1EQZC

X-ray structure of the nucleosome core particle at 2.5 a resolution
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
107
structure length
106
Chain Sequence
b'APATGGVKKPHRYRPGTVALREIRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 146 NUCLEOTIDES LONG DNA
publication title Asymmetries in the nucleosome core particle at 2.5 A resolution.
pubmed doi rcsb
molecule tags Structural protein/dna
total genus 31
structure length 106
sequence length 107
chains with identical sequence G
ec nomenclature
pdb deposition date 2000-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1eqzC00
4J8UB 4J8VA 4J8VB 5B0ZA 5B0ZB 5E5AC 4X23C 3WTPD 3MNND 1P3BC 3AZJC 4LD9B 4LD9A 5AV8D 3X1SA 1KX4D 3AZEC 4H9SA 1F66C 1M1AD 5AVBB 2BYKA 3MGRB 2AROD 3B6GA 4JJNA 3REKB 3AZMB 1U35C 4EO5B 1R4VA 1P3FD 3C1BB 4H9PA 3LZ1D 3AV1B 5B33C 5JA4A 4KUDD 4WU8B 3X1VA 4QLCD 3RELA 3LZ0D 5DNMD 5JRGD 3AYWC 1EQZC 3AZIC 3W96C 5BT1C 3AV2A 3MVDD 3MGSD 5B24D 3AV2B 3REJD 5FUGB 1KX3B 3AZNA 4KGCB 1P3KC 5AVCB 1ID3D 3AN2A 5C3IB 5DNNB 3AZGB 3AN2B 5CP6C 1HQ3A 3AZFA 1HQ3B 5AV9C 4AWLC 4Z5TA 5GT0D 3TU4D 2CV5A 2CV5B 3W98C 4J8UC 3AZHD 1P3AA 2F8NA 5B31A 3C1CC 1P3MA 3WA9D 2FJ7B 3UTBD 2F8NH 3O62C 1H3OA 4R8PA 3AZLD 3KWQB 4YM6D 4XUJB 1M19D 3MGQA 3REKC 2PYOB 3AZMC 4EO5C 2NQBD 3C1BC 4WU9A 3AV1C 5B0YA 4Z66A 1TAFA 1TAFB 2F8NG 4JJND 5B31G 1P3LD 2YFVB 5CPKB 5CPJB 5CHLB 1BH8B 5BNVB 5B1LB 3B6FB 4M6BA 3AFAA 3VH6W 1N1JA 1KX3C 1N1JB 3MGPA 2JSSA 3RELD 5B40A 4KGCC 3UTAA 3AZGC 3UTAB 5F99D 3REHC 4X23A 4X23B 5E5AB 1P3BB 3AZJA 3AZEA 3AZEB 3VH6T 3LJAB 5B2IC 3VH6A 3KXBC 4CAYA 1F66A 1F66B 1S32A 1KX5C 2FJ7C 4NE5A 1U35B 4J8WA 4Z5TD 3WKJD 4XUJC 5B33A 2RVQC 5B33B 2BYMB 2PYOC 1M18A 1TZYC 3AYWA 3AYWB 1EQZB 2LY8A 1ZLAD 5GXQC 3AZIA 3W97D 1P3PC 5AV5A 5AV6A 3W96A 3W96B 4QLCB 4NE3A 3LZ0B 3MGQD 5DNMB 3A6NC 5JRGB 1P3KA 1P3KB 1P3GD 5CPID 2NZDD 5CP6A 4WU9D 5B1LC 3LELC 5B32C 4J8XA 1P34A 5B0YD 5AV9A 3MGSB 5B24B 5KDMB 1ID3B 3W98A 3W99D 3W98B 4J8UA 3C1CA 3C1CB 1KU5A 3O62B 3LJAC 3TU4B 5AVBA 3MGPD 3WAAD 4G91B 3MGRA 3MNNC 3REKA 3WTPC 3AZMA 5AV8C 1KX4C 1AOID 3C1BA 1M1AC 3AV1A 3AZLB 4YM6B 2AROC 5B2JD 4WU8A 1S32D 5GT3D 3AZKD 3B0DC 2NQBB 3X1UD 3REID 1P3FC 4J8WD 3LZ1C 1P3ID 4KUDC 3UT9D 4QLCC 3X1TD 3LZ0C 5DNMC 1M18D 5FUGA 5JRGC 3KUYD 1P3LB 1KX3A 4KGCA 5AVCA 2HIOD 5DNNA 3AZGA 5B1MD 3REHB 3UT9C 3MVDC 3MGSC 5AV5D 5B24C 5AV6D 5AY8D 4WV4B 3REJC 2CWEA 4XZQD 5B2IA 5B2IB 3KXBB 1ID3C 1KX5B 3V9RB 1JFIA 4ZBJC 2FJ7A 4YS3D 5GT0C 1P3OD 5GSUD 4J8XD 3TU4C 1P34D 4ZUXD 4WZSB 4G91C 3KWQA 4HGAC 4XUJA 3AZHC 2PYOA 4Z2MH 3X1VD 4WNNB 3WA9C 1WWIA 1TZYB 4J8VD 3UTBC 5B0ZD 4LD9D 3X1SD 3B0BA 1WWSA 3AZLC 3WKJB 4YM6C 1M19C 5GXQB 1P3PB 3X1VC 5AVBD 3MGRD 3B6GD 2NQBC 3A6NB 2YFVA 3VH5W 5CPKA 5CPJA 4H9SC 3W97B 1BH8A 5BNVA 5B1LA 3LELB 3B6FA 4Z2MG 5B32A 3B6GC 5B32B 2IO5B 2YFWB 4JJNC 4WU8D 1P3LC 3VH5T 4G92C 3VH5A 1P3GB 5E5AA 1P3BA 4E45A 3LJAA 3RELC 3AV2D 3AZND 5AVCD 5F99C 3MNNA 3MNNB 3AN2D 3WTPB 3B0CW 1U35A 5AV8B 1HQ3D 3AZFD 1KX4A 1KX4B 1M1AA 1M1AB 1BFMA 2CV5D 2BYMA 2AROA 2AROB 1BH9B 4H9RB 1P3AD 2F8ND 5B31D 3B0CT 5G49A 3B0DB 5G49B 1P3MD 1AOIB 1P3FA 3R45A 1P3FB 3R45B 4Z5TC 3WKJC 3LZ1B 1EQZA 4R8PD 4CSRB 3KWQD 4KUDB 4QLCA 5GT3B 3LZ0A 3AZKB 5DNMA 5JRGA 3X1UB 3REIB 5BS7C 1P3IB 1ZLAC 4NE6A 3W97C 4DRAA 4UUZB 3UT9B 2IO5C 4Z66D 3MGSA 5B24A 3MVDB 3MGQC 3REJA 4H9NB 3KUYB 3REJB 5KDMA 2HIOB 1P3GC 5CPIC 1ID3A 2NZDC 5B1MB 4WU9C 5CPKD 5CPJD 4ZBJB 4H9OA 5B0YC 4H9OB 3O62A 3B6FD 4KHAB 5AY8B 5GT0B 3TU4A 4XZQB 3AFAD 3W99C 2HUEB 5B40D 4HGAB 3AZHB 3UTAD 3WA9B 1HTAA 3UTBB 4X23D 5E5AD 5GSUB 3AZJD 3AZED 5BNXB 4ZUXB 3WAAC 3MGPC 3AZLA 4YM6A 1M19A 1M19B 1F66D 3X1VB 1JFIB 1AOIC 2NQBA 1U35D 3X1SB 5B2JC 1S32C 5GT3C 5B33D 3AZKC 2BYKB 3B6GB 1P3LA 4JJNB 3X1UC 3REIC 4J8WC 1P3IC 5BO0A 5BO0B 3AYWD 4G92B 1ULYA 4H9PB 3REHA 1EQZD 3X1TC 3AZID 1M18C 2F8NK 5JA4B 3W96D 3KUYC 3RELB 5BT1D 1B67A 3KXBA 2HIOC 1KX5A 5B1MC 3V9RA 1P3KD 5F99A 5F99B 5AV5C 5CP6D 5AV6C 5AY8C 4XZQC 5AV9D 2HUEC 3AZNB 4WNNA 4YS3C 3W98D 1TZYA 4J8UD 3NQJA 3NQJB 3C1CD 3AZFB 1P3OC 5GSUC 4J8XC 1P34C 4ZUXC 3O62D 3WKJA 4Z5TB 5GXQA 1P3PA 1F1EA 4J8VC 1P3AB 5B0ZC 2F8NB 5B31B 3REKD 1P3MB 4LD9C 3A6NA 3AZMD 3X1SC 5BS7A 1A7WA 1H3OB 4R8PB 3C1BD 1ZLAA 1ZLAB 3W97A 3LELA 5AVBC 3AV1D 3MGRC 2YFWA 3MGQB 1P3GA 5CPIA 2NZDA 5CPIB 2NZDB 4WU9B 5B0YB 4Z66B 4WU8C 1KX3D 4KGCD 3W99A 3W99B 5DNND 3WTPA 3AZGD 5AV8A 3REHD 4H9QA 4H9QB 3AV2C 5B32G 3AFAB 3WAAA 3AZNC 3MGPB 4E44A 5B2ID 5B40B 5AVCC 3KXBD 3WAAB 5C3IC 1BH9A 5DNNC 4H9RA 3AN2C 1KX5D 1HQ3C 3AZFC 1AOIA 2FJ7D 3AZJB 3LZ1A 1Q9CA 2CV5C 4CSRA 4CAYB 5B2JA 5B2JB 4KUDA 5GT3A 4XUJD 1S32B 1P3AC 2RVQD 3AZKA 5B31C 2PYOD 1P3MC 3X1UA 3REIA 1TZYD 3WTPE 1P3IA 4J8WB 2L5AA 4R8PC 4UUZA 3KWQC 3UT9A 3X1TA 3X1TB 5GXQD 3MVDA 1P3PD 1M18B 4H9NA 3KUYA 1B6WA 2HIOA 3A6ND 5B1MA 3AZIB 4Z66C 5AV5B 4KHAA 5B1LD 5AY8A 5GT0A 5AV6B 3LELD 5B32D 4XZQA 3AZHA 3NQUA 5CPKC 3NQUB 3WA9A 5CPJC 4YS3A 4YS3B 3UTBA 3B6FC 5CP6B 1P3OA 1P3BD 1P3OB 5GSUA 4NFTA 4J8XB 1P34B 3AFAC 5AV9B 5BNXA 4ZUXA 4AWLB 3LJAD 5B40C 4DRBA 3UTAC 3KSYA
chains in the Genus database with same CATH superfamily
4J8UB 4J8VA 4J8VB 5B0ZA 5B0ZB 5E5AC 4X23C 3WTPD 3MNND 1P3BC 3AZJC 4LD9B 4LD9A 4WJ3C 5AV8D 3X1SA 1KX4D 3AZEC 2ZY2A 4H9SA 1F66C 1M1AD 5AVBB 2BYKA 3MGRB 2AROD 3A1IA 3B6GA 4JJNA 3REKB 3AZMB 1U35C 4EO5B 1R4VA 1P3FD 3C1BB 4H9PA 3LZ1D 2Y2JA 3AV1B 5B33C 5JA4A 4KUDD 4WU8B 3X1VA 4QLCD 3RELA 3LZ0D 5DNMD 5JRGD 3AYWC 2JE5A 2Y2MA 1EQZC 3AZIC 2ZY3A 3W96C 5BT1C 3AV2A 3MVDD 3MGSD 5B24D 3AV2B 3REJD 5FUGB 1KX3B 3AZNA 4KGCB 1P3KC 5AVCB 1ID3D 3AN2A 5C3IB 5DNNB 3AZGB 3AN2B 5CP6C 1HQ3A 3AZFA 1HQ3B 5AV9C 4AWLC 4Z5TA 5GT0D 3TU4D 2CV5A 2CV5B 3W98C 4J8UC 3AZHD 1P3AA 2F8NA 5B31A 3C1CC 1P3MA 3WA9D 2FJ7B 2DF4C 2Y2QA 3UTBD 2F8NH 3O62C 1H3OA 4R8PA 3AZLD 3KWQB 4YM6D 4XUJB 1M19D 2ZY5A 3MGQA 3REKC 2PYOB 3AZMC 4EO5C 2NQBD 3C1BC 2BG1A 4WU9A 3AV1C 5B0YA 4Z66A 2W8SA 1TAFA 1TAFB 2F8NG 4JJND 5B31G 1P3LD 2YFVB 5CPKB 5CPJB 5CHLB 1BH8B 5BNVB 5B1LB 3B6FB 4M6BA 3AFAA 3VH6W 1N1JA 1KX3C 1N1JB 3MGPA 2JSSA 3RELD 5B40A 4KGCC 3UTAA 2J8PA 3UTAB 3AZGC 5F99D 3REHC 4X23A 4X23B 5E5AB 1P3BB 3AZJA 3AZEA 3AZEB 3VH6T 3LJAB 5B2IC 3VH6A 3KXBC 4CAYA 1F66A 1F66B 1S32A 1KX5C 3P5JB 2FJ7C 4NE5A 1U35B 4J8WA 3EPHA 4Z5TD 3WKJD 4XUJC 5B33A 2RVQC 5B33B 2BYMB 2PYOC 1M18A 1TZYC 3AYWA 3EG5B 3AYWB 1EQZB 2LY8A 1ZLAD 5GXQC 3AZIA 3A1KA 3W97D 1P3PC 5AV5A 5AV6A 3W96A 3W96B 4QLCB 4NE3A 3LZ0B 3MGQD 5DNMB 3A6NC 5JRGB 2FFFB 1P3KA 1P3KB 1P3GD 5CPID 2NZDD 5CP6A 4WU9D 5B1LC 3LELC 5B32C 4J8XA 1P34A 5B0YD 5AV9A 3MGSB 5B24B 5KDMB 1ID3B 3W98A 3W99D 3W98B 4J8UA 3C1CA 3C1CB 1KU5A 3O62B 3LJAC 3TU4B 5AVBA 3MGPD 3WAAD 4G91B 3MGRA 3MNNC 3REKA 3WTPC 3AZMA 5AV8C 1KX4C 1AOID 3C1BA 1M1AC 3AV1A 3AZLB 4YM6B 2AROC 5B2JD 4WU8A 1S32D 5GT3D 3AZKD 3B0DC 2NQBB 3X1UD 3REID 1P3FC 4J8WD 3LZ1C 1P3ID 2G5IC 2Y2GA 2Y2NA 4KUDC 3UT9D 4QLCC 3X1TD 3LZ0C 5DNMC 1M18D 5FUGA 5JRGC 3KUYD 1P3LB 1KX3A 4KGCA 5AVCA 2HIOD 2JCHA 5DNNA 3AZGA 5B1MD 3REHB 3UT9C 3MVDC 3MGSC 5AV5D 5B24C 5AV6D 5AY8D 4WV4B 3REJC 3EPJA 2CWEA 4XZQD 5B2IA 5B2IB 3KXBB 1ID3C 2ZY4A 1KX5B 3V9RB 1JFIA 4ZBJC 2FJ7A 4YS3D 5GT0C 1P3OD 5GSUD 4J8XD 3TU4C 1P34D 4ZUXD 4WZSB 4G91C 3KWQA 4HGAC 4XUJA 3AZHC 2PYOA 4Z2MH 3X1VD 4WNNB 3WA9C 1WWIA 1TZYB 4J8VD 3UTBC 5B0ZD 4LD9D 3X1SD 3B0BA 1WWSA 3AZLC 3WKJB 4YM6C 1M19C 5GXQB 1P3PB 3X1VC 5AVBD 3MGRD 3B6GD 2NQBC 3A6NB 2YFVA 3VH5W 5CPKA 5CPJA 4H9SC 2XD5A 3W97B 1BH8A 5BNVA 5B1LA 3LELB 4DQYB 3B6FA 4Z2MG 2RIQA 5B32A 5B32B 3B6GC 2IO5B 2YFWB 4JJNC 4WU8D 1P3LC 3VH5T 4G92C 3VH5A 1P3GB 2Y2PA 5E5AA 1P3BA 4E45A 3LJAA 3RELC 3AV2D 3AZND 3AL0C 5AVCD 5F99C 3MNNA 3MNNB 3AN2D 3WTPB 3B0CW 1U35A 3H0RC 5AV8B 1HQ3D 2Y2LA 3AZFD 1KX4A 1KX4B 1T3UA 1M1AA 1M1AB 1BFMA 2CV5D 2BYMA 2AROA 2AROB 1BH9B 4H9RB 1P3AD 2F8ND 5B31D 3B0CT 5G49A 3B0DB 5G49B 1P3MD 1AOIB 2Y2HA 4UPKA 1P3FA 3R45A 1P3FB 3R45B 4Z5TC 3WKJC 3LZ1B 1EQZA 4R8PD 4CSRB 3KWQD 4KUDB 4QLCA 5GT3B 3LZ0A 3AZKB 3H0LC 5DNMA 5JRGA 3X1UB 3REIB 5BS7C 1P3IB 1ZLAC 4NE6A 3W97C 4DRAA 4UUZB 3UT9B 2IO5C 4Z66D 3MGSA 5B24A 3MVDB 3MGQC 3REJA 4H9NB 3KUYB 3REJB 5KDMA 2HIOB 1P3GC 5CPIC 1ID3A 2NZDC 5B1MB 4WU9C 5CPKD 5CPJD 4ZBJB 4H9OA 5B0YC 4H9OB 3O62A 3B6FD 4KHAB 5AY8B 5GT0B 3TU4A 4XZQB 3AFAD 3IP4C 3W99C 2HUEB 5B40D 4HGAB 3AZHB 1W2EA 3UTAD 3WA9B 1HTAA 3UTBB 4X23D 5E5AD 5GSUB 3AZJD 3AZED 5BNXB 4ZUXB 3WAAC 3MGPC 3AZLA 4YM6A 1M19A 1M19B 2G5HC 1F66D 3X1VB 1JFIB 1AOIC 3H0MC 2NQBA 1U35D 3X1SB 5B2JC 1S32C 5GT3C 5B33D 3AZKC 2BYKB 3B6GB 1P3LA 4JJNB 3X1UC 3REIC 4J8WC 1P3IC 5BO0A 5BO0B 2ZM5A 3AYWD 4G92B 1ULYA 4H9PB 3REHA 1Z2CB 1EQZD 3X1TC 3AZID 1M18C 2F8NK 5JA4B 3W96D 3KUYC 3RELB 5BT1D 1B67A 3KXBA 2HIOC 1KX5A 2F2AC 5B1MC 3V9RA 1P3KD 5F99A 5F99B 5AV5C 3EPKA 5CP6D 5AV6C 5AY8C 1PZRA 4XZQC 5AV9D 2HUEC 3AZNB 4WNNA 4YS3C 3W98D 1TZYA 4J8UD 3NQJA 3KFUG 3NQJB 3C1CD 3AZFB 2DQNC 1P3OC 5GSUC 4J8XC 1P34C 4ZUXC 3F6TA 3O62D 3WKJA 4Z5TB 3EPLA 5GXQA 1P3PA 1F1EA 4J8VC 1P3AB 5B0ZC 2F8NB 3FDDA 5B31B 3REKD 1P3MB 4LD9C 3A6NA 3AZMD 3X1SC 5BS7A 1A7WA 1H3OB 4R8PB 3C1BD 1ZLAA 1ZLAB 3W97A 3LELA 5AVBC 3AV1D 3MGRC 2YFWA 3MGQB 2Y2OA 1P3GA 5CPIA 2NZDA 5CPIB 2NZDB 4WU9B 5B0YB 4Z66B 4WU8C 1KX3D 4KGCD 3W99A 3W99B 5DNND 3WTPA 3AZGD 5AV8A 3REHD 4H9QA 4H9QB 2Y2KA 3AV2C 5B32G 3AFAB 3WAAA 3AZNC 3MGPB 4E44A 5B2ID 5B40B 5AVCC 3KXBD 3WAAB 5C3IC 1BH9A 5DNNC 4H9RA 3AN2C 2XD1A 1KX5D 1HQ3C 3AZFC 1AOIA 2FJ7D 3AZJB 3LZ1A 1Q9CA 2CV5C 4CSRA 4CAYB 5B2JA 5B2JB 4KUDA 5GT3A 4XUJD 1S32B 1P3AC 2RVQD 3AZKA 5B31C 2PYOD 1P3MC 3X1UA 3REIA 1TZYD 3WTPE 1P3IA 4J8WB 2L5AA 4R8PC 4UUZA 2VQRA 3KWQC 3UT9A 3X1TA 3X1TB 5GXQD 3MVDA 1P3PD 1M18B 4H9NA 3KUYA 1B6WA 2HIOA 3A6ND 5B1MA 3AZIB 4Z66C 4KHAA 5AV5B 5B1LD 5AY8A 5GT0A 5AV6B 3LELD 5B32D 4XZQA 3AZHA 3NQUA 5CPKC 3NQUB 3WA9A 5CPJC 4YS3A 4YS3B 3UTBA 2Y2IA 5CP6B 3B6FC 1P3OA 1P3BD 1P3OB 5GSUA 4NFTA 4J8XB 1P34B 3AFAC 5AV9B 5BNXA 4ZUXA 4AWLB 3LJAD 5B40C 4DRBA 2UWXA 3UTAC 3KSYA
chains in the Genus database with same CATH topology
4J8UB 4J8VA 4J8VB 5B0ZA 5B0ZB 5E5AC 4X23C 3WTPD 3MNND 1P3BC 3AZJC 4LD9B 4LD9A 4WJ3C 5AV8D 3X1SA 1KX4D 3AZEC 2ZY2A 4H9SA 1F66C 1M1AD 5AVBB 2BYKA 3MGRB 2AROD 3A1IA 3B6GA 4JJNA 3REKB 3AZMB 1U35C 4EO5B 1R4VA 1P3FD 3C1BB 4H9PA 3LZ1D 2Y2JA 3AV1B 5B33C 5JA4A 4KUDD 4WU8B 3X1VA 4QLCD 3RELA 3LZ0D 5DNMD 5JRGD 3AYWC 2JE5A 2Y2MA 1EQZC 3AZIC 2ZY3A 3W96C 5BT1C 3AV2A 3MVDD 3MGSD 5B24D 3AV2B 3REJD 5FUGB 1KX3B 3AZNA 4KGCB 1P3KC 5AVCB 1ID3D 3AN2A 5C3IB 5DNNB 3AZGB 3AN2B 5CP6C 1HQ3A 3AZFA 1HQ3B 5AV9C 4AWLC 4Z5TA 5GT0D 3TU4D 2CV5A 2CV5B 3W98C 4J8UC 3AZHD 1P3AA 2F8NA 5B31A 3C1CC 1P3MA 3WA9D 2FJ7B 2DF4C 2Y2QA 3UTBD 2F8NH 3O62C 1H3OA 4R8PA 3AZLD 3KWQB 4YM6D 4XUJB 1M19D 2ZY5A 3MGQA 3REKC 2PYOB 3AZMC 4EO5C 2NQBD 3C1BC 2BG1A 4WU9A 3AV1C 5B0YA 4Z66A 2W8SA 1TAFA 1TAFB 2F8NG 4JJND 5B31G 1P3LD 2YFVB 5CPKB 5CPJB 5CHLB 1BH8B 5BNVB 5B1LB 3B6FB 4M6BA 3AFAA 3VH6W 1N1JA 1KX3C 1N1JB 3MGPA 2JSSA 3RELD 5B40A 4KGCC 3UTAA 2J8PA 3UTAB 3AZGC 5F99D 3REHC 4X23A 4X23B 5E5AB 1P3BB 3AZJA 3AZEA 3AZEB 3VH6T 3LJAB 5B2IC 3VH6A 3KXBC 4CAYA 1F66A 1F66B 1S32A 1KX5C 3P5JB 2FJ7C 4NE5A 1U35B 4J8WA 3EPHA 4Z5TD 3WKJD 4XUJC 5B33A 2RVQC 5B33B 2BYMB 2PYOC 1M18A 1TZYC 3AYWA 3EG5B 3AYWB 1EQZB 2LY8A 1ZLAD 5GXQC 3AZIA 3A1KA 3W97D 1P3PC 5AV5A 5AV6A 3W96A 3W96B 4QLCB 4NE3A 3LZ0B 3MGQD 5DNMB 3A6NC 5JRGB 2FFFB 1P3KA 1P3KB 1P3GD 5CPID 2NZDD 5CP6A 4WU9D 5B1LC 3LELC 5B32C 4J8XA 1P34A 5B0YD 5AV9A 3MGSB 5B24B 5KDMB 1ID3B 3W98A 3W99D 3W98B 4J8UA 3C1CA 3C1CB 1KU5A 3O62B 3LJAC 3TU4B 5AVBA 3MGPD 3WAAD 4G91B 3MGRA 3MNNC 3REKA 3WTPC 3AZMA 5AV8C 1KX4C 1AOID 3C1BA 1M1AC 3AV1A 3AZLB 4YM6B 2AROC 5B2JD 4WU8A 1S32D 5GT3D 3AZKD 3B0DC 2NQBB 3X1UD 3REID 1P3FC 4J8WD 3LZ1C 1P3ID 2G5IC 2Y2GA 2Y2NA 4KUDC 3UT9D 4QLCC 3X1TD 3LZ0C 5DNMC 1M18D 5FUGA 5JRGC 3KUYD 1P3LB 1KX3A 4KGCA 5AVCA 2HIOD 2JCHA 5DNNA 3AZGA 5B1MD 3REHB 3UT9C 3MVDC 3MGSC 5AV5D 5B24C 5AV6D 5AY8D 4WV4B 3REJC 3EPJA 2CWEA 4XZQD 5B2IA 5B2IB 3KXBB 1ID3C 2ZY4A 1KX5B 3V9RB 1JFIA 4ZBJC 2FJ7A 4YS3D 5GT0C 1P3OD 5GSUD 4J8XD 3TU4C 1P34D 4ZUXD 4WZSB 4G91C 3KWQA 4HGAC 4XUJA 3AZHC 2PYOA 4Z2MH 3X1VD 4WNNB 3WA9C 1WWIA 1TZYB 4J8VD 3UTBC 5B0ZD 4LD9D 3X1SD 3B0BA 1WWSA 3AZLC 3WKJB 4YM6C 1M19C 5GXQB 1P3PB 3X1VC 5AVBD 3MGRD 3B6GD 2NQBC 3A6NB 2YFVA 3VH5W 5CPKA 5CPJA 4H9SC 2XD5A 3W97B 1BH8A 5BNVA 5B1LA 3LELB 4DQYB 3B6FA 4Z2MG 2RIQA 5B32A 5B32B 3B6GC 2IO5B 2YFWB 4JJNC 4WU8D 1P3LC 3VH5T 4G92C 3VH5A 1P3GB 2Y2PA 5E5AA 1P3BA 4E45A 3LJAA 3RELC 3AV2D 3AZND 3AL0C 5AVCD 5F99C 3MNNA 3MNNB 3AN2D 3WTPB 3B0CW 1U35A 3H0RC 5AV8B 1HQ3D 2Y2LA 3AZFD 1KX4A 1KX4B 1T3UA 1M1AA 1M1AB 1BFMA 2CV5D 2BYMA 2AROA 2AROB 1BH9B 4H9RB 1P3AD 2F8ND 5B31D 3B0CT 5G49A 3B0DB 5G49B 1P3MD 1AOIB 2Y2HA 4UPKA 1P3FA 3R45A 1P3FB 3R45B 4Z5TC 3WKJC 3LZ1B 1EQZA 4R8PD 4CSRB 3KWQD 4KUDB 4QLCA 5GT3B 3LZ0A 3AZKB 3H0LC 5DNMA 5JRGA 3X1UB 3REIB 5BS7C 1P3IB 1ZLAC 4NE6A 3W97C 4DRAA 4UUZB 3UT9B 2IO5C 4Z66D 3MGSA 5B24A 3MVDB 3MGQC 3REJA 4H9NB 3KUYB 3REJB 5KDMA 2HIOB 1P3GC 5CPIC 1ID3A 2NZDC 5B1MB 4WU9C 5CPKD 5CPJD 4ZBJB 4H9OA 5B0YC 4H9OB 3O62A 3B6FD 4KHAB 5AY8B 5GT0B 3TU4A 4XZQB 3AFAD 3IP4C 3W99C 2HUEB 5B40D 4HGAB 3AZHB 1W2EA 3UTAD 3WA9B 1HTAA 3UTBB 4X23D 5E5AD 5GSUB 3AZJD 3AZED 5BNXB 4ZUXB 3WAAC 3MGPC 3AZLA 4YM6A 1M19A 1M19B 2G5HC 1F66D 3X1VB 1JFIB 1AOIC 3H0MC 2NQBA 1U35D 3X1SB 5B2JC 1S32C 5GT3C 5B33D 3AZKC 2BYKB 3B6GB 1P3LA 4JJNB 3X1UC 3REIC 4J8WC 1P3IC 5BO0A 5BO0B 2ZM5A 3AYWD 4G92B 1ULYA 4H9PB 3REHA 1Z2CB 1EQZD 3X1TC 3AZID 1M18C 2F8NK 5JA4B 3W96D 3KUYC 3RELB 5BT1D 1B67A 3KXBA 2HIOC 1KX5A 2F2AC 5B1MC 3V9RA 1P3KD 5F99A 5F99B 5AV5C 3EPKA 5CP6D 5AV6C 5AY8C 1PZRA 4XZQC 5AV9D 2HUEC 3AZNB 4WNNA 4YS3C 3W98D 1TZYA 4J8UD 3NQJA 3KFUG 3NQJB 3C1CD 3AZFB 2DQNC 1P3OC 5GSUC 4J8XC 1P34C 4ZUXC 3F6TA 3O62D 3WKJA 4Z5TB 3EPLA 5GXQA 1P3PA 1F1EA 4J8VC 1P3AB 5B0ZC 2F8NB 3FDDA 5B31B 3REKD 1P3MB 4LD9C 3A6NA 3AZMD 3X1SC 5BS7A 1A7WA 1H3OB 4R8PB 3C1BD 1ZLAA 1ZLAB 3W97A 3LELA 5AVBC 3AV1D 3MGRC 2YFWA 3MGQB 2Y2OA 1P3GA 5CPIA 2NZDA 5CPIB 2NZDB 4WU9B 5B0YB 4Z66B 4WU8C 1KX3D 4KGCD 3W99A 3W99B 5DNND 3WTPA 3AZGD 5AV8A 3REHD 4H9QA 4H9QB 2Y2KA 3AV2C 5B32G 3AFAB 3WAAA 3AZNC 3MGPB 4E44A 5B2ID 5B40B 5AVCC 3KXBD 3WAAB 5C3IC 1BH9A 5DNNC 4H9RA 3AN2C 2XD1A 1KX5D 1HQ3C 3AZFC 1AOIA 2FJ7D 3AZJB 3LZ1A 1Q9CA 2CV5C 4CSRA 4CAYB 5B2JA 5B2JB 4KUDA 5GT3A 4XUJD 1S32B 1P3AC 2RVQD 3AZKA 5B31C 2PYOD 1P3MC 3X1UA 3REIA 1TZYD 3WTPE 1P3IA 4J8WB 2L5AA 4R8PC 4UUZA 2VQRA 3KWQC 3UT9A 3X1TA 3X1TB 5GXQD 3MVDA 1P3PD 1M18B 4H9NA 3KUYA 1B6WA 2HIOA 3A6ND 5B1MA 3AZIB 4Z66C 4KHAA 5AV5B 5B1LD 5AY8A 5GT0A 5AV6B 3LELD 5B32D 4XZQA 3AZHA 3NQUA 5CPKC 3NQUB 3WA9A 5CPJC 4YS3A 4YS3B 3UTBA 2Y2IA 5CP6B 3B6FC 1P3OA 1P3BD 1P3OB 5GSUA 4NFTA 4J8XB 1P34B 3AFAC 5AV9B 5BNXA 4ZUXA 4AWLB 3LJAD 5B40C 4DRBA 2UWXA 3UTAC 3KSYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J8U B;  4J8V A;  4J8V B;  5B0Z A;  5B0Z B;  5E5A C;  4X23 C;  3WTP D;  3MNN D;  1P3B C;  3AZJ C;  4LD9 B;  4LD9 A;  5AV8 D;  3X1S A;  1KX4 D;  3AZE C;  4H9S A;  1F66 C;  1M1A D;  5AVB B;  2BYK A;  3MGR B;  2ARO D;  3B6G A;  4JJN A;  3REK B;  3AZM B;  1U35 C;  4EO5 B;  1R4V A;  1P3F D;  3C1B B;  4H9P A;  3LZ1 D;  3AV1 B;  5B33 C;  5JA4 A;  4KUD D;  4WU8 B;  3X1V A;  4QLC D;  3REL A;  3LZ0 D;  5DNM D;  5JRG D;  3AYW C;  1EQZ C;  3AZI C;  3W96 C;  5BT1 C;  3AV2 A;  3MVD D;  3MGS D;  5B24 D;  3AV2 B;  3REJ D;  5FUG B;  1KX3 B;  3AZN A;  4KGC B;  1P3K C;  5AVC B;  1ID3 D;  3AN2 A;  5C3I B;  5DNN B;  3AZG B;  3AN2 B;  5CP6 C;  1HQ3 A;  3AZF A;  1HQ3 B;  5AV9 C;  4AWL C;  4Z5T A;  5GT0 D;  3TU4 D;  2CV5 A;  2CV5 B;  3W98 C;  4J8U C;  3AZH D;  1P3A A;  2F8N A;  5B31 A;  3C1C C;  1P3M A;  3WA9 D;  2FJ7 B;  3UTB D;  2F8N H;  3O62 C;  1H3O A;  4R8P A;  3AZL D;  3KWQ B;  4YM6 D;  4XUJ B;  1M19 D;  3MGQ A;  3REK C;  2PYO B;  3AZM C;  4EO5 C;  2NQB D;  3C1B C;  4WU9 A;  3AV1 C;  5B0Y A;  4Z66 A;  1TAF A;  1TAF B;  2F8N G;  4JJN D;  5B31 G;  1P3L D;  2YFV B;  5CPK B;  5CPJ B;  5CHL B;  1BH8 B;  5BNV B;  5B1L B;  3B6F B;  4M6B A;  3AFA A;  3VH6 W;  1N1J A;  1KX3 C;  1N1J B;  3MGP A;  2JSS A;  3REL D;  5B40 A;  4KGC C;  3UTA A;  3AZG C;  3UTA B;  5F99 D;  3REH C;  4X23 A;  4X23 B;  5E5A B;  1P3B B;  3AZJ A;  3AZE A;  3AZE B;  3VH6 T;  3LJA B;  5B2I C;  3VH6 A;  3KXB C;  4CAY A;  1F66 A;  1F66 B;  1S32 A;  1KX5 C;  2FJ7 C;  4NE5 A;  1U35 B;  4J8W A;  4Z5T D;  3WKJ D;  4XUJ C;  5B33 A;  2RVQ C;  5B33 B;  2BYM B;  2PYO C;  1M18 A;  1TZY C;  3AYW A;  3AYW B;  1EQZ B;  2LY8 A;  1ZLA D;  5GXQ C;  3AZI A;  3W97 D;  1P3P C;  5AV5 A;  5AV6 A;  3W96 A;  3W96 B;  4QLC B;  4NE3 A;  3LZ0 B;  3MGQ D;  5DNM B;  3A6N C;  5JRG B;  1P3K A;  1P3K B;  1P3G D;  5CPI D;  2NZD D;  5CP6 A;  4WU9 D;  5B1L C;  3LEL C;  5B32 C;  4J8X A;  1P34 A;  5B0Y D;  5AV9 A;  3MGS B;  5B24 B;  5KDM B;  1ID3 B;  3W98 A;  3W99 D;  3W98 B;  4J8U A;  3C1C A;  3C1C B;  1KU5 A;  3O62 B;  3LJA C;  3TU4 B;  5AVB A;  3MGP D;  3WAA D;  4G91 B;  3MGR A;  3MNN C;  3REK A;  3WTP C;  3AZM A;  5AV8 C;  1KX4 C;  1AOI D;  3C1B A;  1M1A C;  3AV1 A;  3AZL B;  4YM6 B;  2ARO C;  5B2J D;  4WU8 A;  1S32 D;  5GT3 D;  3AZK D;  3B0D C;  2NQB B;  3X1U D;  3REI D;  1P3F C;  4J8W D;  3LZ1 C;  1P3I D;  4KUD C;  3UT9 D;  4QLC C;  3X1T D;  3LZ0 C;  5DNM C;  1M18 D;  5FUG A;  5JRG C;  3KUY D;  1P3L B;  1KX3 A;  4KGC A;  5AVC A;  2HIO D;  5DNN A;  3AZG A;  5B1M D;  3REH B;  3UT9 C;  3MVD C;  3MGS C;  5AV5 D;  5B24 C;  5AV6 D;  5AY8 D;  4WV4 B;  3REJ C;  2CWE A;  4XZQ D;  5B2I A;  5B2I B;  3KXB B;  1ID3 C;  1KX5 B;  3V9R B;  1JFI A;  4ZBJ C;  2FJ7 A;  4YS3 D;  5GT0 C;  1P3O D;  5GSU D;  4J8X D;  3TU4 C;  1P34 D;  4ZUX D;  4WZS B;  4G91 C;  3KWQ A;  4HGA C;  4XUJ A;  3AZH C;  2PYO A;  4Z2M H;  3X1V D;  4WNN B;  3WA9 C;  1WWI A;  1TZY B;  4J8V D;  3UTB C;  5B0Z D;  4LD9 D;  3X1S D;  3B0B A;  1WWS A;  3AZL C;  3WKJ B;  4YM6 C;  1M19 C;  5GXQ B;  1P3P B;  3X1V C;  5AVB D;  3MGR D;  3B6G D;  2NQB C;  3A6N B;  2YFV A;  3VH5 W;  5CPK A;  5CPJ A;  4H9S C;  3W97 B;  1BH8 A;  5BNV A;  5B1L A;  3LEL B;  3B6F A;  4Z2M G;  5B32 A;  3B6G C;  5B32 B;  2IO5 B;  2YFW B;  4JJN C;  4WU8 D;  1P3L C;  3VH5 T;  4G92 C;  3VH5 A;  1P3G B;  5E5A A;  1P3B A;  4E45 A;  3LJA A;  3REL C;  3AV2 D;  3AZN D;  5AVC D;  5F99 C;  3MNN A;  3MNN B;  3AN2 D;  3WTP B;  3B0C W;  1U35 A;  5AV8 B;  1HQ3 D;  3AZF D;  1KX4 A;  1KX4 B;  1M1A A;  1M1A B;  1BFM A;  2CV5 D;  2BYM A;  2ARO A;  2ARO B;  1BH9 B;  4H9R B;  1P3A D;  2F8N D;  5B31 D;  3B0C T;  5G49 A;  3B0D B;  5G49 B;  1P3M D;  1AOI B;  1P3F A;  3R45 A;  1P3F B;  3R45 B;  4Z5T C;  3WKJ C;  3LZ1 B;  1EQZ A;  4R8P D;  4CSR B;  3KWQ D;  4KUD B;  4QLC A;  5GT3 B;  3LZ0 A;  3AZK B;  5DNM A;  5JRG A;  3X1U B;  3REI B;  5BS7 C;  1P3I B;  1ZLA C;  4NE6 A;  3W97 C;  4DRA A;  4UUZ B;  3UT9 B;  2IO5 C;  4Z66 D;  3MGS A;  5B24 A;  3MVD B;  3MGQ C;  3REJ A;  4H9N B;  3KUY B;  3REJ B;  5KDM A;  2HIO B;  1P3G C;  5CPI C;  1ID3 A;  2NZD C;  5B1M B;  4WU9 C;  5CPK D;  5CPJ D;  4ZBJ B;  4H9O A;  5B0Y C;  4H9O B;  3O62 A;  3B6F D;  4KHA B;  5AY8 B;  5GT0 B;  3TU4 A;  4XZQ B;  3AFA D;  3W99 C;  2HUE B;  5B40 D;  4HGA B;  3AZH B;  3UTA D;  3WA9 B;  1HTA A;  3UTB B;  4X23 D;  5E5A D;  5GSU B;  3AZJ D;  3AZE D;  5BNX B;  4ZUX B;  3WAA C;  3MGP C;  3AZL A;  4YM6 A;  1M19 A;  1M19 B;  1F66 D;  3X1V B;  1JFI B;  1AOI C;  2NQB A;  1U35 D;  3X1S B;  5B2J C;  1S32 C;  5GT3 C;  5B33 D;  3AZK C;  2BYK B;  3B6G B;  1P3L A;  4JJN B;  3X1U C;  3REI C;  4J8W C;  1P3I C;  5BO0 A;  5BO0 B;  3AYW D;  4G92 B;  1ULY A;  4H9P B;  3REH A;  1EQZ D;  3X1T C;  3AZI D;  1M18 C;  2F8N K;  5JA4 B;  3W96 D;  3KUY C;  3REL B;  5BT1 D;  1B67 A;  3KXB A;  2HIO C;  1KX5 A;  5B1M C;  3V9R A;  1P3K D;  5F99 A;  5F99 B;  5AV5 C;  5CP6 D;  5AV6 C;  5AY8 C;  4XZQ C;  5AV9 D;  2HUE C;  3AZN B;  4WNN A;  4YS3 C;  3W98 D;  1TZY A;  4J8U D;  3NQJ A;  3NQJ B;  3C1C D;  3AZF B;  1P3O C;  5GSU C;  4J8X C;  1P34 C;  4ZUX C;  3O62 D;  3WKJ A;  4Z5T B;  5GXQ A;  1P3P A;  1F1E A;  4J8V C;  1P3A B;  5B0Z C;  2F8N B;  5B31 B;  3REK D;  1P3M B;  4LD9 C;  3A6N A;  3AZM D;  3X1S C;  5BS7 A;  1A7W A;  1H3O B;  4R8P B;  3C1B D;  1ZLA A;  1ZLA B;  3W97 A;  3LEL A;  5AVB C;  3AV1 D;  3MGR C;  2YFW A;  3MGQ B;  1P3G A;  5CPI A;  2NZD A;  5CPI B;  2NZD B;  4WU9 B;  5B0Y B;  4Z66 B;  4WU8 C;  1KX3 D;  4KGC D;  3W99 A;  3W99 B;  5DNN D;  3WTP A;  3AZG D;  5AV8 A;  3REH D;  4H9Q A;  4H9Q B;  3AV2 C;  5B32 G;  3AFA B;  3WAA A;  3AZN C;  3MGP B;  4E44 A;  5B2I D;  5B40 B;  5AVC C;  3KXB D;  3WAA B;  5C3I C;  1BH9 A;  5DNN C;  4H9R A;  3AN2 C;  1KX5 D;  1HQ3 C;  3AZF C;  1AOI A;  2FJ7 D;  3AZJ B;  3LZ1 A;  1Q9C A;  2CV5 C;  4CSR A;  4CAY B;  5B2J A;  5B2J B;  4KUD A;  5GT3 A;  4XUJ D;  1S32 B;  1P3A C;  2RVQ D;  3AZK A;  5B31 C;  2PYO D;  1P3M C;  3X1U A;  3REI A;  1TZY D;  3WTP E;  1P3I A;  4J8W B;  2L5A A;  4R8P C;  4UUZ A;  3KWQ C;  3UT9 A;  3X1T A;  3X1T B;  5GXQ D;  3MVD A;  1P3P D;  1M18 B;  4H9N A;  3KUY A;  1B6W A;  2HIO A;  3A6N D;  5B1M A;  3AZI B;  4Z66 C;  5AV5 B;  4KHA A;  5B1L D;  5AY8 A;  5GT0 A;  5AV6 B;  3LEL D;  5B32 D;  4XZQ A;  3AZH A;  3NQU A;  5CPK C;  3NQU B;  3WA9 A;  5CPJ C;  4YS3 A;  4YS3 B;  3UTB A;  3B6F C;  5CP6 B;  1P3O A;  1P3B D;  1P3O B;  5GSU A;  4NFT A;  4J8X B;  1P34 B;  3AFA C;  5AV9 B;  5BNX A;  4ZUX A;  4AWL B;  3LJA D;  5B40 C;  4DRB A;  3UTA C;  3KSY A; 
#chains in the Genus database with same CATH topology
 4J8U B;  4J8V A;  4J8V B;  5B0Z A;  5B0Z B;  5E5A C;  4X23 C;  3WTP D;  3MNN D;  1P3B C;  3AZJ C;  4LD9 B;  4LD9 A;  4WJ3 C;  5AV8 D;  3X1S A;  1KX4 D;  3AZE C;  2ZY2 A;  4H9S A;  1F66 C;  1M1A D;  5AVB B;  2BYK A;  3MGR B;  2ARO D;  3A1I A;  3B6G A;  4JJN A;  3REK B;  3AZM B;  1U35 C;  4EO5 B;  1R4V A;  1P3F D;  3C1B B;  4H9P A;  3LZ1 D;  2Y2J A;  3AV1 B;  5B33 C;  5JA4 A;  4KUD D;  4WU8 B;  3X1V A;  4QLC D;  3REL A;  3LZ0 D;  5DNM D;  5JRG D;  3AYW C;  2JE5 A;  2Y2M A;  1EQZ C;  3AZI C;  2ZY3 A;  3W96 C;  5BT1 C;  3AV2 A;  3MVD D;  3MGS D;  5B24 D;  3AV2 B;  3REJ D;  5FUG B;  1KX3 B;  3AZN A;  4KGC B;  1P3K C;  5AVC B;  1ID3 D;  3AN2 A;  5C3I B;  5DNN B;  3AZG B;  3AN2 B;  5CP6 C;  1HQ3 A;  3AZF A;  1HQ3 B;  5AV9 C;  4AWL C;  4Z5T A;  5GT0 D;  3TU4 D;  2CV5 A;  2CV5 B;  3W98 C;  4J8U C;  3AZH D;  1P3A A;  2F8N A;  5B31 A;  3C1C C;  1P3M A;  3WA9 D;  2FJ7 B;  2DF4 C;  2Y2Q A;  3UTB D;  2F8N H;  3O62 C;  1H3O A;  4R8P A;  3AZL D;  3KWQ B;  4YM6 D;  4XUJ B;  1M19 D;  2ZY5 A;  3MGQ A;  3REK C;  2PYO B;  3AZM C;  4EO5 C;  2NQB D;  3C1B C;  2BG1 A;  4WU9 A;  3AV1 C;  5B0Y A;  4Z66 A;  2W8S A;  1TAF A;  1TAF B;  2F8N G;  4JJN D;  5B31 G;  1P3L D;  2YFV B;  5CPK B;  5CPJ B;  5CHL B;  1BH8 B;  5BNV B;  5B1L B;  3B6F B;  4M6B A;  3AFA A;  3VH6 W;  1N1J A;  1KX3 C;  1N1J B;  3MGP A;  2JSS A;  3REL D;  5B40 A;  4KGC C;  3UTA A;  2J8P A;  3UTA B;  3AZG C;  5F99 D;  3REH C;  4X23 A;  4X23 B;  5E5A B;  1P3B B;  3AZJ A;  3AZE A;  3AZE B;  3VH6 T;  3LJA B;  5B2I C;  3VH6 A;  3KXB C;  4CAY A;  1F66 A;  1F66 B;  1S32 A;  1KX5 C;  3P5J B;  2FJ7 C;  4NE5 A;  1U35 B;  4J8W A;  3EPH A;  4Z5T D;  3WKJ D;  4XUJ C;  5B33 A;  2RVQ C;  5B33 B;  2BYM B;  2PYO C;  1M18 A;  1TZY C;  3AYW A;  3EG5 B;  3AYW B;  1EQZ B;  2LY8 A;  1ZLA D;  5GXQ C;  3AZI A;  3A1K A;  3W97 D;  1P3P C;  5AV5 A;  5AV6 A;  3W96 A;  3W96 B;  4QLC B;  4NE3 A;  3LZ0 B;  3MGQ D;  5DNM B;  3A6N C;  5JRG B;  2FFF B;  1P3K A;  1P3K B;  1P3G D;  5CPI D;  2NZD D;  5CP6 A;  4WU9 D;  5B1L C;  3LEL C;  5B32 C;  4J8X A;  1P34 A;  5B0Y D;  5AV9 A;  3MGS B;  5B24 B;  5KDM B;  1ID3 B;  3W98 A;  3W99 D;  3W98 B;  4J8U A;  3C1C A;  3C1C B;  1KU5 A;  3O62 B;  3LJA C;  3TU4 B;  5AVB A;  3MGP D;  3WAA D;  4G91 B;  3MGR A;  3MNN C;  3REK A;  3WTP C;  3AZM A;  5AV8 C;  1KX4 C;  1AOI D;  3C1B A;  1M1A C;  3AV1 A;  3AZL B;  4YM6 B;  2ARO C;  5B2J D;  4WU8 A;  1S32 D;  5GT3 D;  3AZK D;  3B0D C;  2NQB B;  3X1U D;  3REI D;  1P3F C;  4J8W D;  3LZ1 C;  1P3I D;  2G5I C;  2Y2G A;  2Y2N A;  4KUD C;  3UT9 D;  4QLC C;  3X1T D;  3LZ0 C;  5DNM C;  1M18 D;  5FUG A;  5JRG C;  3KUY D;  1P3L B;  1KX3 A;  4KGC A;  5AVC A;  2HIO D;  2JCH A;  5DNN A;  3AZG A;  5B1M D;  3REH B;  3UT9 C;  3MVD C;  3MGS C;  5AV5 D;  5B24 C;  5AV6 D;  5AY8 D;  4WV4 B;  3REJ C;  3EPJ A;  2CWE A;  4XZQ D;  5B2I A;  5B2I B;  3KXB B;  1ID3 C;  2ZY4 A;  1KX5 B;  3V9R B;  1JFI A;  4ZBJ C;  2FJ7 A;  4YS3 D;  5GT0 C;  1P3O D;  5GSU D;  4J8X D;  3TU4 C;  1P34 D;  4ZUX D;  4WZS B;  4G91 C;  3KWQ A;  4HGA C;  4XUJ A;  3AZH C;  2PYO A;  4Z2M H;  3X1V D;  4WNN B;  3WA9 C;  1WWI A;  1TZY B;  4J8V D;  3UTB C;  5B0Z D;  4LD9 D;  3X1S D;  3B0B A;  1WWS A;  3AZL C;  3WKJ B;  4YM6 C;  1M19 C;  5GXQ B;  1P3P B;  3X1V C;  5AVB D;  3MGR D;  3B6G D;  2NQB C;  3A6N B;  2YFV A;  3VH5 W;  5CPK A;  5CPJ A;  4H9S C;  2XD5 A;  3W97 B;  1BH8 A;  5BNV A;  5B1L A;  3LEL B;  4DQY B;  3B6F A;  4Z2M G;  2RIQ A;  5B32 A;  5B32 B;  3B6G C;  2IO5 B;  2YFW B;  4JJN C;  4WU8 D;  1P3L C;  3VH5 T;  4G92 C;  3VH5 A;  1P3G B;  2Y2P A;  5E5A A;  1P3B A;  4E45 A;  3LJA A;  3REL C;  3AV2 D;  3AZN D;  3AL0 C;  5AVC D;  5F99 C;  3MNN A;  3MNN B;  3AN2 D;  3WTP B;  3B0C W;  1U35 A;  3H0R C;  5AV8 B;  1HQ3 D;  2Y2L A;  3AZF D;  1KX4 A;  1KX4 B;  1T3U A;  1M1A A;  1M1A B;  1BFM A;  2CV5 D;  2BYM A;  2ARO A;  2ARO B;  1BH9 B;  4H9R B;  1P3A D;  2F8N D;  5B31 D;  3B0C T;  5G49 A;  3B0D B;  5G49 B;  1P3M D;  1AOI B;  2Y2H A;  4UPK A;  1P3F A;  3R45 A;  1P3F B;  3R45 B;  4Z5T C;  3WKJ C;  3LZ1 B;  1EQZ A;  4R8P D;  4CSR B;  3KWQ D;  4KUD B;  4QLC A;  5GT3 B;  3LZ0 A;  3AZK B;  3H0L C;  5DNM A;  5JRG A;  3X1U B;  3REI B;  5BS7 C;  1P3I B;  1ZLA C;  4NE6 A;  3W97 C;  4DRA A;  4UUZ B;  3UT9 B;  2IO5 C;  4Z66 D;  3MGS A;  5B24 A;  3MVD B;  3MGQ C;  3REJ A;  4H9N B;  3KUY B;  3REJ B;  5KDM A;  2HIO B;  1P3G C;  5CPI C;  1ID3 A;  2NZD C;  5B1M B;  4WU9 C;  5CPK D;  5CPJ D;  4ZBJ B;  4H9O A;  5B0Y C;  4H9O B;  3O62 A;  3B6F D;  4KHA B;  5AY8 B;  5GT0 B;  3TU4 A;  4XZQ B;  3AFA D;  3IP4 C;  3W99 C;  2HUE B;  5B40 D;  4HGA B;  3AZH B;  1W2E A;  3UTA D;  3WA9 B;  1HTA A;  3UTB B;  4X23 D;  5E5A D;  5GSU B;  3AZJ D;  3AZE D;  5BNX B;  4ZUX B;  3WAA C;  3MGP C;  3AZL A;  4YM6 A;  1M19 A;  1M19 B;  2G5H C;  1F66 D;  3X1V B;  1JFI B;  1AOI C;  3H0M C;  2NQB A;  1U35 D;  3X1S B;  5B2J C;  1S32 C;  5GT3 C;  5B33 D;  3AZK C;  2BYK B;  3B6G B;  1P3L A;  4JJN B;  3X1U C;  3REI C;  4J8W C;  1P3I C;  5BO0 A;  5BO0 B;  2ZM5 A;  3AYW D;  4G92 B;  1ULY A;  4H9P B;  3REH A;  1Z2C B;  1EQZ D;  3X1T C;  3AZI D;  1M18 C;  2F8N K;  5JA4 B;  3W96 D;  3KUY C;  3REL B;  5BT1 D;  1B67 A;  3KXB A;  2HIO C;  1KX5 A;  2F2A C;  5B1M C;  3V9R A;  1P3K D;  5F99 A;  5F99 B;  5AV5 C;  3EPK A;  5CP6 D;  5AV6 C;  5AY8 C;  1PZR A;  4XZQ C;  5AV9 D;  2HUE C;  3AZN B;  4WNN A;  4YS3 C;  3W98 D;  1TZY A;  4J8U D;  3NQJ A;  3KFU G;  3NQJ B;  3C1C D;  3AZF B;  2DQN C;  1P3O C;  5GSU C;  4J8X C;  1P34 C;  4ZUX C;  3F6T A;  3O62 D;  3WKJ A;  4Z5T B;  3EPL A;  5GXQ A;  1P3P A;  1F1E A;  4J8V C;  1P3A B;  5B0Z C;  2F8N B;  3FDD A;  5B31 B;  3REK D;  1P3M B;  4LD9 C;  3A6N A;  3AZM D;  3X1S C;  5BS7 A;  1A7W A;  1H3O B;  4R8P B;  3C1B D;  1ZLA A;  1ZLA B;  3W97 A;  3LEL A;  5AVB C;  3AV1 D;  3MGR C;  2YFW A;  3MGQ B;  2Y2O A;  1P3G A;  5CPI A;  2NZD A;  5CPI B;  2NZD B;  4WU9 B;  5B0Y B;  4Z66 B;  4WU8 C;  1KX3 D;  4KGC D;  3W99 A;  3W99 B;  5DNN D;  3WTP A;  3AZG D;  5AV8 A;  3REH D;  4H9Q A;  4H9Q B;  2Y2K A;  3AV2 C;  5B32 G;  3AFA B;  3WAA A;  3AZN C;  3MGP B;  4E44 A;  5B2I D;  5B40 B;  5AVC C;  3KXB D;  3WAA B;  5C3I C;  1BH9 A;  5DNN C;  4H9R A;  3AN2 C;  2XD1 A;  1KX5 D;  1HQ3 C;  3AZF C;  1AOI A;  2FJ7 D;  3AZJ B;  3LZ1 A;  1Q9C A;  2CV5 C;  4CSR A;  4CAY B;  5B2J A;  5B2J B;  4KUD A;  5GT3 A;  4XUJ D;  1S32 B;  1P3A C;  2RVQ D;  3AZK A;  5B31 C;  2PYO D;  1P3M C;  3X1U A;  3REI A;  1TZY D;  3WTP E;  1P3I A;  4J8W B;  2L5A A;  4R8P C;  4UUZ A;  2VQR A;  3KWQ C;  3UT9 A;  3X1T A;  3X1T B;  5GXQ D;  3MVD A;  1P3P D;  1M18 B;  4H9N A;  3KUY A;  1B6W A;  2HIO A;  3A6N D;  5B1M A;  3AZI B;  4Z66 C;  4KHA A;  5AV5 B;  5B1L D;  5AY8 A;  5GT0 A;  5AV6 B;  3LEL D;  5B32 D;  4XZQ A;  3AZH A;  3NQU A;  5CPK C;  3NQU B;  3WA9 A;  5CPJ C;  4YS3 A;  4YS3 B;  3UTB A;  2Y2I A;  5CP6 B;  3B6F C;  1P3O A;  1P3B D;  1P3O B;  5GSU A;  4NFT A;  4J8X B;  1P34 B;  3AFA C;  5AV9 B;  5BNX A;  4ZUX A;  4AWL B;  3LJA D;  5B40 C;  4DRB A;  2UWX A;  3UTA C;  3KSY A; 
#chains in the Genus database with same CATH homology
 4J8U B;  4J8V A;  4J8V B;  5B0Z A;  5B0Z B;  5E5A C;  4X23 C;  3WTP D;  3MNN D;  1P3B C;  3AZJ C;  4LD9 B;  4LD9 A;  4WJ3 C;  5AV8 D;  3X1S A;  1KX4 D;  3AZE C;  2ZY2 A;  4H9S A;  1F66 C;  1M1A D;  5AVB B;  2BYK A;  3MGR B;  2ARO D;  3A1I A;  3B6G A;  4JJN A;  3REK B;  3AZM B;  1U35 C;  4EO5 B;  1R4V A;  1P3F D;  3C1B B;  4H9P A;  3LZ1 D;  2Y2J A;  3AV1 B;  5B33 C;  5JA4 A;  4KUD D;  4WU8 B;  3X1V A;  4QLC D;  3REL A;  3LZ0 D;  5DNM D;  5JRG D;  3AYW C;  2JE5 A;  2Y2M A;  1EQZ C;  3AZI C;  2ZY3 A;  3W96 C;  5BT1 C;  3AV2 A;  3MVD D;  3MGS D;  5B24 D;  3AV2 B;  3REJ D;  5FUG B;  1KX3 B;  3AZN A;  4KGC B;  1P3K C;  5AVC B;  1ID3 D;  3AN2 A;  5C3I B;  5DNN B;  3AZG B;  3AN2 B;  5CP6 C;  1HQ3 A;  3AZF A;  1HQ3 B;  5AV9 C;  4AWL C;  4Z5T A;  5GT0 D;  3TU4 D;  2CV5 A;  2CV5 B;  3W98 C;  4J8U C;  3AZH D;  1P3A A;  2F8N A;  5B31 A;  3C1C C;  1P3M A;  3WA9 D;  2FJ7 B;  2DF4 C;  2Y2Q A;  3UTB D;  2F8N H;  3O62 C;  1H3O A;  4R8P A;  3AZL D;  3KWQ B;  4YM6 D;  4XUJ B;  1M19 D;  2ZY5 A;  3MGQ A;  3REK C;  2PYO B;  3AZM C;  4EO5 C;  2NQB D;  3C1B C;  2BG1 A;  4WU9 A;  3AV1 C;  5B0Y A;  4Z66 A;  2W8S A;  1TAF A;  1TAF B;  2F8N G;  4JJN D;  5B31 G;  1P3L D;  2YFV B;  5CPK B;  5CPJ B;  5CHL B;  1BH8 B;  5BNV B;  5B1L B;  3B6F B;  4M6B A;  3AFA A;  3VH6 W;  1N1J A;  1KX3 C;  1N1J B;  3MGP A;  2JSS A;  3REL D;  5B40 A;  4KGC C;  3UTA A;  2J8P A;  3UTA B;  3AZG C;  5F99 D;  3REH C;  4X23 A;  4X23 B;  5E5A B;  1P3B B;  3AZJ A;  3AZE A;  3AZE B;  3VH6 T;  3LJA B;  5B2I C;  3VH6 A;  3KXB C;  4CAY A;  1F66 A;  1F66 B;  1S32 A;  1KX5 C;  3P5J B;  2FJ7 C;  4NE5 A;  1U35 B;  4J8W A;  3EPH A;  4Z5T D;  3WKJ D;  4XUJ C;  5B33 A;  2RVQ C;  5B33 B;  2BYM B;  2PYO C;  1M18 A;  1TZY C;  3AYW A;  3EG5 B;  3AYW B;  1EQZ B;  2LY8 A;  1ZLA D;  5GXQ C;  3AZI A;  3A1K A;  3W97 D;  1P3P C;  5AV5 A;  5AV6 A;  3W96 A;  3W96 B;  4QLC B;  4NE3 A;  3LZ0 B;  3MGQ D;  5DNM B;  3A6N C;  5JRG B;  2FFF B;  1P3K A;  1P3K B;  1P3G D;  5CPI D;  2NZD D;  5CP6 A;  4WU9 D;  5B1L C;  3LEL C;  5B32 C;  4J8X A;  1P34 A;  5B0Y D;  5AV9 A;  3MGS B;  5B24 B;  5KDM B;  1ID3 B;  3W98 A;  3W99 D;  3W98 B;  4J8U A;  3C1C A;  3C1C B;  1KU5 A;  3O62 B;  3LJA C;  3TU4 B;  5AVB A;  3MGP D;  3WAA D;  4G91 B;  3MGR A;  3MNN C;  3REK A;  3WTP C;  3AZM A;  5AV8 C;  1KX4 C;  1AOI D;  3C1B A;  1M1A C;  3AV1 A;  3AZL B;  4YM6 B;  2ARO C;  5B2J D;  4WU8 A;  1S32 D;  5GT3 D;  3AZK D;  3B0D C;  2NQB B;  3X1U D;  3REI D;  1P3F C;  4J8W D;  3LZ1 C;  1P3I D;  2G5I C;  2Y2G A;  2Y2N A;  4KUD C;  3UT9 D;  4QLC C;  3X1T D;  3LZ0 C;  5DNM C;  1M18 D;  5FUG A;  5JRG C;  3KUY D;  1P3L B;  1KX3 A;  4KGC A;  5AVC A;  2HIO D;  2JCH A;  5DNN A;  3AZG A;  5B1M D;  3REH B;  3UT9 C;  3MVD C;  3MGS C;  5AV5 D;  5B24 C;  5AV6 D;  5AY8 D;  4WV4 B;  3REJ C;  3EPJ A;  2CWE A;  4XZQ D;  5B2I A;  5B2I B;  3KXB B;  1ID3 C;  2ZY4 A;  1KX5 B;  3V9R B;  1JFI A;  4ZBJ C;  2FJ7 A;  4YS3 D;  5GT0 C;  1P3O D;  5GSU D;  4J8X D;  3TU4 C;  1P34 D;  4ZUX D;  4WZS B;  4G91 C;  3KWQ A;  4HGA C;  4XUJ A;  3AZH C;  2PYO A;  4Z2M H;  3X1V D;  4WNN B;  3WA9 C;  1WWI A;  1TZY B;  4J8V D;  3UTB C;  5B0Z D;  4LD9 D;  3X1S D;  3B0B A;  1WWS A;  3AZL C;  3WKJ B;  4YM6 C;  1M19 C;  5GXQ B;  1P3P B;  3X1V C;  5AVB D;  3MGR D;  3B6G D;  2NQB C;  3A6N B;  2YFV A;  3VH5 W;  5CPK A;  5CPJ A;  4H9S C;  2XD5 A;  3W97 B;  1BH8 A;  5BNV A;  5B1L A;  3LEL B;  4DQY B;  3B6F A;  4Z2M G;  2RIQ A;  5B32 A;  5B32 B;  3B6G C;  2IO5 B;  2YFW B;  4JJN C;  4WU8 D;  1P3L C;  3VH5 T;  4G92 C;  3VH5 A;  1P3G B;  2Y2P A;  5E5A A;  1P3B A;  4E45 A;  3LJA A;  3REL C;  3AV2 D;  3AZN D;  3AL0 C;  5AVC D;  5F99 C;  3MNN A;  3MNN B;  3AN2 D;  3WTP B;  3B0C W;  1U35 A;  3H0R C;  5AV8 B;  1HQ3 D;  2Y2L A;  3AZF D;  1KX4 A;  1KX4 B;  1T3U A;  1M1A A;  1M1A B;  1BFM A;  2CV5 D;  2BYM A;  2ARO A;  2ARO B;  1BH9 B;  4H9R B;  1P3A D;  2F8N D;  5B31 D;  3B0C T;  5G49 A;  3B0D B;  5G49 B;  1P3M D;  1AOI B;  2Y2H A;  4UPK A;  1P3F A;  3R45 A;  1P3F B;  3R45 B;  4Z5T C;  3WKJ C;  3LZ1 B;  1EQZ A;  4R8P D;  4CSR B;  3KWQ D;  4KUD B;  4QLC A;  5GT3 B;  3LZ0 A;  3AZK B;  3H0L C;  5DNM A;  5JRG A;  3X1U B;  3REI B;  5BS7 C;  1P3I B;  1ZLA C;  4NE6 A;  3W97 C;  4DRA A;  4UUZ B;  3UT9 B;  2IO5 C;  4Z66 D;  3MGS A;  5B24 A;  3MVD B;  3MGQ C;  3REJ A;  4H9N B;  3KUY B;  3REJ B;  5KDM A;  2HIO B;  1P3G C;  5CPI C;  1ID3 A;  2NZD C;  5B1M B;  4WU9 C;  5CPK D;  5CPJ D;  4ZBJ B;  4H9O A;  5B0Y C;  4H9O B;  3O62 A;  3B6F D;  4KHA B;  5AY8 B;  5GT0 B;  3TU4 A;  4XZQ B;  3AFA D;  3IP4 C;  3W99 C;  2HUE B;  5B40 D;  4HGA B;  3AZH B;  1W2E A;  3UTA D;  3WA9 B;  1HTA A;  3UTB B;  4X23 D;  5E5A D;  5GSU B;  3AZJ D;  3AZE D;  5BNX B;  4ZUX B;  3WAA C;  3MGP C;  3AZL A;  4YM6 A;  1M19 A;  1M19 B;  2G5H C;  1F66 D;  3X1V B;  1JFI B;  1AOI C;  3H0M C;  2NQB A;  1U35 D;  3X1S B;  5B2J C;  1S32 C;  5GT3 C;  5B33 D;  3AZK C;  2BYK B;  3B6G B;  1P3L A;  4JJN B;  3X1U C;  3REI C;  4J8W C;  1P3I C;  5BO0 A;  5BO0 B;  2ZM5 A;  3AYW D;  4G92 B;  1ULY A;  4H9P B;  3REH A;  1Z2C B;  1EQZ D;  3X1T C;  3AZI D;  1M18 C;  2F8N K;  5JA4 B;  3W96 D;  3KUY C;  3REL B;  5BT1 D;  1B67 A;  3KXB A;  2HIO C;  1KX5 A;  2F2A C;  5B1M C;  3V9R A;  1P3K D;  5F99 A;  5F99 B;  5AV5 C;  3EPK A;  5CP6 D;  5AV6 C;  5AY8 C;  1PZR A;  4XZQ C;  5AV9 D;  2HUE C;  3AZN B;  4WNN A;  4YS3 C;  3W98 D;  1TZY A;  4J8U D;  3NQJ A;  3KFU G;  3NQJ B;  3C1C D;  3AZF B;  2DQN C;  1P3O C;  5GSU C;  4J8X C;  1P34 C;  4ZUX C;  3F6T A;  3O62 D;  3WKJ A;  4Z5T B;  3EPL A;  5GXQ A;  1P3P A;  1F1E A;  4J8V C;  1P3A B;  5B0Z C;  2F8N B;  3FDD A;  5B31 B;  3REK D;  1P3M B;  4LD9 C;  3A6N A;  3AZM D;  3X1S C;  5BS7 A;  1A7W A;  1H3O B;  4R8P B;  3C1B D;  1ZLA A;  1ZLA B;  3W97 A;  3LEL A;  5AVB C;  3AV1 D;  3MGR C;  2YFW A;  3MGQ B;  2Y2O A;  1P3G A;  5CPI A;  2NZD A;  5CPI B;  2NZD B;  4WU9 B;  5B0Y B;  4Z66 B;  4WU8 C;  1KX3 D;  4KGC D;  3W99 A;  3W99 B;  5DNN D;  3WTP A;  3AZG D;  5AV8 A;  3REH D;  4H9Q A;  4H9Q B;  2Y2K A;  3AV2 C;  5B32 G;  3AFA B;  3WAA A;  3AZN C;  3MGP B;  4E44 A;  5B2I D;  5B40 B;  5AVC C;  3KXB D;  3WAA B;  5C3I C;  1BH9 A;  5DNN C;  4H9R A;  3AN2 C;  2XD1 A;  1KX5 D;  1HQ3 C;  3AZF C;  1AOI A;  2FJ7 D;  3AZJ B;  3LZ1 A;  1Q9C A;  2CV5 C;  4CSR A;  4CAY B;  5B2J A;  5B2J B;  4KUD A;  5GT3 A;  4XUJ D;  1S32 B;  1P3A C;  2RVQ D;  3AZK A;  5B31 C;  2PYO D;  1P3M C;  3X1U A;  3REI A;  1TZY D;  3WTP E;  1P3I A;  4J8W B;  2L5A A;  4R8P C;  4UUZ A;  2VQR A;  3KWQ C;  3UT9 A;  3X1T A;  3X1T B;  5GXQ D;  3MVD A;  1P3P D;  1M18 B;  4H9N A;  3KUY A;  1B6W A;  2HIO A;  3A6N D;  5B1M A;  3AZI B;  4Z66 C;  4KHA A;  5AV5 B;  5B1L D;  5AY8 A;  5GT0 A;  5AV6 B;  3LEL D;  5B32 D;  4XZQ A;  3AZH A;  3NQU A;  5CPK C;  3NQU B;  3WA9 A;  5CPJ C;  4YS3 A;  4YS3 B;  3UTB A;  2Y2I A;  5CP6 B;  3B6F C;  1P3O A;  1P3B D;  1P3O B;  5GSU A;  4NFT A;  4J8X B;  1P34 B;  3AFA C;  5AV9 B;  5BNX A;  4ZUX A;  4AWL B;  3LJA D;  5B40 C;  4DRB A;  2UWX A;  3UTA C;  3KSY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...