3AZJD

Crystal structure of human nucleosome core particle containing h4k44q mutation
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
96
structure length
96
Chain Sequence
RKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 96
sequence length 96
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3azjD00
4ZBJB 1H3OA 2NZDC 1U35B 3R45B 1P3AD 3AZLC 5GT3B 3REJA 3AZHA 3B6GC 3WKJA 2YFWB 2CV5A 5DNNC 5B2IC 3AZHD 1M1AD 3MGSB 3AZJA 3X1UD 3C1CC 3AZIC 1WWSA 3WKJD 3X1SB 3AZNB 2CV5D 2BYKB 5GSUA 4WU8B 5B1LC 3W99A 1P3KA 3AZJD 3AZMA 4G91C 4H9RB 5CPJA 5GSUD 4J8UA 5B0ZB 3RELB 1P3KD 3AZMD 1KX3A 3UTBD 3W98B 4J8UD 5B32G 3AYWB 5B2IA 1S32C 1N1JA 3LZ1A 1P3BA 3C1BC 4NFTA 1KX3D 1M18C 3C1CA 3REKB 3AFAD 2PYOB 3MVDB 4X23B 3LZ1D 3LELC 5AV6A 2BYMA 3A6ND 4M6BA 3WTPC 3AZLB 4R8PC 3O62D 3B6FA 3MNNA 1KX4D 1KX5C 5AV6D 4H9OA 4JJNC 4WV4B 5BNVB 3AZKB 3B6GB 3B6FD 1P34A 3MNND 3WAAC 3AZIB 3C1BA 5B1MA 4Z5TC 1P34D 5B33D 4KUDC 4G91B 5B1MD 5AV5C 3WTPA 3KWQC 4R8PA 1TAFB 2FJ7C 4KHAA 3KXBA 3AV1C 4J8WB 4H9QA 5F99C 3MGPA 1M18B 3TU4C 3NQUA 3KXBD 3AZEC 1AOIA 4Z5TA 3W97A 4WNNA 3MGPD 4UUZB 4WU9D 1WWIA 1AOID 3W97D 5B40D 1HQ3B 4E45A 1M19C 1ZLAB 4H9PA 4H9NA 5CP6C 3UTAC 3AN2B 2HIOA 5B32C 1P3ID 5AV8C 1P3MC 4KUDB 1TZYD 4J8VC 5JA4A 3MGQA 2NQBC 5AV5B 5KDMA 3X1TC 3KWQB 4H9SC 1P3GB 1P3FA 5CPID 1Q9CA 1F66C 3MGQD 1U35C 3AV1B 5GT3C 1JFIB 5BT1D 2AROA 2JSSA 5FUGA 5DNMC 5B24C 5F99B 5CP6A 3LZ0D 4LD9A 4J8XA 1B6WA 5AVBA 5CPKB 5BS7A 5GT0A 2AROD 3MGSC 3NQJA 3KUYA 3X1SC 4QLCC 3AZNC 4J8XD 5AV9D 4WU8C 5AVBD 5GT0D 4H9SA 3MGRD 3AZGA 1ID3D 3KUYD 2YFVB 4YS3B 4AWLC 5CHLB 3LJAB 5B0ZC 1P3LD 1P3PC 3AZGD 3UTAB 5B31B 3VH5A 5B2JC 2L5AA 5JRGB 3W98C 3AYWC 1P3MB 3MGSA 4KGCA 4J8VB 3REKC 2NQBB 3AZNA 3X1TB 2BYKA 5GXQB 2PYOC 4WU8A 1BH9B 3MVDC 4X23C 5G49B 3X1VC 1F66B 4KGCD 3B0CT 4H9RA 4CSRB 5DNMB 5B24B 3RELA 4XZQB 3AZKC 3WA9B 5E5AB 5AY8B 4ZUXB 3REJD 1P3OB 3RELD 5B0YA 3UT9B 4QLCB 5BNXB 3MVDA 5B0YD 4X23A 1EQZB 4XUJC 4NE3A 2NZDA 4AWLB 3AZLA 3W99D 1P3PB 3AZFC 5B31G 5B2JB 3B0BA 2NZDD 5CPJD 5BNVA 3B6GA 5DNNA 3AZLD 4J8WC 2F8NA 3AFAC 4Z2MG 3AZIA 3B6GD 5DNND 5B2ID 5B1LA 1P3BD 2F8ND 1P3AB 3X1VB 3C1CD 3AZID 4E44A 3KSYA 5B1LD 5C3IC 1M1AB 1HQ3C 4YM6C 3X1UB 3WKJB 4J8WA 1S32A 2CV5B 1ZLAC 3AN2C 1M18A 5B33C 3REIC 1S32D 5GSUB 3LELA 3C1BD 4XUJB 3VH6T 4UUZA 3UTBB 3AZFB 1P3GC 3LELD 5AVCC 1KX5A 4JJNA 2LY8A 4Z2MH 3WTPD 4R8PD 3AFAB 3B0CW 1KX5D 3WAAA 4JJND 3AN2A 5CPKC 4WU9C 3A6NB 3WAAD 4KUDA 3O62B 1KX4B 3AV2C 4Z5TD 5AV5A 2BYMB 3KWQA 2FJ7A 2RVQC 5C3IB 3B6FB 4YS3C 3MNNB 4YM6B 4WZSB 5AV5D 3AV1A 3LJAC 2FJ7D 1JFIA 5B31C 5F99A 5B33B 3VH6A 3TU4A 5JRGC 3AZEA 3REIB 3AV1D 5B1MB 3VH5T 5F99D 3TU4D 2HIOD 3AZED 5CPIC 5GXQC 1R4VA 3W96C 5AVCB 5BO0A 3KXBB 3LJAA 1P3FD 1M19A 4Z66C 3UTAA 4XZQC 5B31A 4HGAB 4H9QB 3WA9C 3MGPB 5E5AC 5B32A 5AY8C 4ZUXC 3NQUB 4CAYB 4WU9B 1P3OC 1M19D 5AV8A 3UT9C 3UTAD 5CP6D 1P3MA 4DRAA 4J8VA 5B40B 3AV2B 4LD9D 5B32D 1ID3C 2NQBA 3X1TA 5GXQA 5AV8D 1P3MD 1EQZC 1P3LC 4J8VD 1F66A 1U35A 2NQBD 1A7WA 3R45A 3X1TD 5GT3A 3VH6W 1P3IB 5DNMA 5B24A 3REHC 1U35D 2YFWA 1TZYB 1BH8B 2CWEA 5AY8A 5GT3D 4ZUXA 5DNMD 5B24D 3UT9A 3X1SA 4QLCA 5CPIB 5JA4B 3MGQB 3W96B 3MGSD 1P3AC 3X1SD 4QLCD 3AZND 4WU8D 3LZ0B 5B0ZA 1P3PA 4Z66B 3AZHC 1M1AC 2AROB 5B2JA 3X1UC 3W98A 3AYWA 5B0ZD 3WKJC 2CV5C 1P3PD 4J8XB 5AV9B 5AVBB 5GT0B 3REKA 5B2JD 3AZJC 3MGRB 1ID3B 3W98D 3KUYB 3AYWD 2PYOA 5GSUC 3V9RB 1P3AA 3X1VA 1B67A 1P3LB 3W99C 3REKD 1P3KC 3AZMC 3AZGB 3WTPE 3VH5W 3UTBC 2PYOD 5CPJC 3MVDD 4X23D 4J8UC 3X1VD 3REHB 3AZKA 1M1AA 1KX3C 3X1UA 3AZKD 3LZ1C 1P3BC 4KGCB 3A6NC 1H3OB 3O62C 2IO5C 4XUJA 1KX4C 5AV6C 1TAFA 3UTBA 3AZFA 4G92B 3B6FC 3REJB 3AZHB 4XUJD 3MNNC 2HUEB 3AZFD 3AFAA 1ULYA 1P34C 3AZJB 5B0YB 5B1MC 4J8WD 3A6NA 1M18D 3W99B 3O62A 1P3KB 3AZMB 1KX4A 2NZDB 5CPJB 3B0DC 4J8UB 1HQ3A 4YM6A 1KX3B 3KXBC 1ZLAA 5DNNB 4HGAC 5B2IB 1N1JB 2F8NB 5B33A 1HQ3D 3LZ1B 4YM6D 3MGPC 1P3BB 3C1CB 3REIA 1AOIC 1ZLAD 3W97C 1KU5A 2IO5B 3AN2D 5B1LB 5B40C 5AV6B 3REID 1P3GA 4KUDD 5AVCA 4H9OB 3KWQD 1P3GD 1P3IC 1P34B 5AVCD 1S32B 3C1BB 1TZYC 4NE5A 2HIOC 4CAYA 4WU9A 5CPKA 4DRBA 5B40A 3LELB 3AV2A 3MGQC 3B0DB 5CPKD 3WTPB 4R8PB 5BT1C 2YFVA 4YS3A 1P3FC 3AV2D 4EO5C 1KX5B 2F8NK 4KHAB 3LZ0C 4JJNB 1F1EA 2RVQD 1P3IA 4YS3D 2AROC 2F8NG 5JRGA 3WAAB 1TZYA 1BH8A 3LJAD 1AOIB 4LD9C 4Z5TB 4J8XC 5AV9C 3W97B 5B31D 5AVBC 5BS7C 4WNNB 5GT0C 1BFMA 3MGRC 5JRGD 3KUYC 5CPIA 1BH9A 3W96A 4NE6A 4ZBJC 5G49A 2FJ7B 3AZGC 4CSRA 5GXQD 3LZ0A 3W96D 1HTAA 4Z66A 1F66D 4XZQA 3WA9A 4H9PB 4H9NB 5E5AA 3TU4B 2HIOB 3AZEB 1P3OA 4Z66D 5AV9A 4XZQD 3WA9D 3MGRA 4KGCC 5E5AD 1ID3A 5BNXA 5AY8D 4ZUXD 1P3OD 5KDMB 3UT9D 1EQZA 3V9RA 1P3LA 1P3FB 4EO5B 2F8NH 5BO0B 1EQZD 4G92C 3REJC 5FUGB 3REHA 3RELC 1M19B 5CP6B 2HUEC 4LD9B 5B32B 3REHD 3NQJB 5AV8B 5B0YC
chains in the Genus database with same CATH superfamily
4ZBJB 1H3OA 2NZDC 1U35B 3R45B 1P3AD 3AZLC 5GT3B 3REJA 3AZHA 3B6GC 3WKJA 2YFWB 2CV5A 5DNNC 5B2IC 3AZHD 1M1AD 3MGSB 3AZJA 3X1UD 3C1CC 3AZIC 1WWSA 3WKJD 3X1SB 3AZNB 2CV5D 2BYKB 5GSUA 4WU8B 2DF4C 5B1LC 3W99A 1P3KA 3AZJD 3AZMA 4G91C 4H9RB 5CPJA 5GSUD 4J8UA 5B0ZB 3RELB 1P3KD 3AZMD 1KX3A 3UTBD 3W98B 4J8UD 5B32G 3AYWB 5B2IA 1S32C 1N1JA 3LZ1A 1P3BA 3C1BC 4NFTA 1KX3D 1M18C 3C1CA 3REKB 3AFAD 2PYOB 3MVDB 2UWXA 4X23B 3LZ1D 3LELC 5AV6A 2BYMA 3A6ND 4M6BA 3WTPC 3AZLB 4R8PC 3O62D 3B6FA 3MNNA 1KX4D 1KX5C 2Y2KA 5AV6D 4H9OA 4JJNC 4WV4B 2BG1A 5BNVB 3AZKB 3B6GB 3B6FD 1P34A 3MNND 3WAAC 3AZIB 3C1BA 5B1MA 4Z5TC 1P34D 5B33D 4KUDC 4G91B 5B1MD 1T3UA 5AV5C 3WTPA 3KWQC 4R8PA 1TAFB 2JCHA 2FJ7C 4KHAA 3KXBA 3AV1C 4J8WB 4H9QA 5F99C 3MGPA 1M18B 3TU4C 3NQUA 3KXBD 3AZEC 2RIQA 1AOIA 4Z5TA 3W97A 3P5JB 4WNNA 3MGPD 4UUZB 4WU9D 1WWIA 1AOID 3W97D 3EPLA 5B40D 1HQ3B 2XD1A 4E45A 1M19C 1ZLAB 4H9PA 4H9NA 5CP6C 3UTAC 3AN2B 2HIOA 5B32C 1P3ID 5AV8C 1P3MC 4KUDB 1TZYD 4J8VC 5JA4A 3MGQA 3EPKA 2NQBC 5AV5B 5KDMA 3X1TC 3KWQB 4H9SC 1P3GB 1P3FA 2Y2MA 1Q9CA 5CPID 1F66C 3MGQD 1U35C 3AV1B 5GT3C 1JFIB 5BT1D 2AROA 2JSSA 5FUGA 5DNMC 5B24C 5F99B 5CP6A 3LZ0D 4LD9A 4J8XA 3A1KA 1B6WA 5AVBA 5CPKB 5BS7A 5GT0A 2AROD 3MGSC 3NQJA 3KUYA 3X1SC 4QLCC 3AZNC 4J8XD 5AV9D 4WU8C 5AVBD 5GT0D 4H9SA 3MGRD 3AZGA 1ID3D 3KUYD 2YFVB 4YS3B 2ZY3A 4AWLC 5CHLB 3LJAB 5B0ZC 1P3LD 1P3PC 3AZGD 3UTAB 1PZRA 5B31B 3VH5A 5B2JC 2L5AA 5JRGB 4WJ3C 3W98C 3AYWC 1P3MB 3MGSA 4KGCA 4J8VB 3REKC 2Y2HA 2NQBB 3AZNA 3X1TB 2BYKA 5GXQB 2PYOC 4WU8A 1BH9B 3MVDC 4X23C 5G49B 3X1VC 1F66B 4KGCD 3B0CT 4H9RA 4CSRB 2Y2PA 2G5IC 5DNMB 5B24B 3RELA 4XZQB 3AZKC 3WA9B 5E5AB 5AY8B 4ZUXB 3REJD 1P3OB 3RELD 5B0YA 3UT9B 4QLCB 5BNXB 3MVDA 5B0YD 4X23A 1EQZB 4XUJC 4NE3A 2NZDA 4AWLB 3AZLA 3W99D 1P3PB 3AZFC 3A1IA 5B31G 5B2JB 3B0BA 2NZDD 5CPJD 5BNVA 3B6GA 5DNNA 3AZLD 4J8WC 2F8NA 3AFAC 4Z2MG 3AZIA 3B6GD 2Y2IA 5DNND 5B2ID 2ZY2A 5B1LA 1P3BD 2F8ND 1P3AB 3X1VB 3C1CD 3AZID 4E44A 3KSYA 5B1LD 5C3IC 1M1AB 1HQ3C 4YM6C 3X1UB 3WKJB 4J8WA 1S32A 2CV5B 1ZLAC 3AN2C 1M18A 5B33C 3H0RC 3REIC 1S32D 5GSUB 3LELA 3C1BD 4XUJB 3VH6T 4UUZA 2J8PA 3UTBB 3AZFB 1P3GC 3LELD 5AVCC 1KX5A 4JJNA 2LY8A 4Z2MH 3WTPD 4R8PD 2FFFB 3H0LC 3AFAB 3B0CW 1KX5D 3WAAA 4JJND 3AN2A 5CPKC 4WU9C 1Z2CB 3A6NB 3WAAD 4KUDA 3O62B 1KX4B 3AV2C 4Z5TD 5AV5A 2BYMB 3KWQA 2FJ7A 2RVQC 5C3IB 2Y2NA 3B6FB 4YS3C 2ZM5A 3MNNB 3EPJA 4YM6B 4WZSB 5AV5D 3AV1A 3LJAC 3EPHA 2FJ7D 1JFIA 5B31C 5F99A 5B33B 3VH6A 3TU4A 5JRGC 3AZEA 3REIB 3AV1D 5B1MB 3VH5T 5F99D 3TU4D 2HIOD 3AZED 5CPIC 2XD5A 2G5HC 5GXQC 1R4VA 3W96C 5AVCB 2JE5A 5BO0A 3KXBB 3LJAA 1P3FD 1M19A 4Z66C 3UTAA 4XZQC 5B31A 4HGAB 4H9QB 3WA9C 3MGPB 5E5AC 5B32A 5AY8C 4ZUXC 3NQUB 4CAYB 4WU9B 1P3OC 3F6TA 1M19D 5AV8A 3UT9C 3UTAD 5CP6D 1P3MA 4DRAA 4J8VA 5B40B 3AV2B 4LD9D 5B32D 1ID3C 2NQBA 3X1TA 5GXQA 5AV8D 1P3MD 1EQZC 1P3LC 4J8VD 1F66A 1U35A 2NQBD 1A7WA 3R45A 2DQNC 3X1TD 5GT3A 4UPKA 3VH6W 1P3IB 5DNMA 5B24A 3REHC 1U35D 2YFWA 1TZYB 1BH8B 2CWEA 5AY8A 5GT3D 4ZUXA 5DNMD 5B24D 3UT9A 3X1SA 4QLCA 5CPIB 5JA4B 3MGQB 3W96B 3MGSD 1P3AC 3H0MC 3X1SD 4QLCD 3AZND 4WU8D 3LZ0B 5B0ZA 1P3PA 4Z66B 3AZHC 1M1AC 2AROB 5B2JA 3X1UC 3W98A 3AYWA 5B0ZD 3WKJC 2CV5C 1P3PD 4J8XB 5AV9B 5AVBB 2VQRA 5GT0B 5B2JD 3REKA 3MGRB 3AZJC 1ID3B 3W98D 3KUYB 3AYWD 2PYOA 5GSUC 3V9RB 1P3AA 3X1VA 1B67A 1P3LB 3W99C 3REKD 1P3KC 3AZMC 3AZGB 3WTPE 3VH5W 3UTBC 2PYOD 5CPJC 3MVDD 4X23D 4J8UC 3X1VD 3REHB 2ZY5A 3AZKA 1M1AA 1KX3C 3X1UA 3AZKD 3LZ1C 1P3BC 4KGCB 3A6NC 1H3OB 3O62C 2IO5C 4XUJA 1KX4C 5AV6C 1TAFA 3UTBA 3KFUG 3AZFA 4G92B 3B6FC 3REJB 3AZHB 4XUJD 3MNNC 2HUEB 2Y2OA 3AZFD 3AFAA 1ULYA 1P34C 2Y2GA 3AZJB 3EG5B 5B0YB 5B1MC 4J8WD 3A6NA 1M18D 2Y2LA 3W99B 3O62A 1P3KB 3AZMB 1KX4A 3FDDA 2NZDB 5CPJB 3B0DC 4J8UB 1HQ3A 4YM6A 1KX3B 3KXBC 2Y2QA 1ZLAA 5DNNB 4HGAC 5B2IB 1N1JB 2F8NB 5B33A 1HQ3D 3LZ1B 4YM6D 3MGPC 1P3BB 3C1CB 3REIA 1AOIC 1ZLAD 3W97C 1KU5A 2IO5B 3AN2D 5B1LB 5B40C 5AV6B 3REID 1P3GA 4KUDD 5AVCA 4H9OB 3KWQD 1P3GD 1P3IC 1P34B 5AVCD 1S32B 3C1BB 1TZYC 4NE5A 2HIOC 4CAYA 4WU9A 5CPKA 4DRBA 5B40A 3LELB 3AV2A 3MGQC 3B0DB 5CPKD 3WTPB 4R8PB 5BT1C 2Y2JA 2YFVA 4YS3A 1P3FC 3AV2D 4EO5C 1KX5B 2F8NK 4KHAB 3LZ0C 4JJNB 1F1EA 2RVQD 1P3IA 4YS3D 2AROC 2F8NG 5JRGA 3WAAB 1TZYA 1BH8A 3LJAD 1AOIB 4LD9C 4Z5TB 4J8XC 5AV9C 3W97B 5B31D 5AVBC 5BS7C 4WNNB 5GT0C 1BFMA 3MGRC 5JRGD 3KUYC 5CPIA 1BH9A 3W96A 4NE6A 4ZBJC 5G49A 2FJ7B 3AZGC 4DQYB 4CSRA 5GXQD 3LZ0A 3W96D 1HTAA 4Z66A 1F66D 4XZQA 3WA9A 4H9NB 4H9PB 5E5AA 3TU4B 2HIOB 3AZEB 1P3OA 1W2EA 3AL0C 4Z66D 5AV9A 4XZQD 3WA9D 3MGRA 4KGCC 5E5AD 1ID3A 5BNXA 5AY8D 4ZUXD 1P3OD 5KDMB 3UT9D 1EQZA 3V9RA 1P3LA 1P3FB 4EO5B 2F8NH 2F2AC 5BO0B 1EQZD 4G92C 3REJC 5FUGB 3REHA 3RELC 1M19B 2ZY4A 5CP6B 2HUEC 4LD9B 5B32B 3IP4C 3NQJB 3REHD 5AV8B 5B0YC 2W8SA
chains in the Genus database with same CATH topology
4ZBJB 1H3OA 2NZDC 1U35B 3R45B 1P3AD 3AZLC 5GT3B 3REJA 3AZHA 3B6GC 3WKJA 2YFWB 2CV5A 5DNNC 5B2IC 3AZHD 1M1AD 3MGSB 3AZJA 3X1UD 3C1CC 3AZIC 1WWSA 3WKJD 3X1SB 3AZNB 2CV5D 2BYKB 5GSUA 4WU8B 2DF4C 5B1LC 3W99A 1P3KA 3AZJD 3AZMA 4G91C 4H9RB 5CPJA 5GSUD 4J8UA 5B0ZB 3RELB 1P3KD 3AZMD 1KX3A 3UTBD 3W98B 4J8UD 5B32G 3AYWB 5B2IA 1S32C 1N1JA 3LZ1A 1P3BA 3C1BC 4NFTA 1KX3D 1M18C 3C1CA 3REKB 3AFAD 2PYOB 3MVDB 2UWXA 4X23B 3LZ1D 3LELC 5AV6A 2BYMA 3A6ND 4M6BA 3WTPC 3AZLB 4R8PC 3O62D 3B6FA 3MNNA 1KX4D 1KX5C 2Y2KA 5AV6D 4H9OA 4JJNC 4WV4B 2BG1A 5BNVB 3AZKB 3B6GB 3B6FD 1P34A 3MNND 3WAAC 3AZIB 3C1BA 5B1MA 4Z5TC 1P34D 5B33D 4KUDC 4G91B 5B1MD 1T3UA 5AV5C 3WTPA 3KWQC 4R8PA 1TAFB 2JCHA 2FJ7C 4KHAA 3KXBA 3AV1C 4J8WB 4H9QA 5F99C 3MGPA 1M18B 3TU4C 3NQUA 3KXBD 3AZEC 2RIQA 1AOIA 4Z5TA 3W97A 3P5JB 4WNNA 3MGPD 4UUZB 4WU9D 1WWIA 1AOID 3W97D 3EPLA 5B40D 1HQ3B 2XD1A 4E45A 1M19C 1ZLAB 4H9PA 4H9NA 5CP6C 3UTAC 3AN2B 2HIOA 5B32C 1P3ID 5AV8C 1P3MC 4KUDB 1TZYD 4J8VC 5JA4A 3MGQA 3EPKA 2NQBC 5AV5B 5KDMA 3X1TC 3KWQB 4H9SC 1P3GB 1P3FA 2Y2MA 1Q9CA 5CPID 1F66C 3MGQD 1U35C 3AV1B 5GT3C 1JFIB 5BT1D 2AROA 2JSSA 5FUGA 5DNMC 5B24C 5F99B 5CP6A 3LZ0D 4LD9A 4J8XA 3A1KA 1B6WA 5AVBA 5CPKB 5BS7A 5GT0A 2AROD 3MGSC 3NQJA 3KUYA 3X1SC 4QLCC 3AZNC 4J8XD 5AV9D 4WU8C 5AVBD 5GT0D 4H9SA 3MGRD 3AZGA 1ID3D 3KUYD 2YFVB 4YS3B 2ZY3A 4AWLC 5CHLB 3LJAB 5B0ZC 1P3LD 1P3PC 3AZGD 3UTAB 1PZRA 5B31B 3VH5A 5B2JC 2L5AA 5JRGB 4WJ3C 3W98C 3AYWC 1P3MB 3MGSA 4KGCA 4J8VB 3REKC 2Y2HA 2NQBB 3AZNA 3X1TB 2BYKA 5GXQB 2PYOC 4WU8A 1BH9B 3MVDC 4X23C 5G49B 3X1VC 1F66B 4KGCD 3B0CT 4H9RA 4CSRB 2Y2PA 2G5IC 5DNMB 5B24B 3RELA 4XZQB 3AZKC 3WA9B 5E5AB 5AY8B 4ZUXB 3REJD 1P3OB 3RELD 5B0YA 3UT9B 4QLCB 5BNXB 3MVDA 5B0YD 4X23A 1EQZB 4XUJC 4NE3A 2NZDA 4AWLB 3AZLA 3W99D 1P3PB 3AZFC 3A1IA 5B31G 5B2JB 3B0BA 2NZDD 5CPJD 5BNVA 3B6GA 5DNNA 3AZLD 4J8WC 2F8NA 3AFAC 4Z2MG 3AZIA 3B6GD 2Y2IA 5DNND 5B2ID 2ZY2A 5B1LA 1P3BD 2F8ND 1P3AB 3X1VB 3C1CD 3AZID 4E44A 3KSYA 5B1LD 5C3IC 1M1AB 1HQ3C 4YM6C 3X1UB 3WKJB 4J8WA 1S32A 2CV5B 1ZLAC 3AN2C 1M18A 5B33C 3H0RC 3REIC 1S32D 5GSUB 3LELA 3C1BD 4XUJB 3VH6T 4UUZA 2J8PA 3UTBB 3AZFB 1P3GC 3LELD 5AVCC 1KX5A 4JJNA 2LY8A 4Z2MH 3WTPD 4R8PD 2FFFB 3H0LC 3AFAB 3B0CW 1KX5D 3WAAA 4JJND 3AN2A 5CPKC 4WU9C 1Z2CB 3A6NB 3WAAD 4KUDA 3O62B 1KX4B 3AV2C 4Z5TD 5AV5A 2BYMB 3KWQA 2FJ7A 2RVQC 5C3IB 2Y2NA 3B6FB 4YS3C 2ZM5A 3MNNB 3EPJA 4YM6B 4WZSB 5AV5D 3AV1A 3LJAC 3EPHA 2FJ7D 1JFIA 5B31C 5F99A 5B33B 3VH6A 3TU4A 5JRGC 3AZEA 3REIB 3AV1D 5B1MB 3VH5T 5F99D 3TU4D 2HIOD 3AZED 5CPIC 2XD5A 2G5HC 5GXQC 1R4VA 3W96C 5AVCB 2JE5A 5BO0A 3KXBB 3LJAA 1P3FD 1M19A 4Z66C 3UTAA 4XZQC 5B31A 4HGAB 4H9QB 3WA9C 3MGPB 5E5AC 5B32A 5AY8C 4ZUXC 3NQUB 4CAYB 4WU9B 1P3OC 3F6TA 1M19D 5AV8A 3UT9C 3UTAD 5CP6D 1P3MA 4DRAA 4J8VA 5B40B 3AV2B 4LD9D 5B32D 1ID3C 2NQBA 3X1TA 5GXQA 5AV8D 1P3MD 1EQZC 1P3LC 4J8VD 1F66A 1U35A 2NQBD 1A7WA 3R45A 2DQNC 3X1TD 5GT3A 4UPKA 3VH6W 1P3IB 5DNMA 5B24A 3REHC 1U35D 2YFWA 1TZYB 1BH8B 2CWEA 5AY8A 5GT3D 4ZUXA 5DNMD 5B24D 3UT9A 3X1SA 4QLCA 5CPIB 5JA4B 3MGQB 3W96B 3MGSD 1P3AC 3H0MC 3X1SD 4QLCD 3AZND 4WU8D 3LZ0B 5B0ZA 1P3PA 4Z66B 3AZHC 1M1AC 2AROB 5B2JA 3X1UC 3W98A 3AYWA 5B0ZD 3WKJC 2CV5C 1P3PD 4J8XB 5AV9B 5AVBB 2VQRA 5GT0B 5B2JD 3REKA 3MGRB 3AZJC 1ID3B 3W98D 3KUYB 3AYWD 2PYOA 5GSUC 3V9RB 1P3AA 3X1VA 1B67A 1P3LB 3W99C 3REKD 1P3KC 3AZMC 3AZGB 3WTPE 3VH5W 3UTBC 2PYOD 5CPJC 3MVDD 4X23D 4J8UC 3X1VD 3REHB 2ZY5A 3AZKA 1M1AA 1KX3C 3X1UA 3AZKD 3LZ1C 1P3BC 4KGCB 3A6NC 1H3OB 3O62C 2IO5C 4XUJA 1KX4C 5AV6C 1TAFA 3UTBA 3KFUG 3AZFA 4G92B 3B6FC 3REJB 3AZHB 4XUJD 3MNNC 2HUEB 2Y2OA 3AZFD 3AFAA 1ULYA 1P34C 2Y2GA 3AZJB 3EG5B 5B0YB 5B1MC 4J8WD 3A6NA 1M18D 2Y2LA 3W99B 3O62A 1P3KB 3AZMB 1KX4A 3FDDA 2NZDB 5CPJB 3B0DC 4J8UB 1HQ3A 4YM6A 1KX3B 3KXBC 2Y2QA 1ZLAA 5DNNB 4HGAC 5B2IB 1N1JB 2F8NB 5B33A 1HQ3D 3LZ1B 4YM6D 3MGPC 1P3BB 3C1CB 3REIA 1AOIC 1ZLAD 3W97C 1KU5A 2IO5B 3AN2D 5B1LB 5B40C 5AV6B 3REID 1P3GA 4KUDD 5AVCA 4H9OB 3KWQD 1P3GD 1P3IC 1P34B 5AVCD 1S32B 3C1BB 1TZYC 4NE5A 2HIOC 4CAYA 4WU9A 5CPKA 4DRBA 5B40A 3LELB 3AV2A 3MGQC 3B0DB 5CPKD 3WTPB 4R8PB 5BT1C 2Y2JA 2YFVA 4YS3A 1P3FC 3AV2D 4EO5C 1KX5B 2F8NK 4KHAB 3LZ0C 4JJNB 1F1EA 2RVQD 1P3IA 4YS3D 2AROC 2F8NG 5JRGA 3WAAB 1TZYA 1BH8A 3LJAD 1AOIB 4LD9C 4Z5TB 4J8XC 5AV9C 3W97B 5B31D 5AVBC 5BS7C 4WNNB 5GT0C 1BFMA 3MGRC 5JRGD 3KUYC 5CPIA 1BH9A 3W96A 4NE6A 4ZBJC 5G49A 2FJ7B 3AZGC 4DQYB 4CSRA 5GXQD 3LZ0A 3W96D 1HTAA 4Z66A 1F66D 4XZQA 3WA9A 4H9NB 4H9PB 5E5AA 3TU4B 2HIOB 3AZEB 1P3OA 1W2EA 3AL0C 4Z66D 5AV9A 4XZQD 3WA9D 3MGRA 4KGCC 5E5AD 1ID3A 5BNXA 5AY8D 4ZUXD 1P3OD 5KDMB 3UT9D 1EQZA 3V9RA 1P3LA 1P3FB 4EO5B 2F8NH 2F2AC 5BO0B 1EQZD 4G92C 3REJC 5FUGB 3REHA 3RELC 1M19B 2ZY4A 5CP6B 2HUEC 4LD9B 5B32B 3IP4C 3NQJB 3REHD 5AV8B 5B0YC 2W8SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZBJ B;  1H3O A;  2NZD C;  1U35 B;  3R45 B;  1P3A D;  3AZL C;  5GT3 B;  3REJ A;  3AZH A;  3B6G C;  3WKJ A;  2YFW B;  2CV5 A;  5DNN C;  5B2I C;  3AZH D;  1M1A D;  3MGS B;  3AZJ A;  3X1U D;  3C1C C;  3AZI C;  1WWS A;  3WKJ D;  3X1S B;  3AZN B;  2CV5 D;  2BYK B;  5GSU A;  4WU8 B;  5B1L C;  3W99 A;  1P3K A;  3AZJ D;  3AZM A;  4G91 C;  4H9R B;  5CPJ A;  5GSU D;  4J8U A;  5B0Z B;  3REL B;  1P3K D;  3AZM D;  1KX3 A;  3UTB D;  3W98 B;  4J8U D;  5B32 G;  3AYW B;  5B2I A;  1S32 C;  1N1J A;  3LZ1 A;  1P3B A;  3C1B C;  4NFT A;  1KX3 D;  1M18 C;  3C1C A;  3REK B;  3AFA D;  2PYO B;  3MVD B;  4X23 B;  3LZ1 D;  3LEL C;  5AV6 A;  2BYM A;  3A6N D;  4M6B A;  3WTP C;  3AZL B;  4R8P C;  3O62 D;  3B6F A;  3MNN A;  1KX4 D;  1KX5 C;  5AV6 D;  4H9O A;  4JJN C;  4WV4 B;  5BNV B;  3AZK B;  3B6G B;  3B6F D;  1P34 A;  3MNN D;  3WAA C;  3AZI B;  3C1B A;  5B1M A;  4Z5T C;  1P34 D;  5B33 D;  4KUD C;  4G91 B;  5B1M D;  5AV5 C;  3WTP A;  3KWQ C;  4R8P A;  1TAF B;  2FJ7 C;  4KHA A;  3KXB A;  3AV1 C;  4J8W B;  4H9Q A;  5F99 C;  3MGP A;  1M18 B;  3TU4 C;  3NQU A;  3KXB D;  3AZE C;  1AOI A;  4Z5T A;  3W97 A;  4WNN A;  3MGP D;  4UUZ B;  4WU9 D;  1WWI A;  1AOI D;  3W97 D;  5B40 D;  1HQ3 B;  4E45 A;  1M19 C;  1ZLA B;  4H9P A;  4H9N A;  5CP6 C;  3UTA C;  3AN2 B;  2HIO A;  5B32 C;  1P3I D;  5AV8 C;  1P3M C;  4KUD B;  1TZY D;  4J8V C;  5JA4 A;  3MGQ A;  2NQB C;  5AV5 B;  5KDM A;  3X1T C;  3KWQ B;  4H9S C;  1P3G B;  1P3F A;  5CPI D;  1Q9C A;  1F66 C;  3MGQ D;  1U35 C;  3AV1 B;  5GT3 C;  1JFI B;  5BT1 D;  2ARO A;  2JSS A;  5FUG A;  5DNM C;  5B24 C;  5F99 B;  5CP6 A;  3LZ0 D;  4LD9 A;  4J8X A;  1B6W A;  5AVB A;  5CPK B;  5BS7 A;  5GT0 A;  2ARO D;  3MGS C;  3NQJ A;  3KUY A;  3X1S C;  4QLC C;  3AZN C;  4J8X D;  5AV9 D;  4WU8 C;  5AVB D;  5GT0 D;  4H9S A;  3MGR D;  3AZG A;  1ID3 D;  3KUY D;  2YFV B;  4YS3 B;  4AWL C;  5CHL B;  3LJA B;  5B0Z C;  1P3L D;  1P3P C;  3AZG D;  3UTA B;  5B31 B;  3VH5 A;  5B2J C;  2L5A A;  5JRG B;  3W98 C;  3AYW C;  1P3M B;  3MGS A;  4KGC A;  4J8V B;  3REK C;  2NQB B;  3AZN A;  3X1T B;  2BYK A;  5GXQ B;  2PYO C;  4WU8 A;  1BH9 B;  3MVD C;  4X23 C;  5G49 B;  3X1V C;  1F66 B;  4KGC D;  3B0C T;  4H9R A;  4CSR B;  5DNM B;  5B24 B;  3REL A;  4XZQ B;  3AZK C;  3WA9 B;  5E5A B;  5AY8 B;  4ZUX B;  3REJ D;  1P3O B;  3REL D;  5B0Y A;  3UT9 B;  4QLC B;  5BNX B;  3MVD A;  5B0Y D;  4X23 A;  1EQZ B;  4XUJ C;  4NE3 A;  2NZD A;  4AWL B;  3AZL A;  3W99 D;  1P3P B;  3AZF C;  5B31 G;  5B2J B;  3B0B A;  2NZD D;  5CPJ D;  5BNV A;  3B6G A;  5DNN A;  3AZL D;  4J8W C;  2F8N A;  3AFA C;  4Z2M G;  3AZI A;  3B6G D;  5DNN D;  5B2I D;  5B1L A;  1P3B D;  2F8N D;  1P3A B;  3X1V B;  3C1C D;  3AZI D;  4E44 A;  3KSY A;  5B1L D;  5C3I C;  1M1A B;  1HQ3 C;  4YM6 C;  3X1U B;  3WKJ B;  4J8W A;  1S32 A;  2CV5 B;  1ZLA C;  3AN2 C;  1M18 A;  5B33 C;  3REI C;  1S32 D;  5GSU B;  3LEL A;  3C1B D;  4XUJ B;  3VH6 T;  4UUZ A;  3UTB B;  3AZF B;  1P3G C;  3LEL D;  5AVC C;  1KX5 A;  4JJN A;  2LY8 A;  4Z2M H;  3WTP D;  4R8P D;  3AFA B;  3B0C W;  1KX5 D;  3WAA A;  4JJN D;  3AN2 A;  5CPK C;  4WU9 C;  3A6N B;  3WAA D;  4KUD A;  3O62 B;  1KX4 B;  3AV2 C;  4Z5T D;  5AV5 A;  2BYM B;  3KWQ A;  2FJ7 A;  2RVQ C;  5C3I B;  3B6F B;  4YS3 C;  3MNN B;  4YM6 B;  4WZS B;  5AV5 D;  3AV1 A;  3LJA C;  2FJ7 D;  1JFI A;  5B31 C;  5F99 A;  5B33 B;  3VH6 A;  3TU4 A;  5JRG C;  3AZE A;  3REI B;  3AV1 D;  5B1M B;  3VH5 T;  5F99 D;  3TU4 D;  2HIO D;  3AZE D;  5CPI C;  5GXQ C;  1R4V A;  3W96 C;  5AVC B;  5BO0 A;  3KXB B;  3LJA A;  1P3F D;  1M19 A;  4Z66 C;  3UTA A;  4XZQ C;  5B31 A;  4HGA B;  4H9Q B;  3WA9 C;  3MGP B;  5E5A C;  5B32 A;  5AY8 C;  4ZUX C;  3NQU B;  4CAY B;  4WU9 B;  1P3O C;  1M19 D;  5AV8 A;  3UT9 C;  3UTA D;  5CP6 D;  1P3M A;  4DRA A;  4J8V A;  5B40 B;  3AV2 B;  4LD9 D;  5B32 D;  1ID3 C;  2NQB A;  3X1T A;  5GXQ A;  5AV8 D;  1P3M D;  1EQZ C;  1P3L C;  4J8V D;  1F66 A;  1U35 A;  2NQB D;  1A7W A;  3R45 A;  3X1T D;  5GT3 A;  3VH6 W;  1P3I B;  5DNM A;  5B24 A;  3REH C;  1U35 D;  2YFW A;  1TZY B;  1BH8 B;  2CWE A;  5AY8 A;  5GT3 D;  4ZUX A;  5DNM D;  5B24 D;  3UT9 A;  3X1S A;  4QLC A;  5CPI B;  5JA4 B;  3MGQ B;  3W96 B;  3MGS D;  1P3A C;  3X1S D;  4QLC D;  3AZN D;  4WU8 D;  3LZ0 B;  5B0Z A;  1P3P A;  4Z66 B;  3AZH C;  1M1A C;  2ARO B;  5B2J A;  3X1U C;  3W98 A;  3AYW A;  5B0Z D;  3WKJ C;  2CV5 C;  1P3P D;  4J8X B;  5AV9 B;  5AVB B;  5GT0 B;  3REK A;  5B2J D;  3AZJ C;  3MGR B;  1ID3 B;  3W98 D;  3KUY B;  3AYW D;  2PYO A;  5GSU C;  3V9R B;  1P3A A;  3X1V A;  1B67 A;  1P3L B;  3W99 C;  3REK D;  1P3K C;  3AZM C;  3AZG B;  3WTP E;  3VH5 W;  3UTB C;  2PYO D;  5CPJ C;  3MVD D;  4X23 D;  4J8U C;  3X1V D;  3REH B;  3AZK A;  1M1A A;  1KX3 C;  3X1U A;  3AZK D;  3LZ1 C;  1P3B C;  4KGC B;  3A6N C;  1H3O B;  3O62 C;  2IO5 C;  4XUJ A;  1KX4 C;  5AV6 C;  1TAF A;  3UTB A;  3AZF A;  4G92 B;  3B6F C;  3REJ B;  3AZH B;  4XUJ D;  3MNN C;  2HUE B;  3AZF D;  3AFA A;  1ULY A;  1P34 C;  3AZJ B;  5B0Y B;  5B1M C;  4J8W D;  3A6N A;  1M18 D;  3W99 B;  3O62 A;  1P3K B;  3AZM B;  1KX4 A;  2NZD B;  5CPJ B;  3B0D C;  4J8U B;  1HQ3 A;  4YM6 A;  1KX3 B;  3KXB C;  1ZLA A;  5DNN B;  4HGA C;  5B2I B;  1N1J B;  2F8N B;  5B33 A;  1HQ3 D;  3LZ1 B;  4YM6 D;  3MGP C;  1P3B B;  3C1C B;  3REI A;  1AOI C;  1ZLA D;  3W97 C;  1KU5 A;  2IO5 B;  3AN2 D;  5B1L B;  5B40 C;  5AV6 B;  3REI D;  1P3G A;  4KUD D;  5AVC A;  4H9O B;  3KWQ D;  1P3G D;  1P3I C;  1P34 B;  5AVC D;  1S32 B;  3C1B B;  1TZY C;  4NE5 A;  2HIO C;  4CAY A;  4WU9 A;  5CPK A;  4DRB A;  5B40 A;  3LEL B;  3AV2 A;  3MGQ C;  3B0D B;  5CPK D;  3WTP B;  4R8P B;  5BT1 C;  2YFV A;  4YS3 A;  1P3F C;  3AV2 D;  4EO5 C;  1KX5 B;  2F8N K;  4KHA B;  3LZ0 C;  4JJN B;  1F1E A;  2RVQ D;  1P3I A;  4YS3 D;  2ARO C;  2F8N G;  5JRG A;  3WAA B;  1TZY A;  1BH8 A;  3LJA D;  1AOI B;  4LD9 C;  4Z5T B;  4J8X C;  5AV9 C;  3W97 B;  5B31 D;  5AVB C;  5BS7 C;  4WNN B;  5GT0 C;  1BFM A;  3MGR C;  5JRG D;  3KUY C;  5CPI A;  1BH9 A;  3W96 A;  4NE6 A;  4ZBJ C;  5G49 A;  2FJ7 B;  3AZG C;  4CSR A;  5GXQ D;  3LZ0 A;  3W96 D;  1HTA A;  4Z66 A;  1F66 D;  4XZQ A;  3WA9 A;  4H9P B;  4H9N B;  5E5A A;  3TU4 B;  2HIO B;  3AZE B;  1P3O A;  4Z66 D;  5AV9 A;  4XZQ D;  3WA9 D;  3MGR A;  4KGC C;  5E5A D;  1ID3 A;  5BNX A;  5AY8 D;  4ZUX D;  1P3O D;  5KDM B;  3UT9 D;  1EQZ A;  3V9R A;  1P3L A;  1P3F B;  4EO5 B;  2F8N H;  5BO0 B;  1EQZ D;  4G92 C;  3REJ C;  5FUG B;  3REH A;  3REL C;  1M19 B;  5CP6 B;  2HUE C;  4LD9 B;  5B32 B;  3REH D;  3NQJ B;  5AV8 B;  5B0Y C; 
#chains in the Genus database with same CATH topology
 4ZBJ B;  1H3O A;  2NZD C;  1U35 B;  3R45 B;  1P3A D;  3AZL C;  5GT3 B;  3REJ A;  3AZH A;  3B6G C;  3WKJ A;  2YFW B;  2CV5 A;  5DNN C;  5B2I C;  3AZH D;  1M1A D;  3MGS B;  3AZJ A;  3X1U D;  3C1C C;  3AZI C;  1WWS A;  3WKJ D;  3X1S B;  3AZN B;  2CV5 D;  2BYK B;  5GSU A;  4WU8 B;  2DF4 C;  5B1L C;  3W99 A;  1P3K A;  3AZJ D;  3AZM A;  4G91 C;  4H9R B;  5CPJ A;  5GSU D;  4J8U A;  5B0Z B;  3REL B;  1P3K D;  3AZM D;  1KX3 A;  3UTB D;  3W98 B;  4J8U D;  5B32 G;  3AYW B;  5B2I A;  1S32 C;  1N1J A;  3LZ1 A;  1P3B A;  3C1B C;  4NFT A;  1KX3 D;  1M18 C;  3C1C A;  3REK B;  3AFA D;  2PYO B;  3MVD B;  2UWX A;  4X23 B;  3LZ1 D;  3LEL C;  5AV6 A;  2BYM A;  3A6N D;  4M6B A;  3WTP C;  3AZL B;  4R8P C;  3O62 D;  3B6F A;  3MNN A;  1KX4 D;  1KX5 C;  2Y2K A;  5AV6 D;  4H9O A;  4JJN C;  4WV4 B;  2BG1 A;  5BNV B;  3AZK B;  3B6G B;  3B6F D;  1P34 A;  3MNN D;  3WAA C;  3AZI B;  3C1B A;  5B1M A;  4Z5T C;  1P34 D;  5B33 D;  4KUD C;  4G91 B;  5B1M D;  1T3U A;  5AV5 C;  3WTP A;  3KWQ C;  4R8P A;  1TAF B;  2JCH A;  2FJ7 C;  4KHA A;  3KXB A;  3AV1 C;  4J8W B;  4H9Q A;  5F99 C;  3MGP A;  1M18 B;  3TU4 C;  3NQU A;  3KXB D;  3AZE C;  2RIQ A;  1AOI A;  4Z5T A;  3W97 A;  3P5J B;  4WNN A;  3MGP D;  4UUZ B;  4WU9 D;  1WWI A;  1AOI D;  3W97 D;  3EPL A;  5B40 D;  1HQ3 B;  2XD1 A;  4E45 A;  1M19 C;  1ZLA B;  4H9P A;  4H9N A;  5CP6 C;  3UTA C;  3AN2 B;  2HIO A;  5B32 C;  1P3I D;  5AV8 C;  1P3M C;  4KUD B;  1TZY D;  4J8V C;  5JA4 A;  3MGQ A;  3EPK A;  2NQB C;  5AV5 B;  5KDM A;  3X1T C;  3KWQ B;  4H9S C;  1P3G B;  1P3F A;  2Y2M A;  1Q9C A;  5CPI D;  1F66 C;  3MGQ D;  1U35 C;  3AV1 B;  5GT3 C;  1JFI B;  5BT1 D;  2ARO A;  2JSS A;  5FUG A;  5DNM C;  5B24 C;  5F99 B;  5CP6 A;  3LZ0 D;  4LD9 A;  4J8X A;  3A1K A;  1B6W A;  5AVB A;  5CPK B;  5BS7 A;  5GT0 A;  2ARO D;  3MGS C;  3NQJ A;  3KUY A;  3X1S C;  4QLC C;  3AZN C;  4J8X D;  5AV9 D;  4WU8 C;  5AVB D;  5GT0 D;  4H9S A;  3MGR D;  3AZG A;  1ID3 D;  3KUY D;  2YFV B;  4YS3 B;  2ZY3 A;  4AWL C;  5CHL B;  3LJA B;  5B0Z C;  1P3L D;  1P3P C;  3AZG D;  3UTA B;  1PZR A;  5B31 B;  3VH5 A;  5B2J C;  2L5A A;  5JRG B;  4WJ3 C;  3W98 C;  3AYW C;  1P3M B;  3MGS A;  4KGC A;  4J8V B;  3REK C;  2Y2H A;  2NQB B;  3AZN A;  3X1T B;  2BYK A;  5GXQ B;  2PYO C;  4WU8 A;  1BH9 B;  3MVD C;  4X23 C;  5G49 B;  3X1V C;  1F66 B;  4KGC D;  3B0C T;  4H9R A;  4CSR B;  2Y2P A;  2G5I C;  5DNM B;  5B24 B;  3REL A;  4XZQ B;  3AZK C;  3WA9 B;  5E5A B;  5AY8 B;  4ZUX B;  3REJ D;  1P3O B;  3REL D;  5B0Y A;  3UT9 B;  4QLC B;  5BNX B;  3MVD A;  5B0Y D;  4X23 A;  1EQZ B;  4XUJ C;  4NE3 A;  2NZD A;  4AWL B;  3AZL A;  3W99 D;  1P3P B;  3AZF C;  3A1I A;  5B31 G;  5B2J B;  3B0B A;  2NZD D;  5CPJ D;  5BNV A;  3B6G A;  5DNN A;  3AZL D;  4J8W C;  2F8N A;  3AFA C;  4Z2M G;  3AZI A;  3B6G D;  2Y2I A;  5DNN D;  5B2I D;  2ZY2 A;  5B1L A;  1P3B D;  2F8N D;  1P3A B;  3X1V B;  3C1C D;  3AZI D;  4E44 A;  3KSY A;  5B1L D;  5C3I C;  1M1A B;  1HQ3 C;  4YM6 C;  3X1U B;  3WKJ B;  4J8W A;  1S32 A;  2CV5 B;  1ZLA C;  3AN2 C;  1M18 A;  5B33 C;  3H0R C;  3REI C;  1S32 D;  5GSU B;  3LEL A;  3C1B D;  4XUJ B;  3VH6 T;  4UUZ A;  2J8P A;  3UTB B;  3AZF B;  1P3G C;  3LEL D;  5AVC C;  1KX5 A;  4JJN A;  2LY8 A;  4Z2M H;  3WTP D;  4R8P D;  2FFF B;  3H0L C;  3AFA B;  3B0C W;  1KX5 D;  3WAA A;  4JJN D;  3AN2 A;  5CPK C;  4WU9 C;  1Z2C B;  3A6N B;  3WAA D;  4KUD A;  3O62 B;  1KX4 B;  3AV2 C;  4Z5T D;  5AV5 A;  2BYM B;  3KWQ A;  2FJ7 A;  2RVQ C;  5C3I B;  2Y2N A;  3B6F B;  4YS3 C;  2ZM5 A;  3MNN B;  3EPJ A;  4YM6 B;  4WZS B;  5AV5 D;  3AV1 A;  3LJA C;  3EPH A;  2FJ7 D;  1JFI A;  5B31 C;  5F99 A;  5B33 B;  3VH6 A;  3TU4 A;  5JRG C;  3AZE A;  3REI B;  3AV1 D;  5B1M B;  3VH5 T;  5F99 D;  3TU4 D;  2HIO D;  3AZE D;  5CPI C;  2XD5 A;  2G5H C;  5GXQ C;  1R4V A;  3W96 C;  5AVC B;  2JE5 A;  5BO0 A;  3KXB B;  3LJA A;  1P3F D;  1M19 A;  4Z66 C;  3UTA A;  4XZQ C;  5B31 A;  4HGA B;  4H9Q B;  3WA9 C;  3MGP B;  5E5A C;  5B32 A;  5AY8 C;  4ZUX C;  3NQU B;  4CAY B;  4WU9 B;  1P3O C;  3F6T A;  1M19 D;  5AV8 A;  3UT9 C;  3UTA D;  5CP6 D;  1P3M A;  4DRA A;  4J8V A;  5B40 B;  3AV2 B;  4LD9 D;  5B32 D;  1ID3 C;  2NQB A;  3X1T A;  5GXQ A;  5AV8 D;  1P3M D;  1EQZ C;  1P3L C;  4J8V D;  1F66 A;  1U35 A;  2NQB D;  1A7W A;  3R45 A;  2DQN C;  3X1T D;  5GT3 A;  4UPK A;  3VH6 W;  1P3I B;  5DNM A;  5B24 A;  3REH C;  1U35 D;  2YFW A;  1TZY B;  1BH8 B;  2CWE A;  5AY8 A;  5GT3 D;  4ZUX A;  5DNM D;  5B24 D;  3UT9 A;  3X1S A;  4QLC A;  5CPI B;  5JA4 B;  3MGQ B;  3W96 B;  3MGS D;  1P3A C;  3H0M C;  3X1S D;  4QLC D;  3AZN D;  4WU8 D;  3LZ0 B;  5B0Z A;  1P3P A;  4Z66 B;  3AZH C;  1M1A C;  2ARO B;  5B2J A;  3X1U C;  3W98 A;  3AYW A;  5B0Z D;  3WKJ C;  2CV5 C;  1P3P D;  4J8X B;  5AV9 B;  5AVB B;  2VQR A;  5GT0 B;  5B2J D;  3REK A;  3MGR B;  3AZJ C;  1ID3 B;  3W98 D;  3KUY B;  3AYW D;  2PYO A;  5GSU C;  3V9R B;  1P3A A;  3X1V A;  1B67 A;  1P3L B;  3W99 C;  3REK D;  1P3K C;  3AZM C;  3AZG B;  3WTP E;  3VH5 W;  3UTB C;  2PYO D;  5CPJ C;  3MVD D;  4X23 D;  4J8U C;  3X1V D;  3REH B;  2ZY5 A;  3AZK A;  1M1A A;  1KX3 C;  3X1U A;  3AZK D;  3LZ1 C;  1P3B C;  4KGC B;  3A6N C;  1H3O B;  3O62 C;  2IO5 C;  4XUJ A;  1KX4 C;  5AV6 C;  1TAF A;  3UTB A;  3KFU G;  3AZF A;  4G92 B;  3B6F C;  3REJ B;  3AZH B;  4XUJ D;  3MNN C;  2HUE B;  2Y2O A;  3AZF D;  3AFA A;  1ULY A;  1P34 C;  2Y2G A;  3AZJ B;  3EG5 B;  5B0Y B;  5B1M C;  4J8W D;  3A6N A;  1M18 D;  2Y2L A;  3W99 B;  3O62 A;  1P3K B;  3AZM B;  1KX4 A;  3FDD A;  2NZD B;  5CPJ B;  3B0D C;  4J8U B;  1HQ3 A;  4YM6 A;  1KX3 B;  3KXB C;  2Y2Q A;  1ZLA A;  5DNN B;  4HGA C;  5B2I B;  1N1J B;  2F8N B;  5B33 A;  1HQ3 D;  3LZ1 B;  4YM6 D;  3MGP C;  1P3B B;  3C1C B;  3REI A;  1AOI C;  1ZLA D;  3W97 C;  1KU5 A;  2IO5 B;  3AN2 D;  5B1L B;  5B40 C;  5AV6 B;  3REI D;  1P3G A;  4KUD D;  5AVC A;  4H9O B;  3KWQ D;  1P3G D;  1P3I C;  1P34 B;  5AVC D;  1S32 B;  3C1B B;  1TZY C;  4NE5 A;  2HIO C;  4CAY A;  4WU9 A;  5CPK A;  4DRB A;  5B40 A;  3LEL B;  3AV2 A;  3MGQ C;  3B0D B;  5CPK D;  3WTP B;  4R8P B;  5BT1 C;  2Y2J A;  2YFV A;  4YS3 A;  1P3F C;  3AV2 D;  4EO5 C;  1KX5 B;  2F8N K;  4KHA B;  3LZ0 C;  4JJN B;  1F1E A;  2RVQ D;  1P3I A;  4YS3 D;  2ARO C;  2F8N G;  5JRG A;  3WAA B;  1TZY A;  1BH8 A;  3LJA D;  1AOI B;  4LD9 C;  4Z5T B;  4J8X C;  5AV9 C;  3W97 B;  5B31 D;  5AVB C;  5BS7 C;  4WNN B;  5GT0 C;  1BFM A;  3MGR C;  5JRG D;  3KUY C;  5CPI A;  1BH9 A;  3W96 A;  4NE6 A;  4ZBJ C;  5G49 A;  2FJ7 B;  3AZG C;  4DQY B;  4CSR A;  5GXQ D;  3LZ0 A;  3W96 D;  1HTA A;  4Z66 A;  1F66 D;  4XZQ A;  3WA9 A;  4H9N B;  4H9P B;  5E5A A;  3TU4 B;  2HIO B;  3AZE B;  1P3O A;  1W2E A;  3AL0 C;  4Z66 D;  5AV9 A;  4XZQ D;  3WA9 D;  3MGR A;  4KGC C;  5E5A D;  1ID3 A;  5BNX A;  5AY8 D;  4ZUX D;  1P3O D;  5KDM B;  3UT9 D;  1EQZ A;  3V9R A;  1P3L A;  1P3F B;  4EO5 B;  2F8N H;  2F2A C;  5BO0 B;  1EQZ D;  4G92 C;  3REJ C;  5FUG B;  3REH A;  3REL C;  1M19 B;  2ZY4 A;  5CP6 B;  2HUE C;  4LD9 B;  5B32 B;  3IP4 C;  3NQJ B;  3REH D;  5AV8 B;  5B0Y C;  2W8S A; 
#chains in the Genus database with same CATH homology
 4ZBJ B;  1H3O A;  2NZD C;  1U35 B;  3R45 B;  1P3A D;  3AZL C;  5GT3 B;  3REJ A;  3AZH A;  3B6G C;  3WKJ A;  2YFW B;  2CV5 A;  5DNN C;  5B2I C;  3AZH D;  1M1A D;  3MGS B;  3AZJ A;  3X1U D;  3C1C C;  3AZI C;  1WWS A;  3WKJ D;  3X1S B;  3AZN B;  2CV5 D;  2BYK B;  5GSU A;  4WU8 B;  2DF4 C;  5B1L C;  3W99 A;  1P3K A;  3AZJ D;  3AZM A;  4G91 C;  4H9R B;  5CPJ A;  5GSU D;  4J8U A;  5B0Z B;  3REL B;  1P3K D;  3AZM D;  1KX3 A;  3UTB D;  3W98 B;  4J8U D;  5B32 G;  3AYW B;  5B2I A;  1S32 C;  1N1J A;  3LZ1 A;  1P3B A;  3C1B C;  4NFT A;  1KX3 D;  1M18 C;  3C1C A;  3REK B;  3AFA D;  2PYO B;  3MVD B;  2UWX A;  4X23 B;  3LZ1 D;  3LEL C;  5AV6 A;  2BYM A;  3A6N D;  4M6B A;  3WTP C;  3AZL B;  4R8P C;  3O62 D;  3B6F A;  3MNN A;  1KX4 D;  1KX5 C;  2Y2K A;  5AV6 D;  4H9O A;  4JJN C;  4WV4 B;  2BG1 A;  5BNV B;  3AZK B;  3B6G B;  3B6F D;  1P34 A;  3MNN D;  3WAA C;  3AZI B;  3C1B A;  5B1M A;  4Z5T C;  1P34 D;  5B33 D;  4KUD C;  4G91 B;  5B1M D;  1T3U A;  5AV5 C;  3WTP A;  3KWQ C;  4R8P A;  1TAF B;  2JCH A;  2FJ7 C;  4KHA A;  3KXB A;  3AV1 C;  4J8W B;  4H9Q A;  5F99 C;  3MGP A;  1M18 B;  3TU4 C;  3NQU A;  3KXB D;  3AZE C;  2RIQ A;  1AOI A;  4Z5T A;  3W97 A;  3P5J B;  4WNN A;  3MGP D;  4UUZ B;  4WU9 D;  1WWI A;  1AOI D;  3W97 D;  3EPL A;  5B40 D;  1HQ3 B;  2XD1 A;  4E45 A;  1M19 C;  1ZLA B;  4H9P A;  4H9N A;  5CP6 C;  3UTA C;  3AN2 B;  2HIO A;  5B32 C;  1P3I D;  5AV8 C;  1P3M C;  4KUD B;  1TZY D;  4J8V C;  5JA4 A;  3MGQ A;  3EPK A;  2NQB C;  5AV5 B;  5KDM A;  3X1T C;  3KWQ B;  4H9S C;  1P3G B;  1P3F A;  2Y2M A;  1Q9C A;  5CPI D;  1F66 C;  3MGQ D;  1U35 C;  3AV1 B;  5GT3 C;  1JFI B;  5BT1 D;  2ARO A;  2JSS A;  5FUG A;  5DNM C;  5B24 C;  5F99 B;  5CP6 A;  3LZ0 D;  4LD9 A;  4J8X A;  3A1K A;  1B6W A;  5AVB A;  5CPK B;  5BS7 A;  5GT0 A;  2ARO D;  3MGS C;  3NQJ A;  3KUY A;  3X1S C;  4QLC C;  3AZN C;  4J8X D;  5AV9 D;  4WU8 C;  5AVB D;  5GT0 D;  4H9S A;  3MGR D;  3AZG A;  1ID3 D;  3KUY D;  2YFV B;  4YS3 B;  2ZY3 A;  4AWL C;  5CHL B;  3LJA B;  5B0Z C;  1P3L D;  1P3P C;  3AZG D;  3UTA B;  1PZR A;  5B31 B;  3VH5 A;  5B2J C;  2L5A A;  5JRG B;  4WJ3 C;  3W98 C;  3AYW C;  1P3M B;  3MGS A;  4KGC A;  4J8V B;  3REK C;  2Y2H A;  2NQB B;  3AZN A;  3X1T B;  2BYK A;  5GXQ B;  2PYO C;  4WU8 A;  1BH9 B;  3MVD C;  4X23 C;  5G49 B;  3X1V C;  1F66 B;  4KGC D;  3B0C T;  4H9R A;  4CSR B;  2Y2P A;  2G5I C;  5DNM B;  5B24 B;  3REL A;  4XZQ B;  3AZK C;  3WA9 B;  5E5A B;  5AY8 B;  4ZUX B;  3REJ D;  1P3O B;  3REL D;  5B0Y A;  3UT9 B;  4QLC B;  5BNX B;  3MVD A;  5B0Y D;  4X23 A;  1EQZ B;  4XUJ C;  4NE3 A;  2NZD A;  4AWL B;  3AZL A;  3W99 D;  1P3P B;  3AZF C;  3A1I A;  5B31 G;  5B2J B;  3B0B A;  2NZD D;  5CPJ D;  5BNV A;  3B6G A;  5DNN A;  3AZL D;  4J8W C;  2F8N A;  3AFA C;  4Z2M G;  3AZI A;  3B6G D;  2Y2I A;  5DNN D;  5B2I D;  2ZY2 A;  5B1L A;  1P3B D;  2F8N D;  1P3A B;  3X1V B;  3C1C D;  3AZI D;  4E44 A;  3KSY A;  5B1L D;  5C3I C;  1M1A B;  1HQ3 C;  4YM6 C;  3X1U B;  3WKJ B;  4J8W A;  1S32 A;  2CV5 B;  1ZLA C;  3AN2 C;  1M18 A;  5B33 C;  3H0R C;  3REI C;  1S32 D;  5GSU B;  3LEL A;  3C1B D;  4XUJ B;  3VH6 T;  4UUZ A;  2J8P A;  3UTB B;  3AZF B;  1P3G C;  3LEL D;  5AVC C;  1KX5 A;  4JJN A;  2LY8 A;  4Z2M H;  3WTP D;  4R8P D;  2FFF B;  3H0L C;  3AFA B;  3B0C W;  1KX5 D;  3WAA A;  4JJN D;  3AN2 A;  5CPK C;  4WU9 C;  1Z2C B;  3A6N B;  3WAA D;  4KUD A;  3O62 B;  1KX4 B;  3AV2 C;  4Z5T D;  5AV5 A;  2BYM B;  3KWQ A;  2FJ7 A;  2RVQ C;  5C3I B;  2Y2N A;  3B6F B;  4YS3 C;  2ZM5 A;  3MNN B;  3EPJ A;  4YM6 B;  4WZS B;  5AV5 D;  3AV1 A;  3LJA C;  3EPH A;  2FJ7 D;  1JFI A;  5B31 C;  5F99 A;  5B33 B;  3VH6 A;  3TU4 A;  5JRG C;  3AZE A;  3REI B;  3AV1 D;  5B1M B;  3VH5 T;  5F99 D;  3TU4 D;  2HIO D;  3AZE D;  5CPI C;  2XD5 A;  2G5H C;  5GXQ C;  1R4V A;  3W96 C;  5AVC B;  2JE5 A;  5BO0 A;  3KXB B;  3LJA A;  1P3F D;  1M19 A;  4Z66 C;  3UTA A;  4XZQ C;  5B31 A;  4HGA B;  4H9Q B;  3WA9 C;  3MGP B;  5E5A C;  5B32 A;  5AY8 C;  4ZUX C;  3NQU B;  4CAY B;  4WU9 B;  1P3O C;  3F6T A;  1M19 D;  5AV8 A;  3UT9 C;  3UTA D;  5CP6 D;  1P3M A;  4DRA A;  4J8V A;  5B40 B;  3AV2 B;  4LD9 D;  5B32 D;  1ID3 C;  2NQB A;  3X1T A;  5GXQ A;  5AV8 D;  1P3M D;  1EQZ C;  1P3L C;  4J8V D;  1F66 A;  1U35 A;  2NQB D;  1A7W A;  3R45 A;  2DQN C;  3X1T D;  5GT3 A;  4UPK A;  3VH6 W;  1P3I B;  5DNM A;  5B24 A;  3REH C;  1U35 D;  2YFW A;  1TZY B;  1BH8 B;  2CWE A;  5AY8 A;  5GT3 D;  4ZUX A;  5DNM D;  5B24 D;  3UT9 A;  3X1S A;  4QLC A;  5CPI B;  5JA4 B;  3MGQ B;  3W96 B;  3MGS D;  1P3A C;  3H0M C;  3X1S D;  4QLC D;  3AZN D;  4WU8 D;  3LZ0 B;  5B0Z A;  1P3P A;  4Z66 B;  3AZH C;  1M1A C;  2ARO B;  5B2J A;  3X1U C;  3W98 A;  3AYW A;  5B0Z D;  3WKJ C;  2CV5 C;  1P3P D;  4J8X B;  5AV9 B;  5AVB B;  2VQR A;  5GT0 B;  5B2J D;  3REK A;  3MGR B;  3AZJ C;  1ID3 B;  3W98 D;  3KUY B;  3AYW D;  2PYO A;  5GSU C;  3V9R B;  1P3A A;  3X1V A;  1B67 A;  1P3L B;  3W99 C;  3REK D;  1P3K C;  3AZM C;  3AZG B;  3WTP E;  3VH5 W;  3UTB C;  2PYO D;  5CPJ C;  3MVD D;  4X23 D;  4J8U C;  3X1V D;  3REH B;  2ZY5 A;  3AZK A;  1M1A A;  1KX3 C;  3X1U A;  3AZK D;  3LZ1 C;  1P3B C;  4KGC B;  3A6N C;  1H3O B;  3O62 C;  2IO5 C;  4XUJ A;  1KX4 C;  5AV6 C;  1TAF A;  3UTB A;  3KFU G;  3AZF A;  4G92 B;  3B6F C;  3REJ B;  3AZH B;  4XUJ D;  3MNN C;  2HUE B;  2Y2O A;  3AZF D;  3AFA A;  1ULY A;  1P34 C;  2Y2G A;  3AZJ B;  3EG5 B;  5B0Y B;  5B1M C;  4J8W D;  3A6N A;  1M18 D;  2Y2L A;  3W99 B;  3O62 A;  1P3K B;  3AZM B;  1KX4 A;  3FDD A;  2NZD B;  5CPJ B;  3B0D C;  4J8U B;  1HQ3 A;  4YM6 A;  1KX3 B;  3KXB C;  2Y2Q A;  1ZLA A;  5DNN B;  4HGA C;  5B2I B;  1N1J B;  2F8N B;  5B33 A;  1HQ3 D;  3LZ1 B;  4YM6 D;  3MGP C;  1P3B B;  3C1C B;  3REI A;  1AOI C;  1ZLA D;  3W97 C;  1KU5 A;  2IO5 B;  3AN2 D;  5B1L B;  5B40 C;  5AV6 B;  3REI D;  1P3G A;  4KUD D;  5AVC A;  4H9O B;  3KWQ D;  1P3G D;  1P3I C;  1P34 B;  5AVC D;  1S32 B;  3C1B B;  1TZY C;  4NE5 A;  2HIO C;  4CAY A;  4WU9 A;  5CPK A;  4DRB A;  5B40 A;  3LEL B;  3AV2 A;  3MGQ C;  3B0D B;  5CPK D;  3WTP B;  4R8P B;  5BT1 C;  2Y2J A;  2YFV A;  4YS3 A;  1P3F C;  3AV2 D;  4EO5 C;  1KX5 B;  2F8N K;  4KHA B;  3LZ0 C;  4JJN B;  1F1E A;  2RVQ D;  1P3I A;  4YS3 D;  2ARO C;  2F8N G;  5JRG A;  3WAA B;  1TZY A;  1BH8 A;  3LJA D;  1AOI B;  4LD9 C;  4Z5T B;  4J8X C;  5AV9 C;  3W97 B;  5B31 D;  5AVB C;  5BS7 C;  4WNN B;  5GT0 C;  1BFM A;  3MGR C;  5JRG D;  3KUY C;  5CPI A;  1BH9 A;  3W96 A;  4NE6 A;  4ZBJ C;  5G49 A;  2FJ7 B;  3AZG C;  4DQY B;  4CSR A;  5GXQ D;  3LZ0 A;  3W96 D;  1HTA A;  4Z66 A;  1F66 D;  4XZQ A;  3WA9 A;  4H9N B;  4H9P B;  5E5A A;  3TU4 B;  2HIO B;  3AZE B;  1P3O A;  1W2E A;  3AL0 C;  4Z66 D;  5AV9 A;  4XZQ D;  3WA9 D;  3MGR A;  4KGC C;  5E5A D;  1ID3 A;  5BNX A;  5AY8 D;  4ZUX D;  1P3O D;  5KDM B;  3UT9 D;  1EQZ A;  3V9R A;  1P3L A;  1P3F B;  4EO5 B;  2F8N H;  2F2A C;  5BO0 B;  1EQZ D;  4G92 C;  3REJ C;  5FUG B;  3REH A;  3REL C;  1M19 B;  2ZY4 A;  5CP6 B;  2HUE C;  4LD9 B;  5B32 B;  3IP4 C;  3NQJ B;  3REH D;  5AV8 B;  5B0Y C;  2W8S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...