3AZJD

Crystal structure of human nucleosome core particle containing h4k44q mutation
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
96
structure length
96
Chain Sequence
b'RKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
molecule keywords Histone H3.1
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 37
structure length 96
sequence length 96
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3azjD00
3R45A 3MGQB 3WAAD 1P3BC 2CWEA 4J8XB 3LZ0B 3UT9C 1KX5C 5B33C 4R8PD 3KWQB 3AN2C 4H9RA 3REJC 1P3IA 5B0YC 1KX4A 3WTPE 1P3PA 2HUEC 1P3GB 1P3ID 3AZFB 4QLCC 1KX4D 4H9NB 3AZHA 3X1UB 1P3PD 3MGQC 3B6FB 3WKJB 4UUZA 3AV2B 5B1LD 2IO5B 3REHC 3WTPC 3VH5T 1P3AA 3KWQC 3AZHD 2CV5C 3X1TB 5KDMB 3C1CC 5AV6C 4KUDC 5G49B 3A6NC 5AV9B 3LELA 1P3FD 1P3AD 3C1BB 1P3BA 5CPIC 3MVDB 3UT9A 1HQ3C 3LZ1B 5E5AC 5B33A 1KX5A 4NFTA 3AN2A 3NQUA 3LELD 5B0YA 3KSYA 3VH6W 2YFVB 1P3BD 2F8NK 5FUGA 3UT9D 1KX5D 5B33D 3VH6T 3REJD 3AN2D 4Z5TC 4QLCA 5B0YD 5B24B 5AV9C 5CPJC 1P34B 4WNNA 3MGQA 1H3OB 4ZBJB 4H9OA 3REHA 1R4VA 3WTPA 4QLCD 1M19B 5JA4B 3KWQA 4JJNB 2NQBC 2CV5A 3MGQD 4H9QB 5AV6A 4KUDA 3KXBB 3AFAB 3A6NA 4KGCC 3REHD 3WTPD 3KWQD 3W97C 3LJAB 2CV5D 5CP6C 4X23B 2PYOB 3C1CD 5CPIA 1TZYC 5B24C 5AV6D 4KUDD 4WZSB 4H9NA 5E5AA 4HGAC 3A6ND 1M18C 3B6GB 3AV2A 4CSRB 3WAAB 5CPID 3W96C 4LD9C 1HQ3D 4R8PB 5E5AD 4J8WC 1S32C 1P3MC 3R45B 1P3LC 5G49A 4Z5TA 4DRBA 3WA9C 5AV9A 5CPJA 4WU9B 3LJAC 2PYOC 3C1BA 4H9SC 4Z5TD 5GT3B 1KX4B 3MNNB 5AV9D 5CPJD 2BYMB 3B6GC 5B32G 5B1LB 4ZUXC 1P3OC 3X1SB 2NZDC 4YS3C 3W97A 5DNNB 3AZHB 2NQBD 5CP6A 5C3IB 1TZYA 5B24A 4AWLB 4UUZB 1M18A 1ULYA 4WU9C 1P3FB 4KGCD 5GSUB 3W97D 5CP6D 5GT3C 1TZYD 5B24D 3MNNC 5AV8B 3W96A 1F66C 4LD9A 4J8WA 1S32A 1M18D 3LELB 1P3MA 4H9QA 2JSSA 1P3LA 3WA9A 3O62C 3AFAA 3X1SC 1P3BB 1BFMA 2HIOC 3W96D 5DNNC 4LD9D 4J8WD 3LJAA 1S32D 2PYOA 5C3IC 3NQUB 3REJB 3AN2B 1P3MD 1AOIB 4H9SA 5B0YB 1P3LD 3WA9D 1N1JA 3B0BA 2LY8A 5FUGB 5GSUC 3B6GA 2HUEB 5CPKB 3LJAD 2PYOD 3WAAA 4ZUXA 2AROC 5AV8C 4QLCB 4R8PA 4YS3A 4WNNB 3B6GD 3AZNC 4ZUXD 1P3OD 5B31C 4H9OB 4XUJC 3REHB 3WTPB 2NZDD 4WU9A 4YS3D 2CV5B 4XZQB 3C1CB 1AOIC 3NQJB 5AV6B 5GT3A 4G92B 4KUDB 3MNNA 3A6NB 2BYMA 4WU9D 5CPKC 5B2IC 5BT1C 4NE3A 5CHLB 5B1LA 3X1SA 5CPIB 4Z66C 3UTBC 5GT3D 1ZLAB 1HQ3B 3MNND 5E5AB 5DNNA 1F66D 3VH5W 3VH5A 2BYKB 3O62D 3X1SD 1WWIA 1BH8A 1P3FA 2HIOD 4CAYA 5GSUA 5DNND 2F8NA 4XZQC 4G92C 3AZEC 2AROA 4Z5TB 5AV8A 3AV1B 5CPJB 5GSUD 2F8ND 3AZNA 4H9PB 4XUJA 5B31A 1ZLAC 5B2JC 2AROD 5AV8D 3B0CW 3REJA 2NQBB 1KX3C 1AOIA 3AZND 1U35C 3VH6A 3B0CT 3MGSC 4XUJD 5B31D 4KGCB 4E44A 5CPKA 5B2IA 3W97B 5CP6B 1AOID 1TZYB 4Z66A 3UTBA 3AV1C 4HGAB 3AZJC 1M18B 5CPKD 4YM6B 5B2ID 5BT1D 1F1EA 4Z66D 3UTBD 3W96B 4LD9B 4J8WB 1S32B 4XZQA 3C1CA 1P3MB 1EQZB 3NQJA 1P3LB 3AZEA 3WA9B 3W99B 5AVBC 4XZQD 1M1AB 1ZLAA 5B2JA 1HQ3A 5AV5C 1N1JB 3AZED 4YM6C 2BYKA 1U35A 4ZUXB 1P3OB 1A7WA 5BS7C 3MGSA 2NZDB 1ZLAD 5B2JD 4YS3B 1EQZC 1KX3D 4DRAA 3AV1A 1U35D 3W99C 5B32B 3MGSD 3AZJA 1TAFA 3AZIC 4NE5A 1M1AC 4H9PA 1F66B 3AV1D 2NQBA 3AZJD 3O62B 4KGCA 5B0ZC 2HIOB 1KU5A 5BNXA 5AVBA 5AV5A 5B32C 1BH8B 4CAYB 3REKB 2RVQC 4YM6A 2F8NB 4Z2MG 5AVBD 5AY8C 2AROB 2L5AA 5GXQB 2YFWB 5AV5D 1JFIA 1EQZA 4YM6D 4J8VC 1ID3C 3AZNB 3W99A 5B31B 4XUJB 4WV4B 3AZIA 1M1AA 1EQZD 5BO0A 3V9RA 3W99D 3REKC 5B2IB 3AZID 1BH9B 1P3OA 1M1AD 4EO5C 2NZDA 4Z66B 5GXQC 5B0ZA 3UTBB 3B0DB 3W98B 3UTAC 5B32A 3AZLC 3KUYB 5B0ZD 1P3KC 5AY8A 5DNMC 3AZEB 2F8NH 1F66A 5GT0C 5B32D 2RVQD 4J8VA 1ID3A 3O62A 3REIB 2HIOA 5AY8D 5B40C 5B2JB 3X1VB 5JRGC 3B0DC 2FJ7C 5AVCC 3AZKB 1KX3B 3W98C 4J8VD 1ID3D 1U35B 3KUYC 3MGSB 3REKA 3RELC 5GXQA 1HTAA 2YFWA 3AZJB 1TAFB 3REKD 3AYWC 3UTAA 4G91C 3X1VC 3REIC 3AZLA 5GXQD 3AZMC 3AZKC 1P3KA 4KHAA 5DNMA 3UTAD 5GT0A 4J8XC 3AZLD 3LZ0C 5BNXB 1Q9CA 1BH9A 5AVBB 1P3KD 5BNVA 5B40A 5DNMD 5AV5B 5GT0D 5JRGA 3W98A 2FJ7A 5AVCA 1P3GC 3AZFC 3MGRB 3KUYA 4E45A 5B40D 5F99B 5JRGD 1WWSA 3X1UC 1JFIB 5AVCD 3RELA 2FJ7D 3B6FC 3W98D 3WKJC 3AV2C 5B1MB 2IO5C 3KUYD 3AYWA 3AZIB 3X1TC 3REIA 3RELD 3X1VA 5BO0B 3V9RB 3AZMA 3AZKA 1KX3A 3MGPB 3AYWD 3C1BC 3MGRC 3REID 3X1VD 4J8XA 5B0ZB 5F99C 3LZ0A 3MVDC 3LZ1C 4J8UB 3AZMD 3AZKD 5B1MC 3AZGB 4WU8B 1B67A 4J8XD 3LZ0D 1P3GA 3TU4B 3AZFA 5AY8B 3X1UA 1P34C 3B6FA 3WKJA 3MGPC 4J8VB 1ID3B 1P3GD 4ZBJC 3AZFD 4J8UC 1M19C 4JJNC 3X1UD 3X1TA 5KDMA 3B6FD 3WKJD 3AZGC 4WU8C 4M6BA 3AV2D 3KXBC 3AFAC 4X23C 3X1TD 4H9RB 3TU4C 5BS7A 4EO5B 3MGRA 1P3IB 5F99A 3MVDA 3LZ1A 1P3PB 3UTAB 3WAAC 5B1MA 3C1BD 3MGRD 2YFVA 3AZLB 5F99D 3MVDD 4R8PC 3LZ1D 1P3KB 4KHAB 5DNMB 5GT0B 5B1MD 1P34A 1P3AB 3MGPA 1H3OA 1P3IC 5BNVB 5B40B 1KX4C 4J8UA 5JA4A 1M19A 5JRGB 4JJNA 4NE6A 2FJ7B 5AVCB 1P34D 4Z2MH 1P3PC 3MGPD 3AZGA 4WU8A 5B1LC 3KXBA 2F8NG 3UT9B 4J8UD 1M19D 5B33B 3AZHC 1KX5B 4JJND 4X23A 3TU4A 3RELB 4AWLC 3AZGD 4WU8D 3KXBD 3AFAD 1P3FC 1P3AC 1B6WA 3AYWB 5B31G 4G91B 4CSRA 4X23D 3TU4D 3AZMB 3LELC
chains in the Genus database with same CATH superfamily
3R45A 3H0MC 3MGQB 3WAAD 1P3BC 2CWEA 4J8XB 3LZ0B 3UT9C 1KX5C 5B33C 3EG5B 4R8PD 3FDDA 3KWQB 3AN2C 4H9RA 3REJC 1P3IA 5B0YC 1KX4A 3WTPE 1P3PA 2HUEC 1P3GB 1P3ID 3AZFB 4QLCC 1KX4D 4H9NB 3A1KA 3AZHA 3X1UB 2Y2LA 1P3PD 3MGQC 3B6FB 3WKJB 4UUZA 3AV2B 5B1LD 2IO5B 3REHC 3WTPC 3VH5T 1P3AA 3KWQC 3AZHD 2CV5C 2Y2HA 3X1TB 5KDMB 3C1CC 5AV6C 4KUDC 5G49B 3A6NC 5AV9B 3LELA 1P3FD 1P3AD 2Y2MA 3C1BB 1P3BA 5CPIC 3MVDB 3UT9A 1HQ3C 3LZ1B 5E5AC 5B33A 1KX5A 4NFTA 3AN2A 3NQUA 3LELD 5B0YA 3KSYA 3VH6W 2YFVB 1P3BD 2F8NK 5FUGA 3UT9D 1KX5D 5B33D 3VH6T 3REJD 3AN2D 4Z5TC 4QLCA 5B0YD 5B24B 5AV9C 5CPJC 1P34B 4WNNA 3MGQA 2DQNC 1H3OB 4ZBJB 2G5HC 4H9OA 3REHA 1R4VA 3WTPA 4QLCD 1M19B 5JA4B 3KWQA 4JJNB 2NQBC 2CV5A 3MGQD 4H9QB 5AV6A 4KUDA 3KXBB 3AFAB 3A6NA 4KGCC 3REHD 3WTPD 3KWQD 3W97C 3LJAB 2CV5D 5CP6C 4X23B 2PYOB 3C1CD 5CPIA 1TZYC 5B24C 5AV6D 4KUDD 4WZSB 4H9NA 5E5AA 4HGAC 3A6ND 1M18C 3B6GB 3AV2A 4CSRB 3WAAB 5CPID 3W96C 4LD9C 1HQ3D 4R8PB 5E5AD 4J8WC 1S32C 1P3MC 3R45B 1P3LC 5G49A 4Z5TA 4DRBA 3WA9C 3AL0C 5AV9A 5CPJA 4WU9B 3F6TA 3LJAC 2PYOC 3C1BA 4H9SC 4Z5TD 5GT3B 1KX4B 3MNNB 5AV9D 5CPJD 2BYMB 3B6GC 5B32G 5B1LB 2JCHA 4ZUXC 1P3OC 3X1SB 3EPHA 2NZDC 4YS3C 3W97A 5DNNB 3AZHB 2NQBD 5CP6A 5C3IB 3H0LC 1TZYA 5B24A 2Y2IA 4AWLB 4UUZB 2Y2JA 1M18A 1ULYA 4WU9C 1P3FB 4KGCD 5GSUB 3W97D 5CP6D 5GT3C 1TZYD 5B24D 3MNNC 5AV8B 3W96A 1F66C 4LD9A 4J8WA 1S32A 1M18D 2Y2QA 3LELB 1P3MA 4H9QA 2JSSA 1P3LA 3WA9A 3O62C 3AFAA 3X1SC 1P3BB 1BFMA 2HIOC 3W96D 5DNNC 4LD9D 4J8WD 3LJAA 1S32D 2PYOA 5C3IC 3NQUB 3REJB 3AN2B 1P3MD 1AOIB 4H9SA 5B0YB 1P3LD 3WA9D 1N1JA 3B0BA 2LY8A 3IP4C 5FUGB 5GSUC 3B6GA 2HUEB 5CPKB 3LJAD 2PYOD 3WAAA 4ZUXA 2JE5A 2AROC 5AV8C 4QLCB 4R8PA 4YS3A 4WNNB 3B6GD 3AZNC 4ZUXD 1P3OD 5B31C 4H9OB 4XUJC 3REHB 3WTPB 2NZDD 4WU9A 4YS3D 2CV5B 4XZQB 3C1CB 1AOIC 3NQJB 5AV6B 5GT3A 2XD1A 4G92B 3MNNA 4KUDB 3A6NB 2BYMA 2BG1A 4WU9D 5CPKC 5B2IC 5BT1C 4NE3A 5CHLB 5B1LA 3X1SA 5CPIB 4Z66C 3UTBC 5GT3D 1ZLAB 1HQ3B 1PZRA 2VQRA 5E5AB 5DNNA 3MNND 1F66D 3VH5W 3VH5A 2BYKB 3O62D 3X1SD 1WWIA 1BH8A 1P3FA 2HIOD 4CAYA 5GSUA 5DNND 2F8NA 4XZQC 4G92C 3AZEC 2AROA 4Z5TB 5AV8A 3AV1B 5CPJB 5GSUD 2F8ND 3AZNA 4H9PB 4XUJA 5B31A 1ZLAC 5B2JC 2AROD 5AV8D 3B0CW 3REJA 2NQBB 1KX3C 1AOIA 3AZND 1U35C 3VH6A 3B0CT 3MGSC 4XUJD 5B31D 4KGCB 4E44A 5CPKA 5B2IA 3W97B 5CP6B 1AOID 1TZYB 4Z66A 3UTBA 3AV1C 3P5JB 4HGAB 3AZJC 1M18B 5CPKD 4YM6B 5B2ID 5BT1D 3EPLA 1F1EA 4Z66D 3UTBD 3W96B 4LD9B 4J8WB 1S32B 4XZQA 1Z2CB 3C1CA 1P3MB 1EQZB 3NQJA 1P3LB 3AZEA 3WA9B 3EPJA 3W99B 5AVBC 4XZQD 1M1AB 1ZLAA 5B2JA 1HQ3A 5AV5C 1N1JB 3AZED 4YM6C 2BYKA 1U35A 4ZUXB 1P3OB 1A7WA 5BS7C 3MGSA 2NZDB 1ZLAD 5B2JD 2Y2NA 4YS3B 1EQZC 1T3UA 1KX3D 4DRAA 3AV1A 1U35D 3W99C 5B32B 3MGSD 3AZJA 1TAFA 3AZIC 4NE5A 1M1AC 4H9PA 1F66B 3AV1D 2NQBA 3AZJD 3O62B 4KGCA 5B0ZC 2HIOB 1KU5A 5BNXA 5AVBA 5AV5A 5B32C 1BH8B 2ZY5A 4CAYB 3REKB 2RVQC 4YM6A 2F8NB 2ZY4A 2DF4C 2RIQA 4UPKA 4Z2MG 5AVBD 5AY8C 2AROB 2L5AA 5GXQB 2YFWB 5AV5D 3KFUG 1JFIA 1EQZA 4YM6D 4J8VC 1ID3C 4DQYB 3AZNB 4WJ3C 3W99A 5B31B 4XUJB 4WV4B 3AZIA 2F2AC 1M1AA 1EQZD 5BO0A 3V9RA 2UWXA 3W99D 3REKC 5B2IB 2Y2KA 3AZID 1BH9B 1P3OA 1M1AD 4EO5C 2FFFB 2NZDA 4Z66B 5B0ZA 5GXQC 3UTBB 3B0DB 3W98B 3UTAC 3EPKA 5B32A 3AZLC 2G5IC 3KUYB 5B0ZD 2Y2OA 1P3KC 5AY8A 5DNMC 3AZEB 2F8NH 1F66A 5GT0C 5B32D 2RVQD 4J8VA 1ID3A 3O62A 3REIB 2HIOA 5AY8D 5B40C 5B2JB 3X1VB 5JRGC 3B0DC 2FJ7C 5AVCC 3AZKB 1KX3B 3W98C 4J8VD 2ZY3A 1ID3D 1U35B 3KUYC 3MGSB 3REKA 3RELC 5GXQA 1HTAA 2YFWA 3AZJB 1TAFB 3REKD 3AYWC 3UTAA 2J8PA 4G91C 3X1VC 3REIC 3AZLA 5GXQD 3AZMC 3AZKC 1P3KA 4KHAA 5DNMA 3UTAD 5GT0A 2ZY2A 4J8XC 3AZLD 3LZ0C 5BNXB 1Q9CA 1BH9A 5AVBB 1P3KD 5BNVA 5B40A 5DNMD 5AV5B 5GT0D 5JRGA 3W98A 2FJ7A 5AVCA 2Y2GA 1P3GC 3AZFC 3MGRB 3KUYA 4E45A 5B40D 5F99B 5JRGD 1WWSA 3X1UC 1JFIB 5AVCD 3RELA 2FJ7D 3B6FC 3W98D 3WKJC 3AV2C 5B1MB 2ZM5A 2IO5C 3KUYD 3AYWA 3AZIB 3X1TC 3REIA 3RELD 3X1VA 5BO0B 3V9RB 3AZMA 3AZKA 1KX3A 3MGPB 3AYWD 3C1BC 3MGRC 3REID 3X1VD 4J8XA 5B0ZB 5F99C 3LZ0A 3MVDC 3LZ1C 4J8UB 3AZMD 2XD5A 3AZKD 5B1MC 3AZGB 4WU8B 1B67A 4J8XD 3LZ0D 1P3GA 3TU4B 3AZFA 5AY8B 3X1UA 1P34C 3B6FA 3WKJA 3MGPC 4J8VB 1ID3B 1P3GD 4ZBJC 3AZFD 4J8UC 1M19C 4JJNC 3X1UD 3X1TA 5KDMA 3B6FD 3WKJD 3H0RC 3AZGC 4WU8C 4M6BA 3AV2D 3KXBC 3AFAC 4X23C 3X1TD 4H9RB 3TU4C 5BS7A 4EO5B 3MGRA 1P3IB 5F99A 3MVDA 3LZ1A 1P3PB 3UTAB 3WAAC 5B1MA 3C1BD 3MGRD 2YFVA 3AZLB 5F99D 3MVDD 4R8PC 3LZ1D 1P3KB 4KHAB 5DNMB 2W8SA 5GT0B 5B1MD 1P34A 1P3AB 3MGPA 1H3OA 1P3IC 1W2EA 5BNVB 5B40B 1KX4C 4J8UA 5JA4A 1M19A 5JRGB 4JJNA 4NE6A 2FJ7B 5AVCB 1P34D 4Z2MH 1P3PC 3MGPD 3AZGA 4WU8A 5B1LC 3KXBA 2F8NG 3A1IA 3UT9B 4J8UD 1M19D 5B33B 3AZHC 1KX5B 4JJND 4X23A 3TU4A 3RELB 4AWLC 3AZGD 4WU8D 3KXBD 3AFAD 1P3FC 1P3AC 1B6WA 3AYWB 5B31G 4G91B 4CSRA 4X23D 3TU4D 2Y2PA 3AZMB 3LELC
chains in the Genus database with same CATH topology
3R45A 3H0MC 3MGQB 3WAAD 1P3BC 2CWEA 4J8XB 3LZ0B 3UT9C 1KX5C 5B33C 3EG5B 4R8PD 3FDDA 3KWQB 3AN2C 4H9RA 3REJC 1P3IA 5B0YC 1KX4A 3WTPE 1P3PA 2HUEC 1P3GB 1P3ID 3AZFB 4QLCC 1KX4D 4H9NB 3A1KA 3AZHA 3X1UB 2Y2LA 1P3PD 3MGQC 3B6FB 3WKJB 4UUZA 3AV2B 5B1LD 2IO5B 3REHC 3WTPC 3VH5T 1P3AA 3KWQC 3AZHD 2CV5C 2Y2HA 3X1TB 5KDMB 3C1CC 5AV6C 4KUDC 5G49B 3A6NC 5AV9B 3LELA 1P3FD 1P3AD 2Y2MA 3C1BB 1P3BA 5CPIC 3MVDB 3UT9A 1HQ3C 3LZ1B 5E5AC 5B33A 1KX5A 4NFTA 3AN2A 3NQUA 3LELD 5B0YA 3KSYA 3VH6W 2YFVB 1P3BD 2F8NK 5FUGA 3UT9D 1KX5D 5B33D 3VH6T 3REJD 3AN2D 4Z5TC 4QLCA 5B0YD 5B24B 5AV9C 5CPJC 1P34B 4WNNA 3MGQA 2DQNC 1H3OB 4ZBJB 2G5HC 4H9OA 3REHA 1R4VA 3WTPA 4QLCD 1M19B 5JA4B 3KWQA 4JJNB 2NQBC 2CV5A 3MGQD 4H9QB 5AV6A 4KUDA 3KXBB 3AFAB 3A6NA 4KGCC 3REHD 3WTPD 3KWQD 3W97C 3LJAB 2CV5D 5CP6C 4X23B 2PYOB 3C1CD 5CPIA 1TZYC 5B24C 5AV6D 4KUDD 4WZSB 4H9NA 5E5AA 4HGAC 3A6ND 1M18C 3B6GB 3AV2A 4CSRB 3WAAB 5CPID 3W96C 4LD9C 1HQ3D 4R8PB 5E5AD 4J8WC 1S32C 1P3MC 3R45B 1P3LC 5G49A 4Z5TA 4DRBA 3WA9C 3AL0C 5AV9A 5CPJA 4WU9B 3F6TA 3LJAC 2PYOC 3C1BA 4H9SC 4Z5TD 5GT3B 1KX4B 3MNNB 5AV9D 5CPJD 2BYMB 3B6GC 5B32G 5B1LB 2JCHA 4ZUXC 1P3OC 3X1SB 3EPHA 2NZDC 4YS3C 3W97A 5DNNB 3AZHB 2NQBD 5CP6A 5C3IB 3H0LC 1TZYA 5B24A 2Y2IA 4AWLB 4UUZB 2Y2JA 1M18A 1ULYA 4WU9C 1P3FB 4KGCD 5GSUB 3W97D 5CP6D 5GT3C 1TZYD 5B24D 3MNNC 5AV8B 3W96A 1F66C 4LD9A 4J8WA 1S32A 1M18D 2Y2QA 3LELB 1P3MA 4H9QA 2JSSA 1P3LA 3WA9A 3O62C 3AFAA 3X1SC 1P3BB 1BFMA 2HIOC 3W96D 5DNNC 4LD9D 4J8WD 3LJAA 1S32D 2PYOA 5C3IC 3NQUB 3REJB 3AN2B 1P3MD 1AOIB 4H9SA 5B0YB 1P3LD 3WA9D 1N1JA 3B0BA 2LY8A 3IP4C 5FUGB 5GSUC 3B6GA 2HUEB 5CPKB 3LJAD 2PYOD 3WAAA 4ZUXA 2JE5A 2AROC 5AV8C 4QLCB 4R8PA 4YS3A 4WNNB 3B6GD 3AZNC 4ZUXD 1P3OD 5B31C 4H9OB 4XUJC 3REHB 3WTPB 2NZDD 4WU9A 4YS3D 2CV5B 4XZQB 3C1CB 1AOIC 3NQJB 5AV6B 5GT3A 2XD1A 4G92B 3MNNA 4KUDB 3A6NB 2BYMA 2BG1A 4WU9D 5CPKC 5B2IC 5BT1C 4NE3A 5CHLB 5B1LA 3X1SA 5CPIB 4Z66C 3UTBC 5GT3D 1ZLAB 1HQ3B 1PZRA 2VQRA 5E5AB 5DNNA 3MNND 1F66D 3VH5W 3VH5A 2BYKB 3O62D 3X1SD 1WWIA 1BH8A 1P3FA 2HIOD 4CAYA 5GSUA 5DNND 2F8NA 4XZQC 4G92C 3AZEC 2AROA 4Z5TB 5AV8A 3AV1B 5CPJB 5GSUD 2F8ND 3AZNA 4H9PB 4XUJA 5B31A 1ZLAC 5B2JC 2AROD 5AV8D 3B0CW 3REJA 2NQBB 1KX3C 1AOIA 3AZND 1U35C 3VH6A 3B0CT 3MGSC 4XUJD 5B31D 4KGCB 4E44A 5CPKA 5B2IA 3W97B 5CP6B 1AOID 1TZYB 4Z66A 3UTBA 3AV1C 3P5JB 4HGAB 3AZJC 1M18B 5CPKD 4YM6B 5B2ID 5BT1D 3EPLA 1F1EA 4Z66D 3UTBD 3W96B 4LD9B 4J8WB 1S32B 4XZQA 1Z2CB 3C1CA 1P3MB 1EQZB 3NQJA 1P3LB 3AZEA 3WA9B 3EPJA 3W99B 5AVBC 4XZQD 1M1AB 1ZLAA 5B2JA 1HQ3A 5AV5C 1N1JB 3AZED 4YM6C 2BYKA 1U35A 4ZUXB 1P3OB 1A7WA 5BS7C 3MGSA 2NZDB 1ZLAD 5B2JD 2Y2NA 4YS3B 1EQZC 1T3UA 1KX3D 4DRAA 3AV1A 1U35D 3W99C 5B32B 3MGSD 3AZJA 1TAFA 3AZIC 4NE5A 1M1AC 4H9PA 1F66B 3AV1D 2NQBA 3AZJD 3O62B 4KGCA 5B0ZC 2HIOB 1KU5A 5BNXA 5AVBA 5AV5A 5B32C 1BH8B 2ZY5A 4CAYB 3REKB 2RVQC 4YM6A 2F8NB 2ZY4A 2DF4C 2RIQA 4UPKA 4Z2MG 5AVBD 5AY8C 2AROB 2L5AA 5GXQB 2YFWB 5AV5D 3KFUG 1JFIA 1EQZA 4YM6D 4J8VC 1ID3C 4DQYB 3AZNB 4WJ3C 3W99A 5B31B 4XUJB 4WV4B 3AZIA 2F2AC 1M1AA 1EQZD 5BO0A 3V9RA 2UWXA 3W99D 3REKC 5B2IB 2Y2KA 3AZID 1BH9B 1P3OA 1M1AD 4EO5C 2FFFB 2NZDA 4Z66B 5B0ZA 5GXQC 3UTBB 3B0DB 3W98B 3UTAC 3EPKA 5B32A 3AZLC 2G5IC 3KUYB 5B0ZD 2Y2OA 1P3KC 5AY8A 5DNMC 3AZEB 2F8NH 1F66A 5GT0C 5B32D 2RVQD 4J8VA 1ID3A 3O62A 3REIB 2HIOA 5AY8D 5B40C 5B2JB 3X1VB 5JRGC 3B0DC 2FJ7C 5AVCC 3AZKB 1KX3B 3W98C 4J8VD 2ZY3A 1ID3D 1U35B 3KUYC 3MGSB 3REKA 3RELC 5GXQA 1HTAA 2YFWA 3AZJB 1TAFB 3REKD 3AYWC 3UTAA 2J8PA 4G91C 3X1VC 3REIC 3AZLA 5GXQD 3AZMC 3AZKC 1P3KA 4KHAA 5DNMA 3UTAD 5GT0A 2ZY2A 4J8XC 3AZLD 3LZ0C 5BNXB 1Q9CA 1BH9A 5AVBB 1P3KD 5BNVA 5B40A 5DNMD 5AV5B 5GT0D 5JRGA 3W98A 2FJ7A 5AVCA 2Y2GA 1P3GC 3AZFC 3MGRB 3KUYA 4E45A 5B40D 5F99B 5JRGD 1WWSA 3X1UC 1JFIB 5AVCD 3RELA 2FJ7D 3B6FC 3W98D 3WKJC 3AV2C 5B1MB 2ZM5A 2IO5C 3KUYD 3AYWA 3AZIB 3X1TC 3REIA 3RELD 3X1VA 5BO0B 3V9RB 3AZMA 3AZKA 1KX3A 3MGPB 3AYWD 3C1BC 3MGRC 3REID 3X1VD 4J8XA 5B0ZB 5F99C 3LZ0A 3MVDC 3LZ1C 4J8UB 3AZMD 2XD5A 3AZKD 5B1MC 3AZGB 4WU8B 1B67A 4J8XD 3LZ0D 1P3GA 3TU4B 3AZFA 5AY8B 3X1UA 1P34C 3B6FA 3WKJA 3MGPC 4J8VB 1ID3B 1P3GD 4ZBJC 3AZFD 4J8UC 1M19C 4JJNC 3X1UD 3X1TA 5KDMA 3B6FD 3WKJD 3H0RC 3AZGC 4WU8C 4M6BA 3AV2D 3KXBC 3AFAC 4X23C 3X1TD 4H9RB 3TU4C 5BS7A 4EO5B 3MGRA 1P3IB 5F99A 3MVDA 3LZ1A 1P3PB 3UTAB 3WAAC 5B1MA 3C1BD 3MGRD 2YFVA 3AZLB 5F99D 3MVDD 4R8PC 3LZ1D 1P3KB 4KHAB 5DNMB 2W8SA 5GT0B 5B1MD 1P34A 1P3AB 3MGPA 1H3OA 1P3IC 1W2EA 5BNVB 5B40B 1KX4C 4J8UA 5JA4A 1M19A 5JRGB 4JJNA 4NE6A 2FJ7B 5AVCB 1P34D 4Z2MH 1P3PC 3MGPD 3AZGA 4WU8A 5B1LC 3KXBA 2F8NG 3A1IA 3UT9B 4J8UD 1M19D 5B33B 3AZHC 1KX5B 4JJND 4X23A 3TU4A 3RELB 4AWLC 3AZGD 4WU8D 3KXBD 3AFAD 1P3FC 1P3AC 1B6WA 3AYWB 5B31G 4G91B 4CSRA 4X23D 3TU4D 2Y2PA 3AZMB 3LELC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R45 A;  3MGQ B;  3WAA D;  1P3B C;  2CWE A;  4J8X B;  3LZ0 B;  3UT9 C;  1KX5 C;  5B33 C;  4R8P D;  3KWQ B;  3AN2 C;  4H9R A;  3REJ C;  1P3I A;  5B0Y C;  1KX4 A;  3WTP E;  1P3P A;  2HUE C;  1P3G B;  1P3I D;  3AZF B;  4QLC C;  1KX4 D;  4H9N B;  3AZH A;  3X1U B;  1P3P D;  3MGQ C;  3B6F B;  3WKJ B;  4UUZ A;  3AV2 B;  5B1L D;  2IO5 B;  3REH C;  3WTP C;  3VH5 T;  1P3A A;  3KWQ C;  3AZH D;  2CV5 C;  3X1T B;  5KDM B;  3C1C C;  5AV6 C;  4KUD C;  5G49 B;  3A6N C;  5AV9 B;  3LEL A;  1P3F D;  1P3A D;  3C1B B;  1P3B A;  5CPI C;  3MVD B;  3UT9 A;  1HQ3 C;  3LZ1 B;  5E5A C;  5B33 A;  1KX5 A;  4NFT A;  3AN2 A;  3NQU A;  3LEL D;  5B0Y A;  3KSY A;  3VH6 W;  2YFV B;  1P3B D;  2F8N K;  5FUG A;  3UT9 D;  1KX5 D;  5B33 D;  3VH6 T;  3REJ D;  3AN2 D;  4Z5T C;  4QLC A;  5B0Y D;  5B24 B;  5AV9 C;  5CPJ C;  1P34 B;  4WNN A;  3MGQ A;  1H3O B;  4ZBJ B;  4H9O A;  3REH A;  1R4V A;  3WTP A;  4QLC D;  1M19 B;  5JA4 B;  3KWQ A;  4JJN B;  2NQB C;  2CV5 A;  3MGQ D;  4H9Q B;  5AV6 A;  4KUD A;  3KXB B;  3AFA B;  3A6N A;  4KGC C;  3REH D;  3WTP D;  3KWQ D;  3W97 C;  3LJA B;  2CV5 D;  5CP6 C;  4X23 B;  2PYO B;  3C1C D;  5CPI A;  1TZY C;  5B24 C;  5AV6 D;  4KUD D;  4WZS B;  4H9N A;  5E5A A;  4HGA C;  3A6N D;  1M18 C;  3B6G B;  3AV2 A;  4CSR B;  3WAA B;  5CPI D;  3W96 C;  4LD9 C;  1HQ3 D;  4R8P B;  5E5A D;  4J8W C;  1S32 C;  1P3M C;  3R45 B;  1P3L C;  5G49 A;  4Z5T A;  4DRB A;  3WA9 C;  5AV9 A;  5CPJ A;  4WU9 B;  3LJA C;  2PYO C;  3C1B A;  4H9S C;  4Z5T D;  5GT3 B;  1KX4 B;  3MNN B;  5AV9 D;  5CPJ D;  2BYM B;  3B6G C;  5B32 G;  5B1L B;  4ZUX C;  1P3O C;  3X1S B;  2NZD C;  4YS3 C;  3W97 A;  5DNN B;  3AZH B;  2NQB D;  5CP6 A;  5C3I B;  1TZY A;  5B24 A;  4AWL B;  4UUZ B;  1M18 A;  1ULY A;  4WU9 C;  1P3F B;  4KGC D;  5GSU B;  3W97 D;  5CP6 D;  5GT3 C;  1TZY D;  5B24 D;  3MNN C;  5AV8 B;  3W96 A;  1F66 C;  4LD9 A;  4J8W A;  1S32 A;  1M18 D;  3LEL B;  1P3M A;  4H9Q A;  2JSS A;  1P3L A;  3WA9 A;  3O62 C;  3AFA A;  3X1S C;  1P3B B;  1BFM A;  2HIO C;  3W96 D;  5DNN C;  4LD9 D;  4J8W D;  3LJA A;  1S32 D;  2PYO A;  5C3I C;  3NQU B;  3REJ B;  3AN2 B;  1P3M D;  1AOI B;  4H9S A;  5B0Y B;  1P3L D;  3WA9 D;  1N1J A;  3B0B A;  2LY8 A;  5FUG B;  5GSU C;  3B6G A;  2HUE B;  5CPK B;  3LJA D;  2PYO D;  3WAA A;  4ZUX A;  2ARO C;  5AV8 C;  4QLC B;  4R8P A;  4YS3 A;  4WNN B;  3B6G D;  3AZN C;  4ZUX D;  1P3O D;  5B31 C;  4H9O B;  4XUJ C;  3REH B;  3WTP B;  2NZD D;  4WU9 A;  4YS3 D;  2CV5 B;  4XZQ B;  3C1C B;  1AOI C;  3NQJ B;  5AV6 B;  5GT3 A;  4G92 B;  4KUD B;  3MNN A;  3A6N B;  2BYM A;  4WU9 D;  5CPK C;  5B2I C;  5BT1 C;  4NE3 A;  5CHL B;  5B1L A;  3X1S A;  5CPI B;  4Z66 C;  3UTB C;  5GT3 D;  1ZLA B;  1HQ3 B;  3MNN D;  5E5A B;  5DNN A;  1F66 D;  3VH5 W;  3VH5 A;  2BYK B;  3O62 D;  3X1S D;  1WWI A;  1BH8 A;  1P3F A;  2HIO D;  4CAY A;  5GSU A;  5DNN D;  2F8N A;  4XZQ C;  4G92 C;  3AZE C;  2ARO A;  4Z5T B;  5AV8 A;  3AV1 B;  5CPJ B;  5GSU D;  2F8N D;  3AZN A;  4H9P B;  4XUJ A;  5B31 A;  1ZLA C;  5B2J C;  2ARO D;  5AV8 D;  3B0C W;  3REJ A;  2NQB B;  1KX3 C;  1AOI A;  3AZN D;  1U35 C;  3VH6 A;  3B0C T;  3MGS C;  4XUJ D;  5B31 D;  4KGC B;  4E44 A;  5CPK A;  5B2I A;  3W97 B;  5CP6 B;  1AOI D;  1TZY B;  4Z66 A;  3UTB A;  3AV1 C;  4HGA B;  3AZJ C;  1M18 B;  5CPK D;  4YM6 B;  5B2I D;  5BT1 D;  1F1E A;  4Z66 D;  3UTB D;  3W96 B;  4LD9 B;  4J8W B;  1S32 B;  4XZQ A;  3C1C A;  1P3M B;  1EQZ B;  3NQJ A;  1P3L B;  3AZE A;  3WA9 B;  3W99 B;  5AVB C;  4XZQ D;  1M1A B;  1ZLA A;  5B2J A;  1HQ3 A;  5AV5 C;  1N1J B;  3AZE D;  4YM6 C;  2BYK A;  1U35 A;  4ZUX B;  1P3O B;  1A7W A;  5BS7 C;  3MGS A;  2NZD B;  1ZLA D;  5B2J D;  4YS3 B;  1EQZ C;  1KX3 D;  4DRA A;  3AV1 A;  1U35 D;  3W99 C;  5B32 B;  3MGS D;  3AZJ A;  1TAF A;  3AZI C;  4NE5 A;  1M1A C;  4H9P A;  1F66 B;  3AV1 D;  2NQB A;  3AZJ D;  3O62 B;  4KGC A;  5B0Z C;  2HIO B;  1KU5 A;  5BNX A;  5AVB A;  5AV5 A;  5B32 C;  1BH8 B;  4CAY B;  3REK B;  2RVQ C;  4YM6 A;  2F8N B;  4Z2M G;  5AVB D;  5AY8 C;  2ARO B;  2L5A A;  5GXQ B;  2YFW B;  5AV5 D;  1JFI A;  1EQZ A;  4YM6 D;  4J8V C;  1ID3 C;  3AZN B;  3W99 A;  5B31 B;  4XUJ B;  4WV4 B;  3AZI A;  1M1A A;  1EQZ D;  5BO0 A;  3V9R A;  3W99 D;  3REK C;  5B2I B;  3AZI D;  1BH9 B;  1P3O A;  1M1A D;  4EO5 C;  2NZD A;  4Z66 B;  5GXQ C;  5B0Z A;  3UTB B;  3B0D B;  3W98 B;  3UTA C;  5B32 A;  3AZL C;  3KUY B;  5B0Z D;  1P3K C;  5AY8 A;  5DNM C;  3AZE B;  2F8N H;  1F66 A;  5GT0 C;  5B32 D;  2RVQ D;  4J8V A;  1ID3 A;  3O62 A;  3REI B;  2HIO A;  5AY8 D;  5B40 C;  5B2J B;  3X1V B;  5JRG C;  3B0D C;  2FJ7 C;  5AVC C;  3AZK B;  1KX3 B;  3W98 C;  4J8V D;  1ID3 D;  1U35 B;  3KUY C;  3MGS B;  3REK A;  3REL C;  5GXQ A;  1HTA A;  2YFW A;  3AZJ B;  1TAF B;  3REK D;  3AYW C;  3UTA A;  4G91 C;  3X1V C;  3REI C;  3AZL A;  5GXQ D;  3AZM C;  3AZK C;  1P3K A;  4KHA A;  5DNM A;  3UTA D;  5GT0 A;  4J8X C;  3AZL D;  3LZ0 C;  5BNX B;  1Q9C A;  1BH9 A;  5AVB B;  1P3K D;  5BNV A;  5B40 A;  5DNM D;  5AV5 B;  5GT0 D;  5JRG A;  3W98 A;  2FJ7 A;  5AVC A;  1P3G C;  3AZF C;  3MGR B;  3KUY A;  4E45 A;  5B40 D;  5F99 B;  5JRG D;  1WWS A;  3X1U C;  1JFI B;  5AVC D;  3REL A;  2FJ7 D;  3B6F C;  3W98 D;  3WKJ C;  3AV2 C;  5B1M B;  2IO5 C;  3KUY D;  3AYW A;  3AZI B;  3X1T C;  3REI A;  3REL D;  3X1V A;  5BO0 B;  3V9R B;  3AZM A;  3AZK A;  1KX3 A;  3MGP B;  3AYW D;  3C1B C;  3MGR C;  3REI D;  3X1V D;  4J8X A;  5B0Z B;  5F99 C;  3LZ0 A;  3MVD C;  3LZ1 C;  4J8U B;  3AZM D;  3AZK D;  5B1M C;  3AZG B;  4WU8 B;  1B67 A;  4J8X D;  3LZ0 D;  1P3G A;  3TU4 B;  3AZF A;  5AY8 B;  3X1U A;  1P34 C;  3B6F A;  3WKJ A;  3MGP C;  4J8V B;  1ID3 B;  1P3G D;  4ZBJ C;  3AZF D;  4J8U C;  1M19 C;  4JJN C;  3X1U D;  3X1T A;  5KDM A;  3B6F D;  3WKJ D;  3AZG C;  4WU8 C;  4M6B A;  3AV2 D;  3KXB C;  3AFA C;  4X23 C;  3X1T D;  4H9R B;  3TU4 C;  5BS7 A;  4EO5 B;  3MGR A;  1P3I B;  5F99 A;  3MVD A;  3LZ1 A;  1P3P B;  3UTA B;  3WAA C;  5B1M A;  3C1B D;  3MGR D;  2YFV A;  3AZL B;  5F99 D;  3MVD D;  4R8P C;  3LZ1 D;  1P3K B;  4KHA B;  5DNM B;  5GT0 B;  5B1M D;  1P34 A;  1P3A B;  3MGP A;  1H3O A;  1P3I C;  5BNV B;  5B40 B;  1KX4 C;  4J8U A;  5JA4 A;  1M19 A;  5JRG B;  4JJN A;  4NE6 A;  2FJ7 B;  5AVC B;  1P34 D;  4Z2M H;  1P3P C;  3MGP D;  3AZG A;  4WU8 A;  5B1L C;  3KXB A;  2F8N G;  3UT9 B;  4J8U D;  1M19 D;  5B33 B;  3AZH C;  1KX5 B;  4JJN D;  4X23 A;  3TU4 A;  3REL B;  4AWL C;  3AZG D;  4WU8 D;  3KXB D;  3AFA D;  1P3F C;  1P3A C;  1B6W A;  3AYW B;  5B31 G;  4G91 B;  4CSR A;  4X23 D;  3TU4 D;  3AZM B;  3LEL C; 
#chains in the Genus database with same CATH topology
 3R45 A;  3H0M C;  3MGQ B;  3WAA D;  1P3B C;  2CWE A;  4J8X B;  3LZ0 B;  3UT9 C;  1KX5 C;  5B33 C;  3EG5 B;  4R8P D;  3FDD A;  3KWQ B;  3AN2 C;  4H9R A;  3REJ C;  1P3I A;  5B0Y C;  1KX4 A;  3WTP E;  1P3P A;  2HUE C;  1P3G B;  1P3I D;  3AZF B;  4QLC C;  1KX4 D;  4H9N B;  3A1K A;  3AZH A;  3X1U B;  2Y2L A;  1P3P D;  3MGQ C;  3B6F B;  3WKJ B;  4UUZ A;  3AV2 B;  5B1L D;  2IO5 B;  3REH C;  3WTP C;  3VH5 T;  1P3A A;  3KWQ C;  3AZH D;  2CV5 C;  2Y2H A;  3X1T B;  5KDM B;  3C1C C;  5AV6 C;  4KUD C;  5G49 B;  3A6N C;  5AV9 B;  3LEL A;  1P3F D;  1P3A D;  2Y2M A;  3C1B B;  1P3B A;  5CPI C;  3MVD B;  3UT9 A;  1HQ3 C;  3LZ1 B;  5E5A C;  5B33 A;  1KX5 A;  4NFT A;  3AN2 A;  3NQU A;  3LEL D;  5B0Y A;  3KSY A;  3VH6 W;  2YFV B;  1P3B D;  2F8N K;  5FUG A;  3UT9 D;  1KX5 D;  5B33 D;  3VH6 T;  3REJ D;  3AN2 D;  4Z5T C;  4QLC A;  5B0Y D;  5B24 B;  5AV9 C;  5CPJ C;  1P34 B;  4WNN A;  3MGQ A;  2DQN C;  1H3O B;  4ZBJ B;  2G5H C;  4H9O A;  3REH A;  1R4V A;  3WTP A;  4QLC D;  1M19 B;  5JA4 B;  3KWQ A;  4JJN B;  2NQB C;  2CV5 A;  3MGQ D;  4H9Q B;  5AV6 A;  4KUD A;  3KXB B;  3AFA B;  3A6N A;  4KGC C;  3REH D;  3WTP D;  3KWQ D;  3W97 C;  3LJA B;  2CV5 D;  5CP6 C;  4X23 B;  2PYO B;  3C1C D;  5CPI A;  1TZY C;  5B24 C;  5AV6 D;  4KUD D;  4WZS B;  4H9N A;  5E5A A;  4HGA C;  3A6N D;  1M18 C;  3B6G B;  3AV2 A;  4CSR B;  3WAA B;  5CPI D;  3W96 C;  4LD9 C;  1HQ3 D;  4R8P B;  5E5A D;  4J8W C;  1S32 C;  1P3M C;  3R45 B;  1P3L C;  5G49 A;  4Z5T A;  4DRB A;  3WA9 C;  3AL0 C;  5AV9 A;  5CPJ A;  4WU9 B;  3F6T A;  3LJA C;  2PYO C;  3C1B A;  4H9S C;  4Z5T D;  5GT3 B;  1KX4 B;  3MNN B;  5AV9 D;  5CPJ D;  2BYM B;  3B6G C;  5B32 G;  5B1L B;  2JCH A;  4ZUX C;  1P3O C;  3X1S B;  3EPH A;  2NZD C;  4YS3 C;  3W97 A;  5DNN B;  3AZH B;  2NQB D;  5CP6 A;  5C3I B;  3H0L C;  1TZY A;  5B24 A;  2Y2I A;  4AWL B;  4UUZ B;  2Y2J A;  1M18 A;  1ULY A;  4WU9 C;  1P3F B;  4KGC D;  5GSU B;  3W97 D;  5CP6 D;  5GT3 C;  1TZY D;  5B24 D;  3MNN C;  5AV8 B;  3W96 A;  1F66 C;  4LD9 A;  4J8W A;  1S32 A;  1M18 D;  2Y2Q A;  3LEL B;  1P3M A;  4H9Q A;  2JSS A;  1P3L A;  3WA9 A;  3O62 C;  3AFA A;  3X1S C;  1P3B B;  1BFM A;  2HIO C;  3W96 D;  5DNN C;  4LD9 D;  4J8W D;  3LJA A;  1S32 D;  2PYO A;  5C3I C;  3NQU B;  3REJ B;  3AN2 B;  1P3M D;  1AOI B;  4H9S A;  5B0Y B;  1P3L D;  3WA9 D;  1N1J A;  3B0B A;  2LY8 A;  3IP4 C;  5FUG B;  5GSU C;  3B6G A;  2HUE B;  5CPK B;  3LJA D;  2PYO D;  3WAA A;  4ZUX A;  2JE5 A;  2ARO C;  5AV8 C;  4QLC B;  4R8P A;  4YS3 A;  4WNN B;  3B6G D;  3AZN C;  4ZUX D;  1P3O D;  5B31 C;  4H9O B;  4XUJ C;  3REH B;  3WTP B;  2NZD D;  4WU9 A;  4YS3 D;  2CV5 B;  4XZQ B;  3C1C B;  1AOI C;  3NQJ B;  5AV6 B;  5GT3 A;  2XD1 A;  4G92 B;  3MNN A;  4KUD B;  3A6N B;  2BYM A;  2BG1 A;  4WU9 D;  5CPK C;  5B2I C;  5BT1 C;  4NE3 A;  5CHL B;  5B1L A;  3X1S A;  5CPI B;  4Z66 C;  3UTB C;  5GT3 D;  1ZLA B;  1HQ3 B;  1PZR A;  2VQR A;  5E5A B;  5DNN A;  3MNN D;  1F66 D;  3VH5 W;  3VH5 A;  2BYK B;  3O62 D;  3X1S D;  1WWI A;  1BH8 A;  1P3F A;  2HIO D;  4CAY A;  5GSU A;  5DNN D;  2F8N A;  4XZQ C;  4G92 C;  3AZE C;  2ARO A;  4Z5T B;  5AV8 A;  3AV1 B;  5CPJ B;  5GSU D;  2F8N D;  3AZN A;  4H9P B;  4XUJ A;  5B31 A;  1ZLA C;  5B2J C;  2ARO D;  5AV8 D;  3B0C W;  3REJ A;  2NQB B;  1KX3 C;  1AOI A;  3AZN D;  1U35 C;  3VH6 A;  3B0C T;  3MGS C;  4XUJ D;  5B31 D;  4KGC B;  4E44 A;  5CPK A;  5B2I A;  3W97 B;  5CP6 B;  1AOI D;  1TZY B;  4Z66 A;  3UTB A;  3AV1 C;  3P5J B;  4HGA B;  3AZJ C;  1M18 B;  5CPK D;  4YM6 B;  5B2I D;  5BT1 D;  3EPL A;  1F1E A;  4Z66 D;  3UTB D;  3W96 B;  4LD9 B;  4J8W B;  1S32 B;  4XZQ A;  1Z2C B;  3C1C A;  1P3M B;  1EQZ B;  3NQJ A;  1P3L B;  3AZE A;  3WA9 B;  3EPJ A;  3W99 B;  5AVB C;  4XZQ D;  1M1A B;  1ZLA A;  5B2J A;  1HQ3 A;  5AV5 C;  1N1J B;  3AZE D;  4YM6 C;  2BYK A;  1U35 A;  4ZUX B;  1P3O B;  1A7W A;  5BS7 C;  3MGS A;  2NZD B;  1ZLA D;  5B2J D;  2Y2N A;  4YS3 B;  1EQZ C;  1T3U A;  1KX3 D;  4DRA A;  3AV1 A;  1U35 D;  3W99 C;  5B32 B;  3MGS D;  3AZJ A;  1TAF A;  3AZI C;  4NE5 A;  1M1A C;  4H9P A;  1F66 B;  3AV1 D;  2NQB A;  3AZJ D;  3O62 B;  4KGC A;  5B0Z C;  2HIO B;  1KU5 A;  5BNX A;  5AVB A;  5AV5 A;  5B32 C;  1BH8 B;  2ZY5 A;  4CAY B;  3REK B;  2RVQ C;  4YM6 A;  2F8N B;  2ZY4 A;  2DF4 C;  2RIQ A;  4UPK A;  4Z2M G;  5AVB D;  5AY8 C;  2ARO B;  2L5A A;  5GXQ B;  2YFW B;  5AV5 D;  3KFU G;  1JFI A;  1EQZ A;  4YM6 D;  4J8V C;  1ID3 C;  4DQY B;  3AZN B;  4WJ3 C;  3W99 A;  5B31 B;  4XUJ B;  4WV4 B;  3AZI A;  2F2A C;  1M1A A;  1EQZ D;  5BO0 A;  3V9R A;  2UWX A;  3W99 D;  3REK C;  5B2I B;  2Y2K A;  3AZI D;  1BH9 B;  1P3O A;  1M1A D;  4EO5 C;  2FFF B;  2NZD A;  4Z66 B;  5B0Z A;  5GXQ C;  3UTB B;  3B0D B;  3W98 B;  3UTA C;  3EPK A;  5B32 A;  3AZL C;  2G5I C;  3KUY B;  5B0Z D;  2Y2O A;  1P3K C;  5AY8 A;  5DNM C;  3AZE B;  2F8N H;  1F66 A;  5GT0 C;  5B32 D;  2RVQ D;  4J8V A;  1ID3 A;  3O62 A;  3REI B;  2HIO A;  5AY8 D;  5B40 C;  5B2J B;  3X1V B;  5JRG C;  3B0D C;  2FJ7 C;  5AVC C;  3AZK B;  1KX3 B;  3W98 C;  4J8V D;  2ZY3 A;  1ID3 D;  1U35 B;  3KUY C;  3MGS B;  3REK A;  3REL C;  5GXQ A;  1HTA A;  2YFW A;  3AZJ B;  1TAF B;  3REK D;  3AYW C;  3UTA A;  2J8P A;  4G91 C;  3X1V C;  3REI C;  3AZL A;  5GXQ D;  3AZM C;  3AZK C;  1P3K A;  4KHA A;  5DNM A;  3UTA D;  5GT0 A;  2ZY2 A;  4J8X C;  3AZL D;  3LZ0 C;  5BNX B;  1Q9C A;  1BH9 A;  5AVB B;  1P3K D;  5BNV A;  5B40 A;  5DNM D;  5AV5 B;  5GT0 D;  5JRG A;  3W98 A;  2FJ7 A;  5AVC A;  2Y2G A;  1P3G C;  3AZF C;  3MGR B;  3KUY A;  4E45 A;  5B40 D;  5F99 B;  5JRG D;  1WWS A;  3X1U C;  1JFI B;  5AVC D;  3REL A;  2FJ7 D;  3B6F C;  3W98 D;  3WKJ C;  3AV2 C;  5B1M B;  2ZM5 A;  2IO5 C;  3KUY D;  3AYW A;  3AZI B;  3X1T C;  3REI A;  3REL D;  3X1V A;  5BO0 B;  3V9R B;  3AZM A;  3AZK A;  1KX3 A;  3MGP B;  3AYW D;  3C1B C;  3MGR C;  3REI D;  3X1V D;  4J8X A;  5B0Z B;  5F99 C;  3LZ0 A;  3MVD C;  3LZ1 C;  4J8U B;  3AZM D;  2XD5 A;  3AZK D;  5B1M C;  3AZG B;  4WU8 B;  1B67 A;  4J8X D;  3LZ0 D;  1P3G A;  3TU4 B;  3AZF A;  5AY8 B;  3X1U A;  1P34 C;  3B6F A;  3WKJ A;  3MGP C;  4J8V B;  1ID3 B;  1P3G D;  4ZBJ C;  3AZF D;  4J8U C;  1M19 C;  4JJN C;  3X1U D;  3X1T A;  5KDM A;  3B6F D;  3WKJ D;  3H0R C;  3AZG C;  4WU8 C;  4M6B A;  3AV2 D;  3KXB C;  3AFA C;  4X23 C;  3X1T D;  4H9R B;  3TU4 C;  5BS7 A;  4EO5 B;  3MGR A;  1P3I B;  5F99 A;  3MVD A;  3LZ1 A;  1P3P B;  3UTA B;  3WAA C;  5B1M A;  3C1B D;  3MGR D;  2YFV A;  3AZL B;  5F99 D;  3MVD D;  4R8P C;  3LZ1 D;  1P3K B;  4KHA B;  5DNM B;  2W8S A;  5GT0 B;  5B1M D;  1P34 A;  1P3A B;  3MGP A;  1H3O A;  1P3I C;  1W2E A;  5BNV B;  5B40 B;  1KX4 C;  4J8U A;  5JA4 A;  1M19 A;  5JRG B;  4JJN A;  4NE6 A;  2FJ7 B;  5AVC B;  1P34 D;  4Z2M H;  1P3P C;  3MGP D;  3AZG A;  4WU8 A;  5B1L C;  3KXB A;  2F8N G;  3A1I A;  3UT9 B;  4J8U D;  1M19 D;  5B33 B;  3AZH C;  1KX5 B;  4JJN D;  4X23 A;  3TU4 A;  3REL B;  4AWL C;  3AZG D;  4WU8 D;  3KXB D;  3AFA D;  1P3F C;  1P3A C;  1B6W A;  3AYW B;  5B31 G;  4G91 B;  4CSR A;  4X23 D;  3TU4 D;  2Y2P A;  3AZM B;  3LEL C; 
#chains in the Genus database with same CATH homology
 3R45 A;  3H0M C;  3MGQ B;  3WAA D;  1P3B C;  2CWE A;  4J8X B;  3LZ0 B;  3UT9 C;  1KX5 C;  5B33 C;  3EG5 B;  4R8P D;  3FDD A;  3KWQ B;  3AN2 C;  4H9R A;  3REJ C;  1P3I A;  5B0Y C;  1KX4 A;  3WTP E;  1P3P A;  2HUE C;  1P3G B;  1P3I D;  3AZF B;  4QLC C;  1KX4 D;  4H9N B;  3A1K A;  3AZH A;  3X1U B;  2Y2L A;  1P3P D;  3MGQ C;  3B6F B;  3WKJ B;  4UUZ A;  3AV2 B;  5B1L D;  2IO5 B;  3REH C;  3WTP C;  3VH5 T;  1P3A A;  3KWQ C;  3AZH D;  2CV5 C;  2Y2H A;  3X1T B;  5KDM B;  3C1C C;  5AV6 C;  4KUD C;  5G49 B;  3A6N C;  5AV9 B;  3LEL A;  1P3F D;  1P3A D;  2Y2M A;  3C1B B;  1P3B A;  5CPI C;  3MVD B;  3UT9 A;  1HQ3 C;  3LZ1 B;  5E5A C;  5B33 A;  1KX5 A;  4NFT A;  3AN2 A;  3NQU A;  3LEL D;  5B0Y A;  3KSY A;  3VH6 W;  2YFV B;  1P3B D;  2F8N K;  5FUG A;  3UT9 D;  1KX5 D;  5B33 D;  3VH6 T;  3REJ D;  3AN2 D;  4Z5T C;  4QLC A;  5B0Y D;  5B24 B;  5AV9 C;  5CPJ C;  1P34 B;  4WNN A;  3MGQ A;  2DQN C;  1H3O B;  4ZBJ B;  2G5H C;  4H9O A;  3REH A;  1R4V A;  3WTP A;  4QLC D;  1M19 B;  5JA4 B;  3KWQ A;  4JJN B;  2NQB C;  2CV5 A;  3MGQ D;  4H9Q B;  5AV6 A;  4KUD A;  3KXB B;  3AFA B;  3A6N A;  4KGC C;  3REH D;  3WTP D;  3KWQ D;  3W97 C;  3LJA B;  2CV5 D;  5CP6 C;  4X23 B;  2PYO B;  3C1C D;  5CPI A;  1TZY C;  5B24 C;  5AV6 D;  4KUD D;  4WZS B;  4H9N A;  5E5A A;  4HGA C;  3A6N D;  1M18 C;  3B6G B;  3AV2 A;  4CSR B;  3WAA B;  5CPI D;  3W96 C;  4LD9 C;  1HQ3 D;  4R8P B;  5E5A D;  4J8W C;  1S32 C;  1P3M C;  3R45 B;  1P3L C;  5G49 A;  4Z5T A;  4DRB A;  3WA9 C;  3AL0 C;  5AV9 A;  5CPJ A;  4WU9 B;  3F6T A;  3LJA C;  2PYO C;  3C1B A;  4H9S C;  4Z5T D;  5GT3 B;  1KX4 B;  3MNN B;  5AV9 D;  5CPJ D;  2BYM B;  3B6G C;  5B32 G;  5B1L B;  2JCH A;  4ZUX C;  1P3O C;  3X1S B;  3EPH A;  2NZD C;  4YS3 C;  3W97 A;  5DNN B;  3AZH B;  2NQB D;  5CP6 A;  5C3I B;  3H0L C;  1TZY A;  5B24 A;  2Y2I A;  4AWL B;  4UUZ B;  2Y2J A;  1M18 A;  1ULY A;  4WU9 C;  1P3F B;  4KGC D;  5GSU B;  3W97 D;  5CP6 D;  5GT3 C;  1TZY D;  5B24 D;  3MNN C;  5AV8 B;  3W96 A;  1F66 C;  4LD9 A;  4J8W A;  1S32 A;  1M18 D;  2Y2Q A;  3LEL B;  1P3M A;  4H9Q A;  2JSS A;  1P3L A;  3WA9 A;  3O62 C;  3AFA A;  3X1S C;  1P3B B;  1BFM A;  2HIO C;  3W96 D;  5DNN C;  4LD9 D;  4J8W D;  3LJA A;  1S32 D;  2PYO A;  5C3I C;  3NQU B;  3REJ B;  3AN2 B;  1P3M D;  1AOI B;  4H9S A;  5B0Y B;  1P3L D;  3WA9 D;  1N1J A;  3B0B A;  2LY8 A;  3IP4 C;  5FUG B;  5GSU C;  3B6G A;  2HUE B;  5CPK B;  3LJA D;  2PYO D;  3WAA A;  4ZUX A;  2JE5 A;  2ARO C;  5AV8 C;  4QLC B;  4R8P A;  4YS3 A;  4WNN B;  3B6G D;  3AZN C;  4ZUX D;  1P3O D;  5B31 C;  4H9O B;  4XUJ C;  3REH B;  3WTP B;  2NZD D;  4WU9 A;  4YS3 D;  2CV5 B;  4XZQ B;  3C1C B;  1AOI C;  3NQJ B;  5AV6 B;  5GT3 A;  2XD1 A;  4G92 B;  3MNN A;  4KUD B;  3A6N B;  2BYM A;  2BG1 A;  4WU9 D;  5CPK C;  5B2I C;  5BT1 C;  4NE3 A;  5CHL B;  5B1L A;  3X1S A;  5CPI B;  4Z66 C;  3UTB C;  5GT3 D;  1ZLA B;  1HQ3 B;  1PZR A;  2VQR A;  5E5A B;  5DNN A;  3MNN D;  1F66 D;  3VH5 W;  3VH5 A;  2BYK B;  3O62 D;  3X1S D;  1WWI A;  1BH8 A;  1P3F A;  2HIO D;  4CAY A;  5GSU A;  5DNN D;  2F8N A;  4XZQ C;  4G92 C;  3AZE C;  2ARO A;  4Z5T B;  5AV8 A;  3AV1 B;  5CPJ B;  5GSU D;  2F8N D;  3AZN A;  4H9P B;  4XUJ A;  5B31 A;  1ZLA C;  5B2J C;  2ARO D;  5AV8 D;  3B0C W;  3REJ A;  2NQB B;  1KX3 C;  1AOI A;  3AZN D;  1U35 C;  3VH6 A;  3B0C T;  3MGS C;  4XUJ D;  5B31 D;  4KGC B;  4E44 A;  5CPK A;  5B2I A;  3W97 B;  5CP6 B;  1AOI D;  1TZY B;  4Z66 A;  3UTB A;  3AV1 C;  3P5J B;  4HGA B;  3AZJ C;  1M18 B;  5CPK D;  4YM6 B;  5B2I D;  5BT1 D;  3EPL A;  1F1E A;  4Z66 D;  3UTB D;  3W96 B;  4LD9 B;  4J8W B;  1S32 B;  4XZQ A;  1Z2C B;  3C1C A;  1P3M B;  1EQZ B;  3NQJ A;  1P3L B;  3AZE A;  3WA9 B;  3EPJ A;  3W99 B;  5AVB C;  4XZQ D;  1M1A B;  1ZLA A;  5B2J A;  1HQ3 A;  5AV5 C;  1N1J B;  3AZE D;  4YM6 C;  2BYK A;  1U35 A;  4ZUX B;  1P3O B;  1A7W A;  5BS7 C;  3MGS A;  2NZD B;  1ZLA D;  5B2J D;  2Y2N A;  4YS3 B;  1EQZ C;  1T3U A;  1KX3 D;  4DRA A;  3AV1 A;  1U35 D;  3W99 C;  5B32 B;  3MGS D;  3AZJ A;  1TAF A;  3AZI C;  4NE5 A;  1M1A C;  4H9P A;  1F66 B;  3AV1 D;  2NQB A;  3AZJ D;  3O62 B;  4KGC A;  5B0Z C;  2HIO B;  1KU5 A;  5BNX A;  5AVB A;  5AV5 A;  5B32 C;  1BH8 B;  2ZY5 A;  4CAY B;  3REK B;  2RVQ C;  4YM6 A;  2F8N B;  2ZY4 A;  2DF4 C;  2RIQ A;  4UPK A;  4Z2M G;  5AVB D;  5AY8 C;  2ARO B;  2L5A A;  5GXQ B;  2YFW B;  5AV5 D;  3KFU G;  1JFI A;  1EQZ A;  4YM6 D;  4J8V C;  1ID3 C;  4DQY B;  3AZN B;  4WJ3 C;  3W99 A;  5B31 B;  4XUJ B;  4WV4 B;  3AZI A;  2F2A C;  1M1A A;  1EQZ D;  5BO0 A;  3V9R A;  2UWX A;  3W99 D;  3REK C;  5B2I B;  2Y2K A;  3AZI D;  1BH9 B;  1P3O A;  1M1A D;  4EO5 C;  2FFF B;  2NZD A;  4Z66 B;  5B0Z A;  5GXQ C;  3UTB B;  3B0D B;  3W98 B;  3UTA C;  3EPK A;  5B32 A;  3AZL C;  2G5I C;  3KUY B;  5B0Z D;  2Y2O A;  1P3K C;  5AY8 A;  5DNM C;  3AZE B;  2F8N H;  1F66 A;  5GT0 C;  5B32 D;  2RVQ D;  4J8V A;  1ID3 A;  3O62 A;  3REI B;  2HIO A;  5AY8 D;  5B40 C;  5B2J B;  3X1V B;  5JRG C;  3B0D C;  2FJ7 C;  5AVC C;  3AZK B;  1KX3 B;  3W98 C;  4J8V D;  2ZY3 A;  1ID3 D;  1U35 B;  3KUY C;  3MGS B;  3REK A;  3REL C;  5GXQ A;  1HTA A;  2YFW A;  3AZJ B;  1TAF B;  3REK D;  3AYW C;  3UTA A;  2J8P A;  4G91 C;  3X1V C;  3REI C;  3AZL A;  5GXQ D;  3AZM C;  3AZK C;  1P3K A;  4KHA A;  5DNM A;  3UTA D;  5GT0 A;  2ZY2 A;  4J8X C;  3AZL D;  3LZ0 C;  5BNX B;  1Q9C A;  1BH9 A;  5AVB B;  1P3K D;  5BNV A;  5B40 A;  5DNM D;  5AV5 B;  5GT0 D;  5JRG A;  3W98 A;  2FJ7 A;  5AVC A;  2Y2G A;  1P3G C;  3AZF C;  3MGR B;  3KUY A;  4E45 A;  5B40 D;  5F99 B;  5JRG D;  1WWS A;  3X1U C;  1JFI B;  5AVC D;  3REL A;  2FJ7 D;  3B6F C;  3W98 D;  3WKJ C;  3AV2 C;  5B1M B;  2ZM5 A;  2IO5 C;  3KUY D;  3AYW A;  3AZI B;  3X1T C;  3REI A;  3REL D;  3X1V A;  5BO0 B;  3V9R B;  3AZM A;  3AZK A;  1KX3 A;  3MGP B;  3AYW D;  3C1B C;  3MGR C;  3REI D;  3X1V D;  4J8X A;  5B0Z B;  5F99 C;  3LZ0 A;  3MVD C;  3LZ1 C;  4J8U B;  3AZM D;  2XD5 A;  3AZK D;  5B1M C;  3AZG B;  4WU8 B;  1B67 A;  4J8X D;  3LZ0 D;  1P3G A;  3TU4 B;  3AZF A;  5AY8 B;  3X1U A;  1P34 C;  3B6F A;  3WKJ A;  3MGP C;  4J8V B;  1ID3 B;  1P3G D;  4ZBJ C;  3AZF D;  4J8U C;  1M19 C;  4JJN C;  3X1U D;  3X1T A;  5KDM A;  3B6F D;  3WKJ D;  3H0R C;  3AZG C;  4WU8 C;  4M6B A;  3AV2 D;  3KXB C;  3AFA C;  4X23 C;  3X1T D;  4H9R B;  3TU4 C;  5BS7 A;  4EO5 B;  3MGR A;  1P3I B;  5F99 A;  3MVD A;  3LZ1 A;  1P3P B;  3UTA B;  3WAA C;  5B1M A;  3C1B D;  3MGR D;  2YFV A;  3AZL B;  5F99 D;  3MVD D;  4R8P C;  3LZ1 D;  1P3K B;  4KHA B;  5DNM B;  2W8S A;  5GT0 B;  5B1M D;  1P34 A;  1P3A B;  3MGP A;  1H3O A;  1P3I C;  1W2E A;  5BNV B;  5B40 B;  1KX4 C;  4J8U A;  5JA4 A;  1M19 A;  5JRG B;  4JJN A;  4NE6 A;  2FJ7 B;  5AVC B;  1P34 D;  4Z2M H;  1P3P C;  3MGP D;  3AZG A;  4WU8 A;  5B1L C;  3KXB A;  2F8N G;  3A1I A;  3UT9 B;  4J8U D;  1M19 D;  5B33 B;  3AZH C;  1KX5 B;  4JJN D;  4X23 A;  3TU4 A;  3REL B;  4AWL C;  3AZG D;  4WU8 D;  3KXB D;  3AFA D;  1P3F C;  1P3A C;  1B6W A;  3AYW B;  5B31 G;  4G91 B;  4CSR A;  4X23 D;  3TU4 D;  2Y2P A;  3AZM B;  3LEL C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...