5B1MD

The mouse nucleosome structure containing h3.1
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
94
structure length
94
Chain Sequence
RGRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIASEASRLAHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Testis-Specific Histone Variant H3t Gene Is Essential for Entry into Spermatogenesis
pubmed doi rcsb
source organism Mus musculus
total genus 37
structure length 94
sequence length 94
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b1mD00
5B32C 5DNMD 4R8PB 5B40C 3AZJC 1WWSA 3AZHA 1KX4D 2JSSA 3AZLD 5B32A 2PYOC 5AV8B 5CP6A 5BNXA 5B40A 3AZJA 3TU4A 4WNNB 5B0YD 2PYOA 3LELD 5DNMC 3W97B 4G92C 5B24D 4J8WD 5GSUB 3LJAC 3B0CW 1M18D 1HTAA 2BYMA 4ZUXC 3X1SD 1P3ID 2L5AA 4J8XD 2HUEC 3AFAC 1ID3C 3LJAA 1HQ3B 3MGPD 4ZUXA 3UTAD 3C1BC 3AFAA 1ID3A 1M1AD 1P3AC 3WKJD 3AZMB 1P3PD 2CV5D 1P3IC 4J8XC 5F99B 3W96C 1U35C 4XUJC 3C1BA 3AZFB 5E5AC 5B33C 2NQBB 3MGPC 1P3AA 3WTPB 4J8XA 3KWQB 3W96A 1U35A 4J8UD 4XUJA 3B0BA 5E5AA 5B33A 3KUYA 3MGPA 2CV5C 3VH6W 3MVDB 4H9PB 2FJ7B 5GT0B 1BH8A 5AVCD 5CPID 2CV5A 5AV9C 5AV8D 5B32B 4E45A 5C3IB 3MNNB 1P3KB 5JRGC 3KXBB 5BNXB 3AZJB 5AV9A 3REIB 4X23C 1P3BC 4WU8C 4Z2MG 4KGCC 4WZSB 1B6WA 5AVCC 5JRGA 3UTBD 2HIOD 4WU9D 3AYWB 4X23A 1P3BA 4JJNB 4WU8A 5KDMA 4DRAA 3C1CC 3WAAD 4KGCA 1P3GA 3AZKC 5DNMB 4G92B 4UUZB 4H9RA 1AOID 3MGSD 1KX4B 3C1CA 3AZLB 1KX5C 3AZED 3AZKA 3REHD 1BFMA 4HGAC 4G91C 3REJC 4CAYB 1S32C 3WAAC 5AVBD 2YFVB 5B0YB 1KX5A 3LELB 1P3FD 4LD9D 3R45A 3X1TC 5B31G 5B24B 3REJA 4J8WB 1S32A 3WAAA 1M18B 1P3LC 3X1SB 1P3IB 1JFIB 4J8XB 3W96B 5GXQD 2YFWA 3B0CT 3X1TA 4WV4B 1ZLAD 3NQJA 1P3LA 3WA9D 3MGPB 3UTAB 5FUGB 1P3FC 2RVQC 1EQZC 3AN2C 5G49B 3WKJB 3AZHD 2CV5B 3B6FC 1EQZA 5CP6D 3AN2A 4Z5TD 1TAFA 5B40D 3B6GC 3TU4D 5DNND 3B6FA 4J8UB 2PYOD 4H9OA 5JRGB 3B6GA 3O62D 2IO5C 4XZQD 1M19C 5CP6C 4YM6C 4Z5TC 5AVCB 5CPIB 3VH6T 3TU4C 5B31A 5DNNC 3NQUB 1F66C 4H9RB 3LJAD 1N1JA 1M19A 4ZUXD 4YM6A 4Z5TA 3O62C 5DNNA 5BS7C 3AFAD 5CPJC 3VH6A 1TZYC 1ID3D 4XZQC 1F66A 4NE3A 3AZID 4H9NB 4J8VC 3UTBB 3C1BD 5CPKC 2HIOB 3O62A 4WU9B 5BS7A 5CPJA 1TZYA 4XZQA 3WAAB 1P3AD 5GT3D 4J8VA 1U35D 3W96D 3MGRC 4XUJD 5CPKA 1ULYA 3AV2C 3X1TB 1AOIB 3MGSB 5E5AD 5B33D 3KUYD 3AZIC 3AZEB 1B67A 5AV6D 1P3MC 3MGRA 3REHB 5JA4B 2F8NG 3AV2A 5AVBB 3AZNC 3AZIA 5GT3C 1P3MA 1P3FB 5BNVA 4LD9B 5B2JC 3KUYC 4KHAA 3AZNA 5AV6C 5GT3A 5AV9D 5AV5C 3MGQD 5GXQB 5JRGD 5B2JA 1ZLAB 5AV6A 3WA9B 5AV5A 1Q9CA 4X23D 1P3BD 4WU8D 3REKC 4KGCD 4QLCC 1P3GD 1BH9A 3LZ1C 1A7WA 3MGQC 3A6ND 3AZHB 3V9RA 2IO5B 3C1CD 3REKA 1M19B 4QLCA 5CP6B 3LZ0C 4Z5TB 3AZKD 2NZDD 5B40B 3TU4B 3LZ1A 5DNNB 3MGQA 1KX5D 5AY8C 2PYOB 3LZ0A 1P3GC 2F8NA 3AZGC 3O62B 3A6NC 3REJD 3RELD 1S32D 1TZYB 1P3OD 4XZQB 4Z66C 5AY8A 2BYMB 5B2ID 2NZDC 5B1MD 3X1TD 3AZGA 3A6NA 3LJAB 4NE5A 4Z66A 1P3LD 5B0ZC 4ZUXB 3X1VC 2NZDA 1H3OA 4M6BA 2HUEB 3AFAB 3RELC 1ID3B 1P3OC 4DRBA 5B0ZA 3AZIB 3X1VA 5B2IC 5B1MC 4R8PC 4CSRA 3C1BB 2RVQD 5BNVB 1EQZD 3AN2D 5BT1C 3RELA 1P3OA 1P3AB 5GT3B 5B2IA 5B1MA 4R8PA 3B6FD 1U35B 4XUJB 5CHLB 5E5AB 5B33B 3KUYB 3B6GD 3AV1D 5AV6B 4H9SA 4YS3D 4WNNA 5B1LD 1BH8B 5B31D 2F8NK 3V9RB 1M19D 1HQ3C 4NFTA 4YM6D 5B32G 3AV1C 5AV9B 4YS3C 1F66D 3MGQB 4ZBJC 1WWIA 4EO5C 1HQ3A 5B1LC 3AZMC 3AV1A 5B31C 5F99C 5CPJD 4X23B 4YS3A 1TZYD 1P34C 1P3BB 4KUDD 4WU8B 5KDMB 4KGCB 5B1LA 2NQBC 1P3GB 4J8VD 3WTPC 3AZMA 5CPKD 5F99A 3A6NB 1P34A 3C1CB 2NQBA 3AZKB 2NZDB 3WTPA 3MGRD 4H9QA 3KWQA 3AV2D 2FJ7C 4KUDC 5GT0C 1KX5B 1P3MD 4HGAB 3R45B 4G91B 3REJB 2FJ7A 3RELB 1S32B 1P3OB 4KUDA 5GT0A 3AZND 5C3IC 3MNNC 1P3KC 3KXBC 2AROC 5B2IB 5B1MB 3REIC 2YFWB 1KX3C 5B2JD 3NQJB 3MNNA 1P3KA 1P3LB 3KXBA 2AROA 5AV5D 3AYWC 3REIA 4JJNC 1KX3A 3X1UD 1KU5A 3AYWA 3REKD 1KX4C 4QLCD 4JJNA 1EQZB 3AN2B 3AZLC 1TAFB 5DNMA 3LZ1D 3B6FB 4UUZA 2BYKA 1KX4A 3LZ0D 5B0YC 3KSYA 3AZLA 4H9OB 3X1UC 2F8ND 3LELC 3AV1B 3B6GB 3B0DC 4YS3B 3W99D 4ZBJB 5B24C 5AY8D 4EO5B 4CAYA 4J8WC 3UT9D 5B0YA 5B1LB 2YFVA 1M18C 3X1UA 3X1SC 5BO0A 3LELA 5B31B 3AZGD 1P34B 1N1JB 4Z66D 3WTPE 5B24A 4J8WA 3W98D 4YM6B 1M18A 3UTAC 3VH5T 4H9QB 3X1SA 1P3IA 1JFIA 1F66B 3W99C 5B0ZD 3UT9C 3X1VD 1M1AC 1F1EA 3WKJC 1P3PC 3UTAA 5FUGA 5CPJB 3VH5A 3W99A 4KUDB 3W98C 3UT9A 5G49A 4R8PD 4J8VB 1M1AA 3WKJA 1P3PA 5CPKB 4AWLC 1R4VA 5BT1D 4J8UC 4NE6A 3W98A 2AROB 2LY8A 3MGRB 3AV2B 4J8UA 1KX3B 2CWEA 3W97D 5CPIC 1P3MB 5GSUD 5AV8C 4KHAB 3AZNB 5AVCA 4H9SC 5CPIA 3NQUA 1HQ3D 2BYKB 5B2JB 5AV8A 2F8NH 3W97C 3UTBC 5AV5B 2HIOC 4WU9C 5GSUC 3AZMD 3X1UB 4H9NA 3W97A 5F99D 1BH9B 3VH5W 5BO0B 3B0DB 3UTBA 1P34D 3AZFD 2HIOA 4WU9A 5GSUA 3REKB 3MGSC 4QLCB 1AOIC 2NQBD 3AZEC 3WTPD 3KWQD 3LZ1B 3REHC 1AOIA 3MGSA 3LZ0B 5AVBC 3AZEA 2F8NB 3MVDD 3REHA 5JA4A 3AZFC 2FJ7D 4LD9C 3W99B 5GT0D 5AY8B 3UT9B 5AVBA 1M1AB 3KWQC 1P3PB 3AZGB 1P3FA 5GXQC 3AZFA 4LD9A 5B32D 4Z66B 3MNND 1P3KD 3W98B 3KXBD 2AROD 1ZLAC 3WA9C 4Z2MH 3AZJD 3REID 1H3OB 3MVDC 4AWLB 5GXQA 1KX3D 5B0ZB 3X1VB 1ZLAA 4E44A 3WA9A 3AYWD 4CSRB 3AZHC 3MVDA 4H9PA 4JJND
chains in the Genus database with same CATH superfamily
5B32C 5DNMD 4R8PB 5B40C 3AZJC 1WWSA 3AZHA 1KX4D 2JSSA 3AZLD 5B32A 2PYOC 5AV8B 5CP6A 3EPKA 5BNXA 5B40A 3AZJA 3TU4A 4WNNB 5B0YD 2PYOA 3LELD 5DNMC 3W97B 2VQRA 4G92C 5B24D 3AL0C 4J8WD 5GSUB 3LJAC 3B0CW 1M18D 1HTAA 2BYMA 4ZUXC 3X1SD 1P3ID 2L5AA 4J8XD 2HUEC 3AFAC 1ID3C 3LJAA 1HQ3B 3MGPD 4ZUXA 3P5JB 3UTAD 3C1BC 3AFAA 1ID3A 2Y2QA 1M1AD 1P3AC 3WKJD 3AZMB 1P3PD 2CV5D 1P3IC 4J8XC 5F99B 3W96C 1U35C 4XUJC 3C1BA 3AZFB 5E5AC 5B33C 2NQBB 3MGPC 1P3AA 3WTPB 4J8XA 3KWQB 3W96A 1U35A 4J8UD 4XUJA 3B0BA 2F2AC 5E5AA 5B33A 2UWXA 3KUYA 3MGPA 2CV5C 3VH6W 3MVDB 4H9PB 2FJ7B 5GT0B 1BH8A 5AVCD 5CPID 2DF4C 2CV5A 5AV9C 5AV8D 5B32B 4E45A 5C3IB 3MNNB 1P3KB 5JRGC 3KXBB 5BNXB 2RIQA 3AZJB 5AV9A 2G5IC 3REIB 4X23C 1P3BC 2JE5A 4WU8C 4Z2MG 4KGCC 4WZSB 1B6WA 5AVCC 5JRGA 3UTBD 2HIOD 4WU9D 3AYWB 4X23A 1P3BA 4JJNB 4WU8A 5KDMA 4DRAA 3C1CC 3WAAD 4KGCA 2ZY2A 1P3GA 3AZKC 5DNMB 4G92B 4UUZB 4H9RA 1AOID 3MGSD 1KX4B 3C1CA 3AZLB 1KX5C 3AZED 3AZKA 3REHD 1BFMA 4HGAC 4G91C 3REJC 4CAYB 1S32C 3WAAC 5AVBD 2YFVB 5B0YB 1KX5A 3LELB 2ZY5A 1P3FD 4LD9D 2DQNC 3R45A 3X1TC 5B31G 5B24B 3REJA 4J8WB 1S32A 1PZRA 3WAAA 1M18B 1P3LC 3X1SB 1P3IB 1JFIB 4J8XB 3W96B 2Y2IA 5GXQD 2YFWA 3B0CT 3X1TA 2XD1A 4WV4B 3KFUG 1ZLAD 3NQJA 1P3LA 3WA9D 3MGPB 3UTAB 5FUGB 1P3FC 3EPHA 2RVQC 1EQZC 3AN2C 3FDDA 5G49B 3WKJB 3AZHD 2CV5B 3B6FC 1EQZA 5CP6D 3AN2A 4Z5TD 1TAFA 5B40D 3B6GC 3TU4D 5DNND 3B6FA 4J8UB 2PYOD 4H9OA 5JRGB 3B6GA 3O62D 2IO5C 4XZQD 1M19C 5CP6C 4YM6C 4Z5TC 5AVCB 5CPIB 3VH6T 3TU4C 5B31A 5DNNC 3NQUB 1F66C 4H9RB 3LJAD 1N1JA 1M19A 4ZUXD 4YM6A 4Z5TA 3O62C 5DNNA 5BS7C 3AFAD 5CPJC 3VH6A 1TZYC 1ID3D 4XZQC 1F66A 4NE3A 3AZID 4H9NB 4J8VC 3UTBB 3C1BD 5CPKC 2HIOB 3O62A 4WU9B 5BS7A 5CPJA 1TZYA 4XZQA 3WAAB 1P3AD 5GT3D 4J8VA 1U35D 3W96D 3MGRC 4XUJD 5CPKA 1ULYA 3AV2C 3X1TB 4UPKA 3MGSB 5E5AD 5B33D 1AOIB 3KUYD 3AZIC 3AZEB 1B67A 5AV6D 1P3MC 3MGRA 2W8SA 3REHB 5JA4B 2F8NG 3AV2A 5AVBB 3AZNC 3AZIA 5GT3C 1P3MA 1P3FB 5BNVA 4LD9B 2ZM5A 5B2JC 3KUYC 4KHAA 3AZNA 5AV6C 5GT3A 5AV9D 5AV5C 3MGQD 5GXQB 2Y2JA 1W2EA 5JRGD 5B2JA 1ZLAB 3H0MC 5AV6A 3WA9B 5AV5A 1Q9CA 4X23D 1P3BD 4WU8D 3REKC 4KGCD 4QLCC 1P3GD 1BH9A 3LZ1C 1A7WA 3MGQC 3A6ND 3AZHB 3V9RA 2IO5B 3C1CD 4DQYB 3REKA 1M19B 4QLCA 5CP6B 3LZ0C 4Z5TB 3AZKD 2NZDD 5B40B 3TU4B 3LZ1A 5DNNB 3MGQA 1KX5D 2Y2OA 5AY8C 2PYOB 3LZ0A 1P3GC 3EPLA 2F8NA 2G5HC 3AZGC 3O62B 3A6NC 3REJD 2Y2GA 3RELD 1S32D 1TZYB 1P3OD 4XZQB 4Z66C 5AY8A 2BYMB 5B2ID 2NZDC 5B1MD 3X1TD 3AZGA 3A6NA 3LJAB 4NE5A 4Z66A 1P3LD 5B0ZC 4ZUXB 3X1VC 2NZDA 3IP4C 1H3OA 2J8PA 4M6BA 2HUEB 3AFAB 3RELC 1ID3B 1P3OC 4DRBA 5B0ZA 3AZIB 3X1VA 5B2IC 5B1MC 4R8PC 4CSRA 3C1BB 2RVQD 5BNVB 1EQZD 3AN2D 2XD5A 5BT1C 3RELA 1P3OA 1P3AB 5GT3B 5B2IA 5B1MA 4R8PA 3B6FD 1U35B 4XUJB 5CHLB 5E5AB 5B33B 3KUYB 3B6GD 3AV1D 5AV6B 4H9SA 2Y2PA 4YS3D 4WNNA 5B1LD 1BH8B 2BG1A 5B31D 2F8NK 3V9RB 1M19D 1HQ3C 4NFTA 4YM6D 3EPJA 5B32G 3AV1C 5AV9B 4YS3C 1F66D 3MGQB 4ZBJC 1WWIA 4EO5C 1HQ3A 5B1LC 3AZMC 2JCHA 3AV1A 5B31C 2Y2LA 5F99C 5CPJD 4X23B 4YS3A 1TZYD 1P34C 1P3BB 2ZY4A 4KUDD 4WU8B 5KDMB 4KGCB 1T3UA 5B1LA 2NQBC 1P3GB 4J8VD 3WTPC 3AZMA 5CPKD 5F99A 2Y2MA 3A6NB 1P34A 3C1CB 2NQBA 3AZKB 2NZDB 3WTPA 3MGRD 4H9QA 3KWQA 3AV2D 2FJ7C 4KUDC 5GT0C 1KX5B 1P3MD 4HGAB 3R45B 4G91B 3REJB 2FJ7A 3RELB 1S32B 1P3OB 4KUDA 5GT0A 3AZND 5C3IC 3MNNC 1P3KC 3KXBC 2AROC 5B2IB 5B1MB 3REIC 2YFWB 1KX3C 5B2JD 3NQJB 3MNNA 1P3KA 1P3LB 3KXBA 2AROA 5AV5D 3AYWC 3REIA 3A1KA 4JJNC 1KX3A 3X1UD 1KU5A 3AYWA 3REKD 1KX4C 4QLCD 4JJNA 1EQZB 3AN2B 3AZLC 1TAFB 4WJ3C 5DNMA 3LZ1D 3B6FB 4UUZA 2BYKA 1KX4A 3LZ0D 5B0YC 3KSYA 3AZLA 4H9OB 3X1UC 2F8ND 3LELC 3AV1B 3B6GB 3B0DC 4YS3B 3W99D 4ZBJB 5B24C 5AY8D 4EO5B 4CAYA 4J8WC 3UT9D 5B0YA 5B1LB 2YFVA 1M18C 2Y2KA 3X1UA 3X1SC 3A1IA 5BO0A 3LELA 5B31B 3AZGD 1P34B 1N1JB 4Z66D 3WTPE 5B24A 4J8WA 3W98D 4YM6B 1M18A 1Z2CB 3UTAC 3VH5T 4H9QB 3X1SA 1P3IA 1JFIA 1F66B 3W99C 5B0ZD 3UT9C 3X1VD 1M1AC 1F1EA 3WKJC 1P3PC 3UTAA 5FUGA 5CPJB 3VH5A 3W99A 4KUDB 3W98C 3UT9A 5G49A 4R8PD 4J8VB 1M1AA 3WKJA 1P3PA 5CPKB 4AWLC 1R4VA 5BT1D 4J8UC 4NE6A 3W98A 2AROB 2LY8A 3MGRB 2Y2HA 3F6TA 3AV2B 4J8UA 1KX3B 2CWEA 3W97D 5CPIC 1P3MB 5GSUD 5AV8C 4KHAB 3AZNB 5AVCA 4H9SC 5CPIA 3NQUA 1HQ3D 2BYKB 5B2JB 5AV8A 2F8NH 3W97C 3UTBC 5AV5B 2HIOC 4WU9C 5GSUC 3AZMD 4H9NA 3W97A 5BO0B 3H0RC 1BH9B 3VH5W 5F99D 3B0DB 3X1UB 3UTBA 3AZFD 2HIOA 4WU9A 1P34D 5GSUA 2Y2NA 3MGSC 4QLCB 3REKB 1AOIC 2NQBD 3AZEC 3WTPD 2ZY3A 3KWQD 3LZ1B 3REHC 1AOIA 3MGSA 3LZ0B 5AVBC 3AZEA 2F8NB 3MVDD 3REHA 5JA4A 3AZFC 2FJ7D 4LD9C 3W99B 5GT0D 5AY8B 3UT9B 5AVBA 3H0LC 1M1AB 3KWQC 1P3PB 3AZGB 1P3FA 2FFFB 5GXQC 3AZFA 4LD9A 5B32D 4Z66B 3MNND 1P3KD 3W98B 3KXBD 2AROD 1ZLAC 3WA9C 4Z2MH 3AZJD 3REID 1H3OB 3MVDC 4AWLB 5GXQA 1KX3D 5B0ZB 3X1VB 1ZLAA 3EG5B 4E44A 3AYWD 3WA9A 4CSRB 3AZHC 3MVDA 4H9PA 4JJND
chains in the Genus database with same CATH topology
5B32C 5DNMD 4R8PB 5B40C 3AZJC 1WWSA 3AZHA 1KX4D 2JSSA 3AZLD 5B32A 2PYOC 5AV8B 5CP6A 3EPKA 5BNXA 5B40A 3AZJA 3TU4A 4WNNB 5B0YD 2PYOA 3LELD 5DNMC 3W97B 2VQRA 4G92C 5B24D 3AL0C 4J8WD 5GSUB 3LJAC 3B0CW 1M18D 1HTAA 2BYMA 4ZUXC 3X1SD 1P3ID 2L5AA 4J8XD 2HUEC 3AFAC 1ID3C 3LJAA 1HQ3B 3MGPD 4ZUXA 3P5JB 3UTAD 3C1BC 3AFAA 1ID3A 2Y2QA 1M1AD 1P3AC 3WKJD 3AZMB 1P3PD 2CV5D 1P3IC 4J8XC 5F99B 3W96C 1U35C 4XUJC 3C1BA 3AZFB 5E5AC 5B33C 2NQBB 3MGPC 1P3AA 3WTPB 4J8XA 3KWQB 3W96A 1U35A 4J8UD 4XUJA 3B0BA 2F2AC 5E5AA 5B33A 2UWXA 3KUYA 3MGPA 2CV5C 3VH6W 3MVDB 4H9PB 2FJ7B 5GT0B 1BH8A 5AVCD 5CPID 2DF4C 2CV5A 5AV9C 5AV8D 5B32B 4E45A 5C3IB 3MNNB 1P3KB 5JRGC 3KXBB 5BNXB 2RIQA 3AZJB 5AV9A 2G5IC 3REIB 4X23C 1P3BC 2JE5A 4WU8C 4Z2MG 4KGCC 4WZSB 1B6WA 5AVCC 5JRGA 3UTBD 2HIOD 4WU9D 3AYWB 4X23A 1P3BA 4JJNB 4WU8A 5KDMA 4DRAA 3C1CC 3WAAD 4KGCA 2ZY2A 1P3GA 3AZKC 5DNMB 4G92B 4UUZB 4H9RA 1AOID 3MGSD 1KX4B 3C1CA 3AZLB 1KX5C 3AZED 3AZKA 3REHD 1BFMA 4HGAC 4G91C 3REJC 4CAYB 1S32C 3WAAC 5AVBD 2YFVB 5B0YB 1KX5A 3LELB 2ZY5A 1P3FD 4LD9D 2DQNC 3R45A 3X1TC 5B31G 5B24B 3REJA 4J8WB 1S32A 1PZRA 3WAAA 1M18B 1P3LC 3X1SB 1P3IB 1JFIB 4J8XB 3W96B 2Y2IA 5GXQD 2YFWA 3B0CT 3X1TA 2XD1A 4WV4B 3KFUG 1ZLAD 3NQJA 1P3LA 3WA9D 3MGPB 3UTAB 5FUGB 1P3FC 3EPHA 2RVQC 1EQZC 3AN2C 3FDDA 5G49B 3WKJB 3AZHD 2CV5B 3B6FC 1EQZA 5CP6D 3AN2A 4Z5TD 1TAFA 5B40D 3B6GC 3TU4D 5DNND 3B6FA 4J8UB 2PYOD 4H9OA 5JRGB 3B6GA 3O62D 2IO5C 4XZQD 1M19C 5CP6C 4YM6C 4Z5TC 5AVCB 5CPIB 3VH6T 3TU4C 5B31A 5DNNC 3NQUB 1F66C 4H9RB 3LJAD 1N1JA 1M19A 4ZUXD 4YM6A 4Z5TA 3O62C 5DNNA 5BS7C 3AFAD 5CPJC 3VH6A 1TZYC 1ID3D 4XZQC 1F66A 4NE3A 3AZID 4H9NB 4J8VC 3UTBB 3C1BD 5CPKC 2HIOB 3O62A 4WU9B 5BS7A 5CPJA 1TZYA 4XZQA 3WAAB 1P3AD 5GT3D 4J8VA 1U35D 3W96D 3MGRC 4XUJD 5CPKA 1ULYA 3AV2C 3X1TB 4UPKA 3MGSB 5E5AD 5B33D 1AOIB 3KUYD 3AZIC 3AZEB 1B67A 5AV6D 1P3MC 3MGRA 2W8SA 3REHB 5JA4B 2F8NG 3AV2A 5AVBB 3AZNC 3AZIA 5GT3C 1P3MA 1P3FB 5BNVA 4LD9B 2ZM5A 5B2JC 3KUYC 4KHAA 3AZNA 5AV6C 5GT3A 5AV9D 5AV5C 3MGQD 5GXQB 2Y2JA 1W2EA 5JRGD 5B2JA 1ZLAB 3H0MC 5AV6A 3WA9B 5AV5A 1Q9CA 4X23D 1P3BD 4WU8D 3REKC 4KGCD 4QLCC 1P3GD 1BH9A 3LZ1C 1A7WA 3MGQC 3A6ND 3AZHB 3V9RA 2IO5B 3C1CD 4DQYB 3REKA 1M19B 4QLCA 5CP6B 3LZ0C 4Z5TB 3AZKD 2NZDD 5B40B 3TU4B 3LZ1A 5DNNB 3MGQA 1KX5D 2Y2OA 5AY8C 2PYOB 3LZ0A 1P3GC 3EPLA 2F8NA 2G5HC 3AZGC 3O62B 3A6NC 3REJD 2Y2GA 3RELD 1S32D 1TZYB 1P3OD 4XZQB 4Z66C 5AY8A 2BYMB 5B2ID 2NZDC 5B1MD 3X1TD 3AZGA 3A6NA 3LJAB 4NE5A 4Z66A 1P3LD 5B0ZC 4ZUXB 3X1VC 2NZDA 3IP4C 1H3OA 2J8PA 4M6BA 2HUEB 3AFAB 3RELC 1ID3B 1P3OC 4DRBA 5B0ZA 3AZIB 3X1VA 5B2IC 5B1MC 4R8PC 4CSRA 3C1BB 2RVQD 5BNVB 1EQZD 3AN2D 2XD5A 5BT1C 3RELA 1P3OA 1P3AB 5GT3B 5B2IA 5B1MA 4R8PA 3B6FD 1U35B 4XUJB 5CHLB 5E5AB 5B33B 3KUYB 3B6GD 3AV1D 5AV6B 4H9SA 2Y2PA 4YS3D 4WNNA 5B1LD 1BH8B 2BG1A 5B31D 2F8NK 3V9RB 1M19D 1HQ3C 4NFTA 4YM6D 3EPJA 5B32G 3AV1C 5AV9B 4YS3C 1F66D 3MGQB 4ZBJC 1WWIA 4EO5C 1HQ3A 5B1LC 3AZMC 2JCHA 3AV1A 5B31C 2Y2LA 5F99C 5CPJD 4X23B 4YS3A 1TZYD 1P34C 1P3BB 2ZY4A 4KUDD 4WU8B 5KDMB 4KGCB 1T3UA 5B1LA 2NQBC 1P3GB 4J8VD 3WTPC 3AZMA 5CPKD 5F99A 2Y2MA 3A6NB 1P34A 3C1CB 2NQBA 3AZKB 2NZDB 3WTPA 3MGRD 4H9QA 3KWQA 3AV2D 2FJ7C 4KUDC 5GT0C 1KX5B 1P3MD 4HGAB 3R45B 4G91B 3REJB 2FJ7A 3RELB 1S32B 1P3OB 4KUDA 5GT0A 3AZND 5C3IC 3MNNC 1P3KC 3KXBC 2AROC 5B2IB 5B1MB 3REIC 2YFWB 1KX3C 5B2JD 3NQJB 3MNNA 1P3KA 1P3LB 3KXBA 2AROA 5AV5D 3AYWC 3REIA 3A1KA 4JJNC 1KX3A 3X1UD 1KU5A 3AYWA 3REKD 1KX4C 4QLCD 4JJNA 1EQZB 3AN2B 3AZLC 1TAFB 4WJ3C 5DNMA 3LZ1D 3B6FB 4UUZA 2BYKA 1KX4A 3LZ0D 5B0YC 3KSYA 3AZLA 4H9OB 3X1UC 2F8ND 3LELC 3AV1B 3B6GB 3B0DC 4YS3B 3W99D 4ZBJB 5B24C 5AY8D 4EO5B 4CAYA 4J8WC 3UT9D 5B0YA 5B1LB 2YFVA 1M18C 2Y2KA 3X1UA 3X1SC 3A1IA 5BO0A 3LELA 5B31B 3AZGD 1P34B 1N1JB 4Z66D 3WTPE 5B24A 4J8WA 3W98D 4YM6B 1M18A 1Z2CB 3UTAC 3VH5T 4H9QB 3X1SA 1P3IA 1JFIA 1F66B 3W99C 5B0ZD 3UT9C 3X1VD 1M1AC 1F1EA 3WKJC 1P3PC 3UTAA 5FUGA 5CPJB 3VH5A 3W99A 4KUDB 3W98C 3UT9A 5G49A 4R8PD 4J8VB 1M1AA 3WKJA 1P3PA 5CPKB 4AWLC 1R4VA 5BT1D 4J8UC 4NE6A 3W98A 2AROB 2LY8A 3MGRB 2Y2HA 3F6TA 3AV2B 4J8UA 1KX3B 2CWEA 3W97D 5CPIC 1P3MB 5GSUD 5AV8C 4KHAB 3AZNB 5AVCA 4H9SC 5CPIA 3NQUA 1HQ3D 2BYKB 5B2JB 5AV8A 2F8NH 3W97C 3UTBC 5AV5B 2HIOC 4WU9C 5GSUC 3AZMD 4H9NA 3W97A 5BO0B 3H0RC 1BH9B 3VH5W 5F99D 3B0DB 3X1UB 3UTBA 3AZFD 2HIOA 4WU9A 1P34D 5GSUA 2Y2NA 3MGSC 4QLCB 3REKB 1AOIC 2NQBD 3AZEC 3WTPD 2ZY3A 3KWQD 3LZ1B 3REHC 1AOIA 3MGSA 3LZ0B 5AVBC 3AZEA 2F8NB 3MVDD 3REHA 5JA4A 3AZFC 2FJ7D 4LD9C 3W99B 5GT0D 5AY8B 3UT9B 5AVBA 3H0LC 1M1AB 3KWQC 1P3PB 3AZGB 1P3FA 2FFFB 5GXQC 3AZFA 4LD9A 5B32D 4Z66B 3MNND 1P3KD 3W98B 3KXBD 2AROD 1ZLAC 3WA9C 4Z2MH 3AZJD 3REID 1H3OB 3MVDC 4AWLB 5GXQA 1KX3D 5B0ZB 3X1VB 1ZLAA 3EG5B 4E44A 3AYWD 3WA9A 4CSRB 3AZHC 3MVDA 4H9PA 4JJND
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B32 C;  5DNM D;  4R8P B;  5B40 C;  3AZJ C;  1WWS A;  3AZH A;  1KX4 D;  2JSS A;  3AZL D;  5B32 A;  2PYO C;  5AV8 B;  5CP6 A;  5BNX A;  5B40 A;  3AZJ A;  3TU4 A;  4WNN B;  5B0Y D;  2PYO A;  3LEL D;  5DNM C;  3W97 B;  4G92 C;  5B24 D;  4J8W D;  5GSU B;  3LJA C;  3B0C W;  1M18 D;  1HTA A;  2BYM A;  4ZUX C;  3X1S D;  1P3I D;  2L5A A;  4J8X D;  2HUE C;  3AFA C;  1ID3 C;  3LJA A;  1HQ3 B;  3MGP D;  4ZUX A;  3UTA D;  3C1B C;  3AFA A;  1ID3 A;  1M1A D;  1P3A C;  3WKJ D;  3AZM B;  1P3P D;  2CV5 D;  1P3I C;  4J8X C;  5F99 B;  3W96 C;  1U35 C;  4XUJ C;  3C1B A;  3AZF B;  5E5A C;  5B33 C;  2NQB B;  3MGP C;  1P3A A;  3WTP B;  4J8X A;  3KWQ B;  3W96 A;  1U35 A;  4J8U D;  4XUJ A;  3B0B A;  5E5A A;  5B33 A;  3KUY A;  3MGP A;  2CV5 C;  3VH6 W;  3MVD B;  4H9P B;  2FJ7 B;  5GT0 B;  1BH8 A;  5AVC D;  5CPI D;  2CV5 A;  5AV9 C;  5AV8 D;  5B32 B;  4E45 A;  5C3I B;  3MNN B;  1P3K B;  5JRG C;  3KXB B;  5BNX B;  3AZJ B;  5AV9 A;  3REI B;  4X23 C;  1P3B C;  4WU8 C;  4Z2M G;  4KGC C;  4WZS B;  1B6W A;  5AVC C;  5JRG A;  3UTB D;  2HIO D;  4WU9 D;  3AYW B;  4X23 A;  1P3B A;  4JJN B;  4WU8 A;  5KDM A;  4DRA A;  3C1C C;  3WAA D;  4KGC A;  1P3G A;  3AZK C;  5DNM B;  4G92 B;  4UUZ B;  4H9R A;  1AOI D;  3MGS D;  1KX4 B;  3C1C A;  3AZL B;  1KX5 C;  3AZE D;  3AZK A;  3REH D;  1BFM A;  4HGA C;  4G91 C;  3REJ C;  4CAY B;  1S32 C;  3WAA C;  5AVB D;  2YFV B;  5B0Y B;  1KX5 A;  3LEL B;  1P3F D;  4LD9 D;  3R45 A;  3X1T C;  5B31 G;  5B24 B;  3REJ A;  4J8W B;  1S32 A;  3WAA A;  1M18 B;  1P3L C;  3X1S B;  1P3I B;  1JFI B;  4J8X B;  3W96 B;  5GXQ D;  2YFW A;  3B0C T;  3X1T A;  4WV4 B;  1ZLA D;  3NQJ A;  1P3L A;  3WA9 D;  3MGP B;  3UTA B;  5FUG B;  1P3F C;  2RVQ C;  1EQZ C;  3AN2 C;  5G49 B;  3WKJ B;  3AZH D;  2CV5 B;  3B6F C;  1EQZ A;  5CP6 D;  3AN2 A;  4Z5T D;  1TAF A;  5B40 D;  3B6G C;  3TU4 D;  5DNN D;  3B6F A;  4J8U B;  2PYO D;  4H9O A;  5JRG B;  3B6G A;  3O62 D;  2IO5 C;  4XZQ D;  1M19 C;  5CP6 C;  4YM6 C;  4Z5T C;  5AVC B;  5CPI B;  3VH6 T;  3TU4 C;  5B31 A;  5DNN C;  3NQU B;  1F66 C;  4H9R B;  3LJA D;  1N1J A;  1M19 A;  4ZUX D;  4YM6 A;  4Z5T A;  3O62 C;  5DNN A;  5BS7 C;  3AFA D;  5CPJ C;  3VH6 A;  1TZY C;  1ID3 D;  4XZQ C;  1F66 A;  4NE3 A;  3AZI D;  4H9N B;  4J8V C;  3UTB B;  3C1B D;  5CPK C;  2HIO B;  3O62 A;  4WU9 B;  5BS7 A;  5CPJ A;  1TZY A;  4XZQ A;  3WAA B;  1P3A D;  5GT3 D;  4J8V A;  1U35 D;  3W96 D;  3MGR C;  4XUJ D;  5CPK A;  1ULY A;  3AV2 C;  3X1T B;  1AOI B;  3MGS B;  5E5A D;  5B33 D;  3KUY D;  3AZI C;  3AZE B;  1B67 A;  5AV6 D;  1P3M C;  3MGR A;  3REH B;  5JA4 B;  2F8N G;  3AV2 A;  5AVB B;  3AZN C;  3AZI A;  5GT3 C;  1P3M A;  1P3F B;  5BNV A;  4LD9 B;  5B2J C;  3KUY C;  4KHA A;  3AZN A;  5AV6 C;  5GT3 A;  5AV9 D;  5AV5 C;  3MGQ D;  5GXQ B;  5JRG D;  5B2J A;  1ZLA B;  5AV6 A;  3WA9 B;  5AV5 A;  1Q9C A;  4X23 D;  1P3B D;  4WU8 D;  3REK C;  4KGC D;  4QLC C;  1P3G D;  1BH9 A;  3LZ1 C;  1A7W A;  3MGQ C;  3A6N D;  3AZH B;  3V9R A;  2IO5 B;  3C1C D;  3REK A;  1M19 B;  4QLC A;  5CP6 B;  3LZ0 C;  4Z5T B;  3AZK D;  2NZD D;  5B40 B;  3TU4 B;  3LZ1 A;  5DNN B;  3MGQ A;  1KX5 D;  5AY8 C;  2PYO B;  3LZ0 A;  1P3G C;  2F8N A;  3AZG C;  3O62 B;  3A6N C;  3REJ D;  3REL D;  1S32 D;  1TZY B;  1P3O D;  4XZQ B;  4Z66 C;  5AY8 A;  2BYM B;  5B2I D;  2NZD C;  5B1M D;  3X1T D;  3AZG A;  3A6N A;  3LJA B;  4NE5 A;  4Z66 A;  1P3L D;  5B0Z C;  4ZUX B;  3X1V C;  2NZD A;  1H3O A;  4M6B A;  2HUE B;  3AFA B;  3REL C;  1ID3 B;  1P3O C;  4DRB A;  5B0Z A;  3AZI B;  3X1V A;  5B2I C;  5B1M C;  4R8P C;  4CSR A;  3C1B B;  2RVQ D;  5BNV B;  1EQZ D;  3AN2 D;  5BT1 C;  3REL A;  1P3O A;  1P3A B;  5GT3 B;  5B2I A;  5B1M A;  4R8P A;  3B6F D;  1U35 B;  4XUJ B;  5CHL B;  5E5A B;  5B33 B;  3KUY B;  3B6G D;  3AV1 D;  5AV6 B;  4H9S A;  4YS3 D;  4WNN A;  5B1L D;  1BH8 B;  5B31 D;  2F8N K;  3V9R B;  1M19 D;  1HQ3 C;  4NFT A;  4YM6 D;  5B32 G;  3AV1 C;  5AV9 B;  4YS3 C;  1F66 D;  3MGQ B;  4ZBJ C;  1WWI A;  4EO5 C;  1HQ3 A;  5B1L C;  3AZM C;  3AV1 A;  5B31 C;  5F99 C;  5CPJ D;  4X23 B;  4YS3 A;  1TZY D;  1P34 C;  1P3B B;  4KUD D;  4WU8 B;  5KDM B;  4KGC B;  5B1L A;  2NQB C;  1P3G B;  4J8V D;  3WTP C;  3AZM A;  5CPK D;  5F99 A;  3A6N B;  1P34 A;  3C1C B;  2NQB A;  3AZK B;  2NZD B;  3WTP A;  3MGR D;  4H9Q A;  3KWQ A;  3AV2 D;  2FJ7 C;  4KUD C;  5GT0 C;  1KX5 B;  1P3M D;  4HGA B;  3R45 B;  4G91 B;  3REJ B;  2FJ7 A;  3REL B;  1S32 B;  1P3O B;  4KUD A;  5GT0 A;  3AZN D;  5C3I C;  3MNN C;  1P3K C;  3KXB C;  2ARO C;  5B2I B;  5B1M B;  3REI C;  2YFW B;  1KX3 C;  5B2J D;  3NQJ B;  3MNN A;  1P3K A;  1P3L B;  3KXB A;  2ARO A;  5AV5 D;  3AYW C;  3REI A;  4JJN C;  1KX3 A;  3X1U D;  1KU5 A;  3AYW A;  3REK D;  1KX4 C;  4QLC D;  4JJN A;  1EQZ B;  3AN2 B;  3AZL C;  1TAF B;  5DNM A;  3LZ1 D;  3B6F B;  4UUZ A;  2BYK A;  1KX4 A;  3LZ0 D;  5B0Y C;  3KSY A;  3AZL A;  4H9O B;  3X1U C;  2F8N D;  3LEL C;  3AV1 B;  3B6G B;  3B0D C;  4YS3 B;  3W99 D;  4ZBJ B;  5B24 C;  5AY8 D;  4EO5 B;  4CAY A;  4J8W C;  3UT9 D;  5B0Y A;  5B1L B;  2YFV A;  1M18 C;  3X1U A;  3X1S C;  5BO0 A;  3LEL A;  5B31 B;  3AZG D;  1P34 B;  1N1J B;  4Z66 D;  3WTP E;  5B24 A;  4J8W A;  3W98 D;  4YM6 B;  1M18 A;  3UTA C;  3VH5 T;  4H9Q B;  3X1S A;  1P3I A;  1JFI A;  1F66 B;  3W99 C;  5B0Z D;  3UT9 C;  3X1V D;  1M1A C;  1F1E A;  3WKJ C;  1P3P C;  3UTA A;  5FUG A;  5CPJ B;  3VH5 A;  3W99 A;  4KUD B;  3W98 C;  3UT9 A;  5G49 A;  4R8P D;  4J8V B;  1M1A A;  3WKJ A;  1P3P A;  5CPK B;  4AWL C;  1R4V A;  5BT1 D;  4J8U C;  4NE6 A;  3W98 A;  2ARO B;  2LY8 A;  3MGR B;  3AV2 B;  4J8U A;  1KX3 B;  2CWE A;  3W97 D;  5CPI C;  1P3M B;  5GSU D;  5AV8 C;  4KHA B;  3AZN B;  5AVC A;  4H9S C;  5CPI A;  3NQU A;  1HQ3 D;  2BYK B;  5B2J B;  5AV8 A;  2F8N H;  3W97 C;  3UTB C;  5AV5 B;  2HIO C;  4WU9 C;  5GSU C;  3AZM D;  3X1U B;  4H9N A;  3W97 A;  5F99 D;  1BH9 B;  3VH5 W;  5BO0 B;  3B0D B;  3UTB A;  1P34 D;  3AZF D;  2HIO A;  4WU9 A;  5GSU A;  3REK B;  3MGS C;  4QLC B;  1AOI C;  2NQB D;  3AZE C;  3WTP D;  3KWQ D;  3LZ1 B;  3REH C;  1AOI A;  3MGS A;  3LZ0 B;  5AVB C;  3AZE A;  2F8N B;  3MVD D;  3REH A;  5JA4 A;  3AZF C;  2FJ7 D;  4LD9 C;  3W99 B;  5GT0 D;  5AY8 B;  3UT9 B;  5AVB A;  1M1A B;  3KWQ C;  1P3P B;  3AZG B;  1P3F A;  5GXQ C;  3AZF A;  4LD9 A;  5B32 D;  4Z66 B;  3MNN D;  1P3K D;  3W98 B;  3KXB D;  2ARO D;  1ZLA C;  3WA9 C;  4Z2M H;  3AZJ D;  3REI D;  1H3O B;  3MVD C;  4AWL B;  5GXQ A;  1KX3 D;  5B0Z B;  3X1V B;  1ZLA A;  4E44 A;  3WA9 A;  3AYW D;  4CSR B;  3AZH C;  3MVD A;  4H9P A;  4JJN D; 
#chains in the Genus database with same CATH topology
 5B32 C;  5DNM D;  4R8P B;  5B40 C;  3AZJ C;  1WWS A;  3AZH A;  1KX4 D;  2JSS A;  3AZL D;  5B32 A;  2PYO C;  5AV8 B;  5CP6 A;  3EPK A;  5BNX A;  5B40 A;  3AZJ A;  3TU4 A;  4WNN B;  5B0Y D;  2PYO A;  3LEL D;  5DNM C;  3W97 B;  2VQR A;  4G92 C;  5B24 D;  3AL0 C;  4J8W D;  5GSU B;  3LJA C;  3B0C W;  1M18 D;  1HTA A;  2BYM A;  4ZUX C;  3X1S D;  1P3I D;  2L5A A;  4J8X D;  2HUE C;  3AFA C;  1ID3 C;  3LJA A;  1HQ3 B;  3MGP D;  4ZUX A;  3P5J B;  3UTA D;  3C1B C;  3AFA A;  1ID3 A;  2Y2Q A;  1M1A D;  1P3A C;  3WKJ D;  3AZM B;  1P3P D;  2CV5 D;  1P3I C;  4J8X C;  5F99 B;  3W96 C;  1U35 C;  4XUJ C;  3C1B A;  3AZF B;  5E5A C;  5B33 C;  2NQB B;  3MGP C;  1P3A A;  3WTP B;  4J8X A;  3KWQ B;  3W96 A;  1U35 A;  4J8U D;  4XUJ A;  3B0B A;  2F2A C;  5E5A A;  5B33 A;  2UWX A;  3KUY A;  3MGP A;  2CV5 C;  3VH6 W;  3MVD B;  4H9P B;  2FJ7 B;  5GT0 B;  1BH8 A;  5AVC D;  5CPI D;  2DF4 C;  2CV5 A;  5AV9 C;  5AV8 D;  5B32 B;  4E45 A;  5C3I B;  3MNN B;  1P3K B;  5JRG C;  3KXB B;  5BNX B;  2RIQ A;  3AZJ B;  5AV9 A;  2G5I C;  3REI B;  4X23 C;  1P3B C;  2JE5 A;  4WU8 C;  4Z2M G;  4KGC C;  4WZS B;  1B6W A;  5AVC C;  5JRG A;  3UTB D;  2HIO D;  4WU9 D;  3AYW B;  4X23 A;  1P3B A;  4JJN B;  4WU8 A;  5KDM A;  4DRA A;  3C1C C;  3WAA D;  4KGC A;  2ZY2 A;  1P3G A;  3AZK C;  5DNM B;  4G92 B;  4UUZ B;  4H9R A;  1AOI D;  3MGS D;  1KX4 B;  3C1C A;  3AZL B;  1KX5 C;  3AZE D;  3AZK A;  3REH D;  1BFM A;  4HGA C;  4G91 C;  3REJ C;  4CAY B;  1S32 C;  3WAA C;  5AVB D;  2YFV B;  5B0Y B;  1KX5 A;  3LEL B;  2ZY5 A;  1P3F D;  4LD9 D;  2DQN C;  3R45 A;  3X1T C;  5B31 G;  5B24 B;  3REJ A;  4J8W B;  1S32 A;  1PZR A;  3WAA A;  1M18 B;  1P3L C;  3X1S B;  1P3I B;  1JFI B;  4J8X B;  3W96 B;  2Y2I A;  5GXQ D;  2YFW A;  3B0C T;  3X1T A;  2XD1 A;  4WV4 B;  3KFU G;  1ZLA D;  3NQJ A;  1P3L A;  3WA9 D;  3MGP B;  3UTA B;  5FUG B;  1P3F C;  3EPH A;  2RVQ C;  1EQZ C;  3AN2 C;  3FDD A;  5G49 B;  3WKJ B;  3AZH D;  2CV5 B;  3B6F C;  1EQZ A;  5CP6 D;  3AN2 A;  4Z5T D;  1TAF A;  5B40 D;  3B6G C;  3TU4 D;  5DNN D;  3B6F A;  4J8U B;  2PYO D;  4H9O A;  5JRG B;  3B6G A;  3O62 D;  2IO5 C;  4XZQ D;  1M19 C;  5CP6 C;  4YM6 C;  4Z5T C;  5AVC B;  5CPI B;  3VH6 T;  3TU4 C;  5B31 A;  5DNN C;  3NQU B;  1F66 C;  4H9R B;  3LJA D;  1N1J A;  1M19 A;  4ZUX D;  4YM6 A;  4Z5T A;  3O62 C;  5DNN A;  5BS7 C;  3AFA D;  5CPJ C;  3VH6 A;  1TZY C;  1ID3 D;  4XZQ C;  1F66 A;  4NE3 A;  3AZI D;  4H9N B;  4J8V C;  3UTB B;  3C1B D;  5CPK C;  2HIO B;  3O62 A;  4WU9 B;  5BS7 A;  5CPJ A;  1TZY A;  4XZQ A;  3WAA B;  1P3A D;  5GT3 D;  4J8V A;  1U35 D;  3W96 D;  3MGR C;  4XUJ D;  5CPK A;  1ULY A;  3AV2 C;  3X1T B;  4UPK A;  3MGS B;  5E5A D;  5B33 D;  1AOI B;  3KUY D;  3AZI C;  3AZE B;  1B67 A;  5AV6 D;  1P3M C;  3MGR A;  2W8S A;  3REH B;  5JA4 B;  2F8N G;  3AV2 A;  5AVB B;  3AZN C;  3AZI A;  5GT3 C;  1P3M A;  1P3F B;  5BNV A;  4LD9 B;  2ZM5 A;  5B2J C;  3KUY C;  4KHA A;  3AZN A;  5AV6 C;  5GT3 A;  5AV9 D;  5AV5 C;  3MGQ D;  5GXQ B;  2Y2J A;  1W2E A;  5JRG D;  5B2J A;  1ZLA B;  3H0M C;  5AV6 A;  3WA9 B;  5AV5 A;  1Q9C A;  4X23 D;  1P3B D;  4WU8 D;  3REK C;  4KGC D;  4QLC C;  1P3G D;  1BH9 A;  3LZ1 C;  1A7W A;  3MGQ C;  3A6N D;  3AZH B;  3V9R A;  2IO5 B;  3C1C D;  4DQY B;  3REK A;  1M19 B;  4QLC A;  5CP6 B;  3LZ0 C;  4Z5T B;  3AZK D;  2NZD D;  5B40 B;  3TU4 B;  3LZ1 A;  5DNN B;  3MGQ A;  1KX5 D;  2Y2O A;  5AY8 C;  2PYO B;  3LZ0 A;  1P3G C;  3EPL A;  2F8N A;  2G5H C;  3AZG C;  3O62 B;  3A6N C;  3REJ D;  2Y2G A;  3REL D;  1S32 D;  1TZY B;  1P3O D;  4XZQ B;  4Z66 C;  5AY8 A;  2BYM B;  5B2I D;  2NZD C;  5B1M D;  3X1T D;  3AZG A;  3A6N A;  3LJA B;  4NE5 A;  4Z66 A;  1P3L D;  5B0Z C;  4ZUX B;  3X1V C;  2NZD A;  3IP4 C;  1H3O A;  2J8P A;  4M6B A;  2HUE B;  3AFA B;  3REL C;  1ID3 B;  1P3O C;  4DRB A;  5B0Z A;  3AZI B;  3X1V A;  5B2I C;  5B1M C;  4R8P C;  4CSR A;  3C1B B;  2RVQ D;  5BNV B;  1EQZ D;  3AN2 D;  2XD5 A;  5BT1 C;  3REL A;  1P3O A;  1P3A B;  5GT3 B;  5B2I A;  5B1M A;  4R8P A;  3B6F D;  1U35 B;  4XUJ B;  5CHL B;  5E5A B;  5B33 B;  3KUY B;  3B6G D;  3AV1 D;  5AV6 B;  4H9S A;  2Y2P A;  4YS3 D;  4WNN A;  5B1L D;  1BH8 B;  2BG1 A;  5B31 D;  2F8N K;  3V9R B;  1M19 D;  1HQ3 C;  4NFT A;  4YM6 D;  3EPJ A;  5B32 G;  3AV1 C;  5AV9 B;  4YS3 C;  1F66 D;  3MGQ B;  4ZBJ C;  1WWI A;  4EO5 C;  1HQ3 A;  5B1L C;  3AZM C;  2JCH A;  3AV1 A;  5B31 C;  2Y2L A;  5F99 C;  5CPJ D;  4X23 B;  4YS3 A;  1TZY D;  1P34 C;  1P3B B;  2ZY4 A;  4KUD D;  4WU8 B;  5KDM B;  4KGC B;  1T3U A;  5B1L A;  2NQB C;  1P3G B;  4J8V D;  3WTP C;  3AZM A;  5CPK D;  5F99 A;  2Y2M A;  3A6N B;  1P34 A;  3C1C B;  2NQB A;  3AZK B;  2NZD B;  3WTP A;  3MGR D;  4H9Q A;  3KWQ A;  3AV2 D;  2FJ7 C;  4KUD C;  5GT0 C;  1KX5 B;  1P3M D;  4HGA B;  3R45 B;  4G91 B;  3REJ B;  2FJ7 A;  3REL B;  1S32 B;  1P3O B;  4KUD A;  5GT0 A;  3AZN D;  5C3I C;  3MNN C;  1P3K C;  3KXB C;  2ARO C;  5B2I B;  5B1M B;  3REI C;  2YFW B;  1KX3 C;  5B2J D;  3NQJ B;  3MNN A;  1P3K A;  1P3L B;  3KXB A;  2ARO A;  5AV5 D;  3AYW C;  3REI A;  3A1K A;  4JJN C;  1KX3 A;  3X1U D;  1KU5 A;  3AYW A;  3REK D;  1KX4 C;  4QLC D;  4JJN A;  1EQZ B;  3AN2 B;  3AZL C;  1TAF B;  4WJ3 C;  5DNM A;  3LZ1 D;  3B6F B;  4UUZ A;  2BYK A;  1KX4 A;  3LZ0 D;  5B0Y C;  3KSY A;  3AZL A;  4H9O B;  3X1U C;  2F8N D;  3LEL C;  3AV1 B;  3B6G B;  3B0D C;  4YS3 B;  3W99 D;  4ZBJ B;  5B24 C;  5AY8 D;  4EO5 B;  4CAY A;  4J8W C;  3UT9 D;  5B0Y A;  5B1L B;  2YFV A;  1M18 C;  2Y2K A;  3X1U A;  3X1S C;  3A1I A;  5BO0 A;  3LEL A;  5B31 B;  3AZG D;  1P34 B;  1N1J B;  4Z66 D;  3WTP E;  5B24 A;  4J8W A;  3W98 D;  4YM6 B;  1M18 A;  1Z2C B;  3UTA C;  3VH5 T;  4H9Q B;  3X1S A;  1P3I A;  1JFI A;  1F66 B;  3W99 C;  5B0Z D;  3UT9 C;  3X1V D;  1M1A C;  1F1E A;  3WKJ C;  1P3P C;  3UTA A;  5FUG A;  5CPJ B;  3VH5 A;  3W99 A;  4KUD B;  3W98 C;  3UT9 A;  5G49 A;  4R8P D;  4J8V B;  1M1A A;  3WKJ A;  1P3P A;  5CPK B;  4AWL C;  1R4V A;  5BT1 D;  4J8U C;  4NE6 A;  3W98 A;  2ARO B;  2LY8 A;  3MGR B;  2Y2H A;  3F6T A;  3AV2 B;  4J8U A;  1KX3 B;  2CWE A;  3W97 D;  5CPI C;  1P3M B;  5GSU D;  5AV8 C;  4KHA B;  3AZN B;  5AVC A;  4H9S C;  5CPI A;  3NQU A;  1HQ3 D;  2BYK B;  5B2J B;  5AV8 A;  2F8N H;  3W97 C;  3UTB C;  5AV5 B;  2HIO C;  4WU9 C;  5GSU C;  3AZM D;  4H9N A;  3W97 A;  5BO0 B;  3H0R C;  1BH9 B;  3VH5 W;  5F99 D;  3B0D B;  3X1U B;  3UTB A;  3AZF D;  2HIO A;  4WU9 A;  1P34 D;  5GSU A;  2Y2N A;  3MGS C;  4QLC B;  3REK B;  1AOI C;  2NQB D;  3AZE C;  3WTP D;  2ZY3 A;  3KWQ D;  3LZ1 B;  3REH C;  1AOI A;  3MGS A;  3LZ0 B;  5AVB C;  3AZE A;  2F8N B;  3MVD D;  3REH A;  5JA4 A;  3AZF C;  2FJ7 D;  4LD9 C;  3W99 B;  5GT0 D;  5AY8 B;  3UT9 B;  5AVB A;  3H0L C;  1M1A B;  3KWQ C;  1P3P B;  3AZG B;  1P3F A;  2FFF B;  5GXQ C;  3AZF A;  4LD9 A;  5B32 D;  4Z66 B;  3MNN D;  1P3K D;  3W98 B;  3KXB D;  2ARO D;  1ZLA C;  3WA9 C;  4Z2M H;  3AZJ D;  3REI D;  1H3O B;  3MVD C;  4AWL B;  5GXQ A;  1KX3 D;  5B0Z B;  3X1V B;  1ZLA A;  3EG5 B;  4E44 A;  3AYW D;  3WA9 A;  4CSR B;  3AZH C;  3MVD A;  4H9P A;  4JJN D; 
#chains in the Genus database with same CATH homology
 5B32 C;  5DNM D;  4R8P B;  5B40 C;  3AZJ C;  1WWS A;  3AZH A;  1KX4 D;  2JSS A;  3AZL D;  5B32 A;  2PYO C;  5AV8 B;  5CP6 A;  3EPK A;  5BNX A;  5B40 A;  3AZJ A;  3TU4 A;  4WNN B;  5B0Y D;  2PYO A;  3LEL D;  5DNM C;  3W97 B;  2VQR A;  4G92 C;  5B24 D;  3AL0 C;  4J8W D;  5GSU B;  3LJA C;  3B0C W;  1M18 D;  1HTA A;  2BYM A;  4ZUX C;  3X1S D;  1P3I D;  2L5A A;  4J8X D;  2HUE C;  3AFA C;  1ID3 C;  3LJA A;  1HQ3 B;  3MGP D;  4ZUX A;  3P5J B;  3UTA D;  3C1B C;  3AFA A;  1ID3 A;  2Y2Q A;  1M1A D;  1P3A C;  3WKJ D;  3AZM B;  1P3P D;  2CV5 D;  1P3I C;  4J8X C;  5F99 B;  3W96 C;  1U35 C;  4XUJ C;  3C1B A;  3AZF B;  5E5A C;  5B33 C;  2NQB B;  3MGP C;  1P3A A;  3WTP B;  4J8X A;  3KWQ B;  3W96 A;  1U35 A;  4J8U D;  4XUJ A;  3B0B A;  2F2A C;  5E5A A;  5B33 A;  2UWX A;  3KUY A;  3MGP A;  2CV5 C;  3VH6 W;  3MVD B;  4H9P B;  2FJ7 B;  5GT0 B;  1BH8 A;  5AVC D;  5CPI D;  2DF4 C;  2CV5 A;  5AV9 C;  5AV8 D;  5B32 B;  4E45 A;  5C3I B;  3MNN B;  1P3K B;  5JRG C;  3KXB B;  5BNX B;  2RIQ A;  3AZJ B;  5AV9 A;  2G5I C;  3REI B;  4X23 C;  1P3B C;  2JE5 A;  4WU8 C;  4Z2M G;  4KGC C;  4WZS B;  1B6W A;  5AVC C;  5JRG A;  3UTB D;  2HIO D;  4WU9 D;  3AYW B;  4X23 A;  1P3B A;  4JJN B;  4WU8 A;  5KDM A;  4DRA A;  3C1C C;  3WAA D;  4KGC A;  2ZY2 A;  1P3G A;  3AZK C;  5DNM B;  4G92 B;  4UUZ B;  4H9R A;  1AOI D;  3MGS D;  1KX4 B;  3C1C A;  3AZL B;  1KX5 C;  3AZE D;  3AZK A;  3REH D;  1BFM A;  4HGA C;  4G91 C;  3REJ C;  4CAY B;  1S32 C;  3WAA C;  5AVB D;  2YFV B;  5B0Y B;  1KX5 A;  3LEL B;  2ZY5 A;  1P3F D;  4LD9 D;  2DQN C;  3R45 A;  3X1T C;  5B31 G;  5B24 B;  3REJ A;  4J8W B;  1S32 A;  1PZR A;  3WAA A;  1M18 B;  1P3L C;  3X1S B;  1P3I B;  1JFI B;  4J8X B;  3W96 B;  2Y2I A;  5GXQ D;  2YFW A;  3B0C T;  3X1T A;  2XD1 A;  4WV4 B;  3KFU G;  1ZLA D;  3NQJ A;  1P3L A;  3WA9 D;  3MGP B;  3UTA B;  5FUG B;  1P3F C;  3EPH A;  2RVQ C;  1EQZ C;  3AN2 C;  3FDD A;  5G49 B;  3WKJ B;  3AZH D;  2CV5 B;  3B6F C;  1EQZ A;  5CP6 D;  3AN2 A;  4Z5T D;  1TAF A;  5B40 D;  3B6G C;  3TU4 D;  5DNN D;  3B6F A;  4J8U B;  2PYO D;  4H9O A;  5JRG B;  3B6G A;  3O62 D;  2IO5 C;  4XZQ D;  1M19 C;  5CP6 C;  4YM6 C;  4Z5T C;  5AVC B;  5CPI B;  3VH6 T;  3TU4 C;  5B31 A;  5DNN C;  3NQU B;  1F66 C;  4H9R B;  3LJA D;  1N1J A;  1M19 A;  4ZUX D;  4YM6 A;  4Z5T A;  3O62 C;  5DNN A;  5BS7 C;  3AFA D;  5CPJ C;  3VH6 A;  1TZY C;  1ID3 D;  4XZQ C;  1F66 A;  4NE3 A;  3AZI D;  4H9N B;  4J8V C;  3UTB B;  3C1B D;  5CPK C;  2HIO B;  3O62 A;  4WU9 B;  5BS7 A;  5CPJ A;  1TZY A;  4XZQ A;  3WAA B;  1P3A D;  5GT3 D;  4J8V A;  1U35 D;  3W96 D;  3MGR C;  4XUJ D;  5CPK A;  1ULY A;  3AV2 C;  3X1T B;  4UPK A;  3MGS B;  5E5A D;  5B33 D;  1AOI B;  3KUY D;  3AZI C;  3AZE B;  1B67 A;  5AV6 D;  1P3M C;  3MGR A;  2W8S A;  3REH B;  5JA4 B;  2F8N G;  3AV2 A;  5AVB B;  3AZN C;  3AZI A;  5GT3 C;  1P3M A;  1P3F B;  5BNV A;  4LD9 B;  2ZM5 A;  5B2J C;  3KUY C;  4KHA A;  3AZN A;  5AV6 C;  5GT3 A;  5AV9 D;  5AV5 C;  3MGQ D;  5GXQ B;  2Y2J A;  1W2E A;  5JRG D;  5B2J A;  1ZLA B;  3H0M C;  5AV6 A;  3WA9 B;  5AV5 A;  1Q9C A;  4X23 D;  1P3B D;  4WU8 D;  3REK C;  4KGC D;  4QLC C;  1P3G D;  1BH9 A;  3LZ1 C;  1A7W A;  3MGQ C;  3A6N D;  3AZH B;  3V9R A;  2IO5 B;  3C1C D;  4DQY B;  3REK A;  1M19 B;  4QLC A;  5CP6 B;  3LZ0 C;  4Z5T B;  3AZK D;  2NZD D;  5B40 B;  3TU4 B;  3LZ1 A;  5DNN B;  3MGQ A;  1KX5 D;  2Y2O A;  5AY8 C;  2PYO B;  3LZ0 A;  1P3G C;  3EPL A;  2F8N A;  2G5H C;  3AZG C;  3O62 B;  3A6N C;  3REJ D;  2Y2G A;  3REL D;  1S32 D;  1TZY B;  1P3O D;  4XZQ B;  4Z66 C;  5AY8 A;  2BYM B;  5B2I D;  2NZD C;  5B1M D;  3X1T D;  3AZG A;  3A6N A;  3LJA B;  4NE5 A;  4Z66 A;  1P3L D;  5B0Z C;  4ZUX B;  3X1V C;  2NZD A;  3IP4 C;  1H3O A;  2J8P A;  4M6B A;  2HUE B;  3AFA B;  3REL C;  1ID3 B;  1P3O C;  4DRB A;  5B0Z A;  3AZI B;  3X1V A;  5B2I C;  5B1M C;  4R8P C;  4CSR A;  3C1B B;  2RVQ D;  5BNV B;  1EQZ D;  3AN2 D;  2XD5 A;  5BT1 C;  3REL A;  1P3O A;  1P3A B;  5GT3 B;  5B2I A;  5B1M A;  4R8P A;  3B6F D;  1U35 B;  4XUJ B;  5CHL B;  5E5A B;  5B33 B;  3KUY B;  3B6G D;  3AV1 D;  5AV6 B;  4H9S A;  2Y2P A;  4YS3 D;  4WNN A;  5B1L D;  1BH8 B;  2BG1 A;  5B31 D;  2F8N K;  3V9R B;  1M19 D;  1HQ3 C;  4NFT A;  4YM6 D;  3EPJ A;  5B32 G;  3AV1 C;  5AV9 B;  4YS3 C;  1F66 D;  3MGQ B;  4ZBJ C;  1WWI A;  4EO5 C;  1HQ3 A;  5B1L C;  3AZM C;  2JCH A;  3AV1 A;  5B31 C;  2Y2L A;  5F99 C;  5CPJ D;  4X23 B;  4YS3 A;  1TZY D;  1P34 C;  1P3B B;  2ZY4 A;  4KUD D;  4WU8 B;  5KDM B;  4KGC B;  1T3U A;  5B1L A;  2NQB C;  1P3G B;  4J8V D;  3WTP C;  3AZM A;  5CPK D;  5F99 A;  2Y2M A;  3A6N B;  1P34 A;  3C1C B;  2NQB A;  3AZK B;  2NZD B;  3WTP A;  3MGR D;  4H9Q A;  3KWQ A;  3AV2 D;  2FJ7 C;  4KUD C;  5GT0 C;  1KX5 B;  1P3M D;  4HGA B;  3R45 B;  4G91 B;  3REJ B;  2FJ7 A;  3REL B;  1S32 B;  1P3O B;  4KUD A;  5GT0 A;  3AZN D;  5C3I C;  3MNN C;  1P3K C;  3KXB C;  2ARO C;  5B2I B;  5B1M B;  3REI C;  2YFW B;  1KX3 C;  5B2J D;  3NQJ B;  3MNN A;  1P3K A;  1P3L B;  3KXB A;  2ARO A;  5AV5 D;  3AYW C;  3REI A;  3A1K A;  4JJN C;  1KX3 A;  3X1U D;  1KU5 A;  3AYW A;  3REK D;  1KX4 C;  4QLC D;  4JJN A;  1EQZ B;  3AN2 B;  3AZL C;  1TAF B;  4WJ3 C;  5DNM A;  3LZ1 D;  3B6F B;  4UUZ A;  2BYK A;  1KX4 A;  3LZ0 D;  5B0Y C;  3KSY A;  3AZL A;  4H9O B;  3X1U C;  2F8N D;  3LEL C;  3AV1 B;  3B6G B;  3B0D C;  4YS3 B;  3W99 D;  4ZBJ B;  5B24 C;  5AY8 D;  4EO5 B;  4CAY A;  4J8W C;  3UT9 D;  5B0Y A;  5B1L B;  2YFV A;  1M18 C;  2Y2K A;  3X1U A;  3X1S C;  3A1I A;  5BO0 A;  3LEL A;  5B31 B;  3AZG D;  1P34 B;  1N1J B;  4Z66 D;  3WTP E;  5B24 A;  4J8W A;  3W98 D;  4YM6 B;  1M18 A;  1Z2C B;  3UTA C;  3VH5 T;  4H9Q B;  3X1S A;  1P3I A;  1JFI A;  1F66 B;  3W99 C;  5B0Z D;  3UT9 C;  3X1V D;  1M1A C;  1F1E A;  3WKJ C;  1P3P C;  3UTA A;  5FUG A;  5CPJ B;  3VH5 A;  3W99 A;  4KUD B;  3W98 C;  3UT9 A;  5G49 A;  4R8P D;  4J8V B;  1M1A A;  3WKJ A;  1P3P A;  5CPK B;  4AWL C;  1R4V A;  5BT1 D;  4J8U C;  4NE6 A;  3W98 A;  2ARO B;  2LY8 A;  3MGR B;  2Y2H A;  3F6T A;  3AV2 B;  4J8U A;  1KX3 B;  2CWE A;  3W97 D;  5CPI C;  1P3M B;  5GSU D;  5AV8 C;  4KHA B;  3AZN B;  5AVC A;  4H9S C;  5CPI A;  3NQU A;  1HQ3 D;  2BYK B;  5B2J B;  5AV8 A;  2F8N H;  3W97 C;  3UTB C;  5AV5 B;  2HIO C;  4WU9 C;  5GSU C;  3AZM D;  4H9N A;  3W97 A;  5BO0 B;  3H0R C;  1BH9 B;  3VH5 W;  5F99 D;  3B0D B;  3X1U B;  3UTB A;  3AZF D;  2HIO A;  4WU9 A;  1P34 D;  5GSU A;  2Y2N A;  3MGS C;  4QLC B;  3REK B;  1AOI C;  2NQB D;  3AZE C;  3WTP D;  2ZY3 A;  3KWQ D;  3LZ1 B;  3REH C;  1AOI A;  3MGS A;  3LZ0 B;  5AVB C;  3AZE A;  2F8N B;  3MVD D;  3REH A;  5JA4 A;  3AZF C;  2FJ7 D;  4LD9 C;  3W99 B;  5GT0 D;  5AY8 B;  3UT9 B;  5AVB A;  3H0L C;  1M1A B;  3KWQ C;  1P3P B;  3AZG B;  1P3F A;  2FFF B;  5GXQ C;  3AZF A;  4LD9 A;  5B32 D;  4Z66 B;  3MNN D;  1P3K D;  3W98 B;  3KXB D;  2ARO D;  1ZLA C;  3WA9 C;  4Z2M H;  3AZJ D;  3REI D;  1H3O B;  3MVD C;  4AWL B;  5GXQ A;  1KX3 D;  5B0Z B;  3X1V B;  1ZLA A;  3EG5 B;  4E44 A;  3AYW D;  3WA9 A;  4CSR B;  3AZH C;  3MVD A;  4H9P A;  4JJN D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...