJ7 B;  4HGA C;  3AZF A;  4JJN B;  3AZH C;  3MGQ D;  3REH D;  5GSU B;  4J8V A;  5B2I C;  1P3O C;  1KX4 D;  3MGR B;  4QLC A;  3AV2 A;  1F66 B;  4WV4 B;  4H9P A;  4G91 C;  5JA4 A;  3REJ D;  1P3F D;  3B0D C;  5B0Z B;  1BH9 B;  5AV6 C;  1S32 D;  5AVB D;  2BYM B;  3X1T A;  3REK A;  4H9S A;  5BNX B;  1P3G A;  5CHL B;  4Z5T C;  3UTB B;  3KWQ D;  1TAF B;  1M18 C;  3REH B;  3LJA D;  5JRG A;  3REI C;  3UTA A;  4R8P A;  1KX4 B;  1ZLA A;  3B6G C;  4CSR B;  3C1C A;  4J8X D;  5DNN B;  4WU8 A;  3AV1 A;  3REL C;  3X1V D;  5BNV B;  5AV8 D;  2ARO D;  1P34 B;  4ZBJ C;  1N1J A;  1S32 B;  3O62 D;  5B31 G;  4XZQ D;  4Z2M G;  4WNN A;  1P3M A;  1ULY A;  1P3P B;  2HUE C;  4XUJ D;  3MNN D;  3AZG C;  1KX3 B;  2F8N B;  3AZK C;  3TU4 D;  5CPJ A;  1P3K D;  4KUD D;  4H9O B;  5KDM B;  4J8X B;  3A6N C;  3X1V B;  5B24 C;  1U35 D;  5AV9 B;  4KHA A;  2YFV A;  4XZQ B;  3AZL C;  4J8V B;  4XUJ B;  4H9N A;  5GT3 D;  3W96 A;  4QLC B;  4KUD B;  5AY8 B;  4LD9 B;  3LZ1 C;  4YS3 C;  3VH5 W;  4H9P B;  5F99 D;  2LY8 A;  3MVD D;  5JA4 B;  3UT9 D;  3W99 A;  3WKJ A;  5GXQ C;  3AZN D;  3X1T B;  3AZE A;  3VH6 W;  5B1L C;  3VH6 T;  3R45 A;  3LEL C;  3MGS B;  3KXB C;  5CPI C;  5BO0 A;  1H3O B;  5BS7 C;  5GT0 C;  5AVC A;  5B32 G;  1ZLA B;  5GT3 B;  2NZD D;  5AV5 A;  3C1C B;  3C1B D;  4M6B A;  5F99 B;  3MVD B;  4Z66 D;  4NFT A;  3UT9 B;  5CP6 C;  1M19 D;  4EO5 C;  3X1U D;  5CPK A;  2FJ7 A;  3AZH D;  4J8U A;  4JJN A;  5B32 C;  1ID3 A;  5C3I B;  1HQ3 A;  5G49 B;  5GSU A;  4KGC C;  5B2I D;  1P3O D;  5B1M A;  3MGR A;  4WU9 C;  1KX5 A;  5AV6 D;  2HIO B;  1BH9 A;  3W98 C;  2BYM A;  4Z5T D;  5BNX A;  4X23 D;  3UTB A;  1M18 D;  3MGQ A;  1TAF A;  3REH A;  3REI D;  3B6G D;  2IO5 B;  1KX4 A;  1TZY C;  3WTP E;  4CSR A;  5DNN A;  3AZJ C;  3AZM B;  3REL D;  3WA9 C;  4G91 B;  5BNV A;  3REJ A;  3B0D B;  3WTP B;  3X1S C;  3LZ0 D;  3R45 B;  1P34 A;  1S32 A;  5DNM B;  3REK C;  4X23 B;  1P3G C;  1M18 B;  3KWQ A;  3AZG D;  2F8N A;  3LJA A;  3B6G B;  3WAA C;  5B2J C;  5JRG C;  4R8P C;  5KDM A;  4J8X A;  1P3L C;  5FUG B;  3A6N D;  3AV1 C;  3X1V A;  3B6F B;  3LZ0 B;  3MGP B;  1M1A D;  4J8U B;  5AV9 A;  1ID3 B;  3AZL D;  4XZQ A;  1HQ3 B;  4ZUX C;  3W97 B;  3AZG B;  1AOI B;  3AZI B;  4XUJ A;  3MNN A;  1P3M C;  5B1M B;  1P3B C;  4G92 B;  1WWI A;  3TU4 A;  1P3K A;  5AY8 A;  4YS3 D;  3B0B A;  5CPJ C;  4KUD A;  4LD9 A;  1KX5 B;  4YM6 C;  4J8W C;  3A6N B;  5GXQ D;  5B31 B;  5B1L D;  1U35 A;  1M1A B;  3KXB D;  5CPI D;  3MGS A;  3MGQ B;  1H3O A;  5GT0 D;  5GT3 A;  3W96 C;  4YS3 B; 
#chains in the Genus database with same CATH topology
 2JSS A;  5E5A C;  3EPJ A;  4H9Q A;  4UPK A;  2RIQ A;  5F99 A;  3MVD A;  5CP6 D;  2Y2K A;  3REJ B;  3UT9 A;  1P3F B;  3W99 C;  3WKJ C;  2Y2L A;  5AVB B;  3AZN A;  2W8S A;  2J8P A;  3AZE C;  2RVQ C;  4DQY B;  3KWQ B;  5B32 D;  4AWL C;  2F8N K;  5GT0 B;  3LJA B;  4KGC D;  1B67 A;  5G49 A;  3A1K A;  4WU9 D;  5B40 C;  5AV5 C;  5B33 C;  5AV8 B;  1M19 A;  2ARO B;  3P5J B;  3O62 B;  3KUY D;  2HIO A;  3W98 D;  3AFA C;  5B0Y C;  5CPK C;  2FJ7 C;  3AYW C;  3MNN B;  2PYO C;  1P3I C;  3TU4 B;  1P3K B;  5GSU C;  1TZY D;  3VH5 T;  1R4V A;  4DRB A;  3AZJ D;  3WA9 D;  1F66 C;  3AZM A;  2NQB C;  3X1S D;  1U35 B;  3IP4 C;  3WTP A;  5AV6 A;  3KUY B;  5DNM A;  2L5A A;  5B0Z C;  3REK D;  1P3G D;  2JE5 A;  1KU5 A;  4X23 A;  4E45 A;  3UTB C;  1M18 A;  1T3U A;  3REI A;  3WAA D;  5B2J D;  4H9Q B;  5JRG D;  3B6G A;  2F8N H;  2F8N G;  1P3L D;  3AZJ B;  3AV1 D;  3REL A;  5FUG A;  5DNN C;  3AZN B;  1P3A C;  1BH8 A;  3B6F A;  3LZ0 A;  3MGP A;  1P34 C;  1S32 C;  4ZUX D;  3AN2 C;  3W97 A;  2CV5 C;  3AZG A;  1P3M D;  2NZD B;  1AOI A;  3AZI A;  1P3B D;  1P3P C;  1KX3 C;  4UUZ A;  3C1B B;  5CPJ D;  5B2J B;  4H9R B;  4NE5 A;  2ZY3 A;  4Z66 B;  1M19 B;  1P3L B;  2XD5 A;  1EQZ C;  4YM6 D;  4J8W D;  3A6N A;  3X1U B;  5B31 A;  3X1V C;  4HGA B;  1M1A A;  3AZH B;  3NQU A;  3AZF C;  5AV9 C;  4XZQ C;  5B2I B;  1P3O B;  4J8V C;  4NE3 A;  3W96 D;  4YS3 A;  2YFW A;  5E5A D;  5AY8 C;  4QLC C;  3AV2 C;  4KUD C;  4LD9 C;  2JCH A;  1P3F A;  3W99 D;  3WKJ D;  5AV6 B;  5AVB A;  3AZE D;  5B1L A;  2RVQ D;  4Z5T B;  3X1T C;  4H9S C;  5CPI A;  4CAY A;  3MGS C;  3AZK D;  5GT0 A;  3REI B;  4WJ3 C;  3UTA C;  5B40 D;  1ZLA C;  5AV5 D;  5B33 D;  5E5A B;  3C1C C;  3REL B;  4WU8 C;  1BH8 B;  5B24 D;  5F99 C;  3MVD C;  5AV8 A;  4ZBJ B;  2ARO A;  5BT1 C;  3O62 A;  3AFA D;  5B0Y D;  5CPK D;  4AWL B;  3AYW D;  2HUE B;  5B32 A;  2PYO D;  3AZK B;  1P3I D;  4UUZ B;  2VQR A;  3LZ1 D;  5C3I C;  4KGC A;  5GSU D;  5B40 B;  5B33 B;  4WU9 A;  1F66 D;  3B0C W;  5B24 B;  2NQB D;  3NQU B;  3LEL D;  3KUY A;  5B0Z D;  3AFA B;  3AZL B;  1WWS A;  2HIO C;  2Y2M A;  3AYW B;  2PYO B;  3UTB D;  1P3I B;  3LZ1 B;  2YFW B;  1TZY A;  2IO5 C;  5GXQ B;  3AZJ A;  5DNN D;  1P3A D;  3WA9 A;  2NQB B;  3AZM C;  5B1L B;  3X1S A;  3EPH A;  3LEL B;  1P34 D;  3WTP C;  3KXB B;  5CPI B;  5DNM C;  4CAY B;  3AN2 D;  4X23 C;  2CV5 D;  5AVC C;  2NZD A;  1KX3 D;  1P3P D;  1BFM A;  2F8N D;  1F1E A;  3C1B A;  2ZY5 A;  5B2J A;  3WAA A;  4H9R A;  3EPL A;  5CP6 B;  4Z66 A;  1HTA A;  1EQZ D;  1P3L A;  4EO5 B;  1P3A B;  3X1U A;  3B6F C;  3LZ0 C;  3MGP C;  3AZF D;  3FDD A;  1B6W A;  5B32 B;  3EPK A;  5AV9 D;  4J8U C;  3AZH A;  4JJN C;  1ID3 C;  4Z2M H;  3AN2 B;  4ZUX A;  2CV5 B;  4KGC B;  3A1I A;  4J8V D;  1HQ3 C;  5B2I A;  1P3O A;  3W97 C;  4WU9 B;  1P3B A;  3AZI C;  1AOI C;  3NQJ B;  5B1M C;  4QLC D;  3MGR C;  5AY8 D;  4G92 C;  3AV2 D;  1JFI B;  4LD9 D;  1EQZ B;  4YM6 A;  4J8W A;  1KX5 C;  3W98 B;  2BYK A;  3X1T D;  5B31 C;  4Z5T A;  3AZF B;  1M1A C;  3VH5 A;  3MGS D;  3MGQ C;  3V9R A;  3REH C;  3UTA D;  1TZY B;  4R8P D;  1ZLA D;  3VH6 A;  1KX4 C;  3C1C D;  3AV2 B;  3WA9 B;  5E5A A;  4WU8 D;  3X1S B;  1P3F C;  3REJ C;  5BT1 D;  3REK B;  5AVB C;  1P3G B;  3KWQ C;  3AZK A;  3WAA B;  3LJA C;  3H0L C;  5JRG B;  2Y2I A;  3UTA B;  4R8P B;  5B40 A;  5B33 A;  4J8X C;  4WU8 B;  3AV1 B;  3KSY A;  2Y2H A;  3H0R C;  5B24 A;  5AV8 C;  1N1J B;  2ARO C;  2HIO D;  3O62 C;  3AFA A;  5B0Y A;  3AZL A;  4ZUX B;  4WNN B;  3AYW A;  1P3M B;  2PYO A;  1P3I A;  1P3B B;  4XUJ C;  4WZS B;  3MNN C;  5CPJ B;  3LZ1 A;  1Q9C A;  3TU4 C;  1P3K C;  4YM6 B;  4J8W B;  2F2A C;  5GXQ A;  1F66 A;  2BYK B;  3AZM D;  2NQB A;  1U35 C;  3WTP D;  3LEL A;  4KHA B;  5DNM D;  5B0Z A;  3KXB A;  3KUY C;  5BS7 A;  2YFV B;  3V9R B;  5AVC D;  4H9N B;  3W96 B;  5GT3 C;  2FFF B;  5CP6 A;  3W99 B;  3WKJ B;  3UT9 C;  1P3A A;  4DRA A;  3AZE B;  3AZN C;  3B6F D;  3MGP D;  3H0M C;  2FJ7 D;  1A7W A;  4J8U D;  4JJN D;  5BO0 B;  1ID3 D;  4NE6 A;  3AN2 A;  5AVC B;  2CV5 A;  1HQ3 D;  3W97 D;  3F6T A;  1P3P A;  5AV5 B;  3AZI D;  1KX3 A;  1AOI D;  2CWE A;  5B1M D;  3MGR D;  3NQJ A;  2NZD C;  3C1B C;  1JFI A;  3B0C T;  4H9O A;  1EQZ A;  4Z66 C;  2Y2N A;  1M19 C;  1KX5 D;  3W98 A;  4E44 A;  5B0Y B;  3X1U C;  5CPK B;  5B31 D;  2FJ7 B;  4HGA C;  3AZF A;  4JJN B;  3AZH C;  3MGQ D;  3REH D;  5GSU B;  4J8V A;  5B2I C;  2ZM5 A;  1P3O C;  1KX4 D;  3MGR B;  4QLC A;  3AV2 A;  1F66 B;  4WV4 B;  4H9P A;  4G91 C;  5JA4 A;  3REJ D;  1P3F D;  3B0D C;  5B0Z B;  1BH9 B;  5AV6 C;  2Y2Q A;  1S32 D;  5AVB D;  2BYM B;  3X1T A;  3REK A;  4H9S A;  5BNX B;  1P3G A;  5CHL B;  4Z5T C;  3UTB B;  3KWQ D;  1TAF B;  1M18 C;  3REH B;  3LJA D;  2G5H C;  5JRG A;  3REI C;  3UTA A;  4R8P A;  1KX4 B;  1ZLA A;  3B6G C;  4CSR B;  3C1C A;  4J8X D;  5DNN B;  4WU8 A;  3AV1 A;  3REL C;  3X1V D;  5BNV B;  5AV8 D;  2ARO D;  1P34 B;  4ZBJ C;  1N1J A;  1S32 B;  3O62 D;  5B31 G;  1PZR A;  2DF4 C;  4XZQ D;  4Z2M G;  4WNN A;  1P3M A;  1ULY A;  1P3P B;  2HUE C;  4XUJ D;  3MNN D;  3AZG C;  1KX3 B;  2F8N B;  3AZK C;  3TU4 D;  5CPJ A;  1P3K D;  4KUD D;  4H9O B;  5KDM B;  4J8X B;  3A6N C;  3X1V B;  2DQN C;  5B24 C;  1U35 D;  2Y2G A;  5AV9 B;  3EG5 B;  4KHA A;  2YFV A;  4XZQ B;  3AZL C;  2BG1 A;  4J8V B;  4XUJ B;  3KFU G;  4H9N A;  5GT3 D;  3W96 A;  4QLC B;  4KUD B;  5AY8 B;  4LD9 B;  3LZ1 C;  4YS3 C;  3VH5 W;  4H9P B;  5F99 D;  2LY8 A;  3MVD D;  5JA4 B;  2ZY2 A;  3UT9 D;  3W99 A;  3WKJ A;  5GXQ C;  3AZN D;  3X1T B;  3AZE A;  3VH6 W;  2Y2P A;  5B1L C;  3AL0 C;  3VH6 T;  2Y2J A;  3R45 A;  3LEL C;  1W2E A;  3MGS B;  3KXB C;  5CPI C;  5BO0 A;  1H3O B;  5BS7 C;  5GT0 C;  5AVC A;  5B32 G;  1ZLA B;  5GT3 B;  2NZD D;  5AV5 A;  3C1C B;  3C1B D;  4M6B A;  5F99 B;  3MVD B;  4Z66 D;  4NFT A;  3UT9 B;  5CP6 C;  1M19 D;  2Y2O A;  4EO5 C;  3X1U D;  5CPK A;  2FJ7 A;  3AZH D;  4J8U A;  4JJN A;  5B32 C;  1ID3 A;  5C3I B;  1HQ3 A;  5G49 B;  5GSU A;  4KGC C;  5B2I D;  1P3O D;  2G5I C;  5B1M A;  3MGR A;  4WU9 C;  1KX5 A;  5AV6 D;  2HIO B;  1BH9 A;  3W98 C;  2BYM A;  4Z5T D;  5BNX A;  4X23 D;  3UTB A;  1M18 D;  3MGQ A;  1TAF A;  3REH A;  3REI D;  3B6G D;  2IO5 B;  1KX4 A;  1TZY C;  3WTP E;  4CSR A;  5DNN A;  3AZJ C;  3AZM B;  3REL D;  3WA9 C;  4G91 B;  5BNV A;  3REJ A;  3B0D B;  3WTP B;  3X1S C;  3LZ0 D;  3R45 B;  1P34 A;  1S32 A;  5DNM B;  2UWX A;  3REK C;  4X23 B;  2XD1 A;  1P3G C;  1M18 B;  3KWQ A;  3AZG D;  2F8N A;  3LJA A;  3B6G B;  3WAA C;  5B2J C;  5JRG C;  4R8P C;  5KDM A;  4J8X A;  1P3L C;  5FUG B;  3A6N D;  3AV1 C;  3X1V A;  3B6F B;  3LZ0 B;  3MGP B;  1M1A D;  4J8U B;  5AV9 A;  1ID3 B;  3AZL D;  4XZQ A;  1HQ3 B;  4ZUX C;  3W97 B;  3AZG B;  1AOI B;  3AZI B;  4XUJ A;  3MNN A;  1P3M C;  5B1M B;  1P3B C;  4G92 B;  1WWI A;  3TU4 A;  1P3K A;  5AY8 A;  4YS3 D;  3B0B A;  5CPJ C;  4KUD A;  4LD9 A;  1KX5 B;  4YM6 C;  4J8W C;  3A6N B;  5GXQ D;  5B31 B;  5B1L D;  1U35 A;  1M1A B;  3KXB D;  5CPI D;  3MGS A;  3MGQ B;  1H3O A;  5GT0 D;  1Z2C B;  5GT3 A;  2ZY4 A;  3W96 C;  4YS3 B; 
#chains in the Genus database with same CATH homology
 2JSS A;  5E5A C;  3EPJ A;  4H9Q A;  4UPK A;  2RIQ A;  5F99 A;  3MVD A;  5CP6 D;  2Y2K A;  3REJ B;  3UT9 A;  1P3F B;  3W99 C;  3WKJ C;  2Y2L A;  5AVB B;  3AZN A;  2W8S A;  2J8P A;  3AZE C;  2RVQ C;  4DQY B;  3KWQ B;  5B32 D;  4AWL C;  2F8N K;  5GT0 B;  3LJA B;  4KGC D;  1B67 A;  5G49 A;  3A1K A;  4WU9 D;  5B40 C;  5AV5 C;  5B33 C;  5AV8 B;  1M19 A;  2ARO B;  3P5J B;  3O62 B;  3KUY D;  2HIO A;  3W98 D;  3AFA C;  5B0Y C;  5CPK C;  2FJ7 C;  3AYW C;  3MNN B;  2PYO C;  1P3I C;  3TU4 B;  1P3K B;  5GSU C;  1TZY D;  3VH5 T;  1R4V A;  4DRB A;  3AZJ D;  3WA9 D;  1F66 C;  3AZM A;  2NQB C;  3X1S D;  1U35 B;  3IP4 C;  3WTP A;  5AV6 A;  3KUY B;  5DNM A;  2L5A A;  5B0Z C;  3REK D;  1P3G D;  2JE5 A;  1KU5 A;  4X23 A;  4E45 A;  3UTB C;  1M18 A;  1T3U A;  3REI A;  3WAA D;  5B2J D;  4H9Q B;  5JRG D;  3B6G A;  2F8N H;  2F8N G;  1P3L D;  3AZJ B;  3AV1 D;  3REL A;  5FUG A;  5DNN C;  3AZN B;  1P3A C;  1BH8 A;  3B6F A;  3LZ0 A;  3MGP A;  1P34 C;  1S32 C;  4ZUX D;  3AN2 C;  3W97 A;  2CV5 C;  3AZG A;  1P3M D;  2NZD B;  1AOI A;  3AZI A;  1P3B D;  1P3P C;  1KX3 C;  4UUZ A;  3C1B B;  5CPJ D;  5B2J B;  4H9R B;  4NE5 A;  2ZY3 A;  4Z66 B;  1M19 B;  1P3L B;  2XD5 A;  1EQZ C;  4YM6 D;  4J8W D;  3A6N A;  3X1U B;  5B31 A;  3X1V C;  4HGA B;  1M1A A;  3AZH B;  3NQU A;  3AZF C;  5AV9 C;  4XZQ C;  5B2I B;  1P3O B;  4J8V C;  4NE3 A;  3W96 D;  4YS3 A;  2YFW A;  5E5A D;  5AY8 C;  4QLC C;  3AV2 C;  4KUD C;  4LD9 C;  2JCH A;  1P3F A;  3W99 D;  3WKJ D;  5AV6 B;  5AVB A;  3AZE D;  5B1L A;  2RVQ D;  4Z5T B;  3X1T C;  4H9S C;  5CPI A;  4CAY A;  3MGS C;  3AZK D;  5GT0 A;  3REI B;  4WJ3 C;  3UTA C;  5B40 D;  1ZLA C;  5AV5 D;  5B33 D;  5E5A B;  3C1C C;  3REL B;  4WU8 C;  1BH8 B;  5B24 D;  5F99 C;  3MVD C;  5AV8 A;  4ZBJ B;  2ARO A;  5BT1 C;  3O62 A;  3AFA D;  5B0Y D;  5CPK D;  4AWL B;  3AYW D;  2HUE B;  5B32 A;  2PYO D;  3AZK B;  1P3I D;  4UUZ B;  2VQR A;  3LZ1 D;  5C3I C;  4KGC A;  5GSU D;  5B40 B;  5B33 B;  4WU9 A;  1F66 D;  3B0C W;  5B24 B;  2NQB D;  3NQU B;  3LEL D;  3KUY A;  5B0Z D;  3AFA B;  3AZL B;  1WWS A;  2HIO C;  2Y2M A;  3AYW B;  2PYO B;  3UTB D;  1P3I B;  3LZ1 B;  2YFW B;  1TZY A;  2IO5 C;  5GXQ B;  3AZJ A;  5DNN D;  1P3A D;  3WA9 A;  2NQB B;  3AZM C;  5B1L B;  3X1S A;  3EPH A;  3LEL B;  1P34 D;  3WTP C;  3KXB B;  5CPI B;  5DNM C;  4CAY B;  3AN2 D;  4X23 C;  2CV5 D;  5AVC C;  2NZD A;  1KX3 D;  1P3P D;  1BFM A;  2F8N D;  1F1E A;  3C1B A;  2ZY5 A;  5B2J A;  3WAA A;  4H9R A;  3EPL A;  5CP6 B;  4Z66 A;  1HTA A;  1EQZ D;  1P3L A;  4EO5 B;  1P3A B;  3X1U A;  3B6F C;  3LZ0 C;  3MGP C;  3AZF D;  3FDD A;  1B6W A;  5B32 B;  3EPK A;  5AV9 D;  4J8U C;  3AZH A;  4JJN C;  1ID3 C;  4Z2M H;  3AN2 B;  4ZUX A;  2CV5 B;  4KGC B;  3A1I A;  4J8V D;  1HQ3 C;  5B2I A;  1P3O A;  3W97 C;  4WU9 B;  1P3B A;  3AZI C;  1AOI C;  3NQJ B;  5B1M C;  4QLC D;  3MGR C;  5AY8 D;  4G92 C;  3AV2 D;  1JFI B;  4LD9 D;  1EQZ B;  4YM6 A;  4J8W A;  1KX5 C;  3W98 B;  2BYK A;  3X1T D;  5B31 C;  4Z5T A;  3AZF B;  1M1A C;  3VH5 A;  3MGS D;  3MGQ C;  3V9R A;  3REH C;  3UTA D;  1TZY B;  4R8P D;  1ZLA D;  3VH6 A;  1KX4 C;  3C1C D;  3AV2 B;  3WA9 B;  5E5A A;  4WU8 D;  3X1S B;  1P3F C;  3REJ C;  5BT1 D;  3REK B;  5AVB C;  1P3G B;  3KWQ C;  3AZK A;  3WAA B;  3LJA C;  3H0L C;  5JRG B;  2Y2I A;  3UTA B;  4R8P B;  5B40 A;  5B33 A;  4J8X C;  4WU8 B;  3AV1 B;  3KSY A;  2Y2H A;  3H0R C;  5B24 A;  5AV8 C;  1N1J B;  2ARO C;  2HIO D;  3O62 C;  3AFA A;  5B0Y A;  3AZL A;  4ZUX B;  4WNN B;  3AYW A;  1P3M B;  2PYO A;  1P3I A;  1P3B B;  4XUJ C;  4WZS B;  3MNN C;  5CPJ B;  3LZ1 A;  1Q9C A;  3TU4 C;  1P3K C;  4YM6 B;  4J8W B;  2F2A C;  5GXQ A;  1F66 A;  2BYK B;  3AZM D;  2NQB A;  1U35 C;  3WTP D;  3LEL A;  4KHA B;  5DNM D;  5B0Z A;  3KXB A;  3KUY C;  5BS7 A;  2YFV B;  3V9R B;  5AVC D;  4H9N B;  3W96 B;  5GT3 C;  2FFF B;  5CP6 A;  3W99 B;  3WKJ B;  3UT9 C;  1P3A A;  4DRA A;  3AZE B;  3AZN C;  3B6F D;  3MGP D;  3H0M C;  2FJ7 D;  1A7W A;  4J8U D;  4JJN D;  5BO0 B;  1ID3 D;  4NE6 A;  3AN2 A;  5AVC B;  2CV5 A;  1HQ3 D;  3W97 D;  3F6T A;  1P3P A;  5AV5 B;  3AZI D;  1KX3 A;  1AOI D;  2CWE A;  5B1M D;  3MGR D;  3NQJ A;  2NZD C;  3C1B C;  1JFI A;  3B0C T;  4H9O A;  1EQZ A;  4Z66 C;  2Y2N A;  1M19 C;  1KX5 D;  3W98 A;  4E44 A;  5B0Y B;  3X1U C;  5CPK B;  5B31 D;  2FJ7 B;  4HGA C;  3AZF A;  4JJN B;  3AZH C;  3MGQ D;  3REH D;  5GSU B;  4J8V A;  5B2I C;  2ZM5 A;  1P3O C;  1KX4 D;  3MGR B;  4QLC A;  3AV2 A;  1F66 B;  4WV4 B;  4H9P A;  4G91 C;  5JA4 A;  3REJ D;  1P3F D;  3B0D C;  5B0Z B;  1BH9 B;  5AV6 C;  2Y2Q A;  1S32 D;  5AVB D;  2BYM B;  3X1T A;  3REK A;  4H9S A;  5BNX B;  1P3G A;  5CHL B;  4Z5T C;  3UTB B;  3KWQ D;  1TAF B;  1M18 C;  3REH B;  3LJA D;  2G5H C;  5JRG A;  3REI C;  3UTA A;  4R8P A;  1KX4 B;  1ZLA A;  3B6G C;  4CSR B;  3C1C A;  4J8X D;  5DNN B;  4WU8 A;  3AV1 A;  3REL C;  3X1V D;  5BNV B;  5AV8 D;  2ARO D;  1P34 B;  4ZBJ C;  1N1J A;  1S32 B;  3O62 D;  5B31 G;  1PZR A;  2DF4 C;  4XZQ D;  4Z2M G;  4WNN A;  1P3M A;  1ULY A;  1P3P B;  2HUE C;  4XUJ D;  3MNN D;  3AZG C;  1KX3 B;  2F8N B;  3AZK C;  3TU4 D;  5CPJ A;  1P3K D;  4KUD D;  4H9O B;  5KDM B;  4J8X B;  3A6N C;  3X1V B;  2DQN C;  5B24 C;  1U35 D;  2Y2G A;  5AV9 B;  3EG5 B;  4KHA A;  2YFV A;  4XZQ B;  3AZL C;  2BG1 A;  4J8V B;  4XUJ B;  3KFU G;  4H9N A;  5GT3 D;  3W96 A;  4QLC B;  4KUD B;  5AY8 B;  4LD9 B;  3LZ1 C;  4YS3 C;  3VH5 W;  4H9P B;  5F99 D;  2LY8 A;  3MVD D;  5JA4 B;  2ZY2 A;  3UT9 D;  3W99 A;  3WKJ A;  5GXQ C;  3AZN D;  3X1T B;  3AZE A;  3VH6 W;  2Y2P A;  5B1L C;  3AL0 C;  3VH6 T;  2Y2J A;  3R45 A;  3LEL C;  1W2E A;  3MGS B;  3KXB C;  5CPI C;  5BO0 A;  1H3O B;  5BS7 C;  5GT0 C;  5AVC A;  5B32 G;  1ZLA B;  5GT3 B;  2NZD D;  5AV5 A;  3C1C B;  3C1B D;  4M6B A;  5F99 B;  3MVD B;  4Z66 D;  4NFT A;  3UT9 B;  5CP6 C;  1M19 D;  2Y2O A;  4EO5 C;  3X1U D;  5CPK A;  2FJ7 A;  3AZH D;  4J8U A;  4JJN A;  5B32 C;  1ID3 A;  5C3I B;  1HQ3 A;  5G49 B;  5GSU A;  4KGC C;  5B2I D;  1P3O D;  2G5I C;  5B1M A;  3MGR A;  4WU9 C;  1KX5 A;  5AV6 D;  2HIO B;  1BH9 A;  3W98 C;  2BYM A;  4Z5T D;  5BNX A;  4X23 D;  3UTB A;  1M18 D;  3MGQ A;  1TAF A;  3REH A;  3REI D;  3B6G D;  2IO5 B;  1KX4 A;  1TZY C;  3WTP E;  4CSR A;  5DNN A;  3AZJ C;  3AZM B;  3REL D;  3WA9 C;  4G91 B;  5BNV A;  3REJ A;  3B0D B;  3WTP B;  3X1S C;  3LZ0 D;  3R45 B;  1P34 A;  1S32 A;  5DNM B;  2UWX A;  3REK C;  4X23 B;  2XD1 A;  1P3G C;  1M18 B;  3KWQ A;  3AZG D;  2F8N A;  3LJA A;  3B6G B;  3WAA C;  5B2J C;  5JRG C;  4R8P C;  5KDM A;  4J8X A;  1P3L C;  5FUG B;  3A6N D;  3AV1 C;  3X1V A;  3B6F B;  3LZ0 B;  3MGP B;  1M1A D;  4J8U B;  5AV9 A;  1ID3 B;  3AZL D;  4XZQ A;  1HQ3 B;  4ZUX C;  3W97 B;  3AZG B;  1AOI B;  3AZI B;  4XUJ A;  3MNN A;  1P3M C;  5B1M B;  1P3B C;  4G92 B;  1WWI A;  3TU4 A;  1P3K A;  5AY8 A;  4YS3 D;  3B0B A;  5CPJ C;  4KUD A;  4LD9 A;  1KX5 B;  4YM6 C;  4J8W C;  3A6N B;  5GXQ D;  5B31 B;  5B1L D;  1U35 A;  1M1A B;  3KXB D;  5CPI D;  3MGS A;  3MGQ B;  1H3O A;  5GT0 D;  1Z2C B;  5GT3 A;  2ZY4 A;  3W96 C;  4YS3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...