1EQZC

X-ray structure of the nucleosome core particle at 2.5 a resolution
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
107
structure length
106
Chain Sequence
APATGGVKKPHRYRPGTVALREIRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords 146 NUCLEOTIDES LONG DNA
publication title Asymmetries in the nucleosome core particle at 2.5 A resolution.
pubmed doi rcsb
total genus 31
structure length 106
sequence length 107
chains with identical sequence G
ec nomenclature
pdb deposition date 2000-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1eqzC00
1P3GA 1P3OB 4J8WB 4R8PD 5AVCC 5B0ZC 3AZMD 5BO0A 5B32B 2CV5D 3AZLC 4J8UB 3W96C 3AZGC 5DNMA 5GSUA 5BS7C 3B0DC 4J8UA 4E45A 1M18C 4LD9A 3LELD 4WU9B 1BH9B 4JJNC 4Z66A 5BNVB 2NZDC 3REHD 3B0CW 1AOIC 4HGAC 5GT0C 1M1AD 1A7WA 4NFTA 1P3MA 5B1LD 3X1TA 5BNVA 1S32D 4H9PA 5KDMB 1U35B 4X23A 3AN2B 1P3LA 5KDMA 2L5AA 3MVDD 5B0YD 1P34D 5B33A 3AZMB 3MNNC 3AZJC 4YS3C 3MGPD 1KX3C 5B40D 2CV5B 4H9NA 3W96A 3AZGA 1M19C 4Z5TC 5DNND 4R8PA 5BS7A 4YM6C 2YFVA 2IO5B 3UTBC 3AZNC 1M18A 3B6FD 3AZIC 3AFAC 3UTAC 3A6ND 2AROD 3REIC 5B2JC 4KHAB 5AVBB 3REHB 5GT3D 5CP6D 3C1CC 3B0CT 4EO5C 3LELA 1BFMA 5B1LB 5AV6D 5AV8D 3REHA 3W97C 5JRGC 1M1AA 5B31B 4H9SC 3TU4C 3AZKD 1S32A 1P3KC 4XZQD 3AZJA 5CPKB 1KX3A 2FJ7C 3B6GC 3KWQC 3MGPB 1P3IB 1M19A 1KX5C 4Z5TA 3MVDA 5B0YA 1N1JA 5DNNB 3LZ1C 1P34A 3O62C 4G92B 2BYMB 1H3OB 1HQ3C 5GXQC 3AZIA 3B6FB 3AFAA 5B40A 4H9OB 5DNNA 4XUJB 5G49A 2AROB 5B2JA 3A6NB 4AWLB 3AV2D 1P3PD 3B6FA 4J8XC 4QLCD 4CAYB 5JRGA 2HIOD 5AV8B 5AV6B 3WAAC 4H9SA 5GT3A 3AZHC 5CP6A 5B1MD 3X1SD 3AZKB 3REJC 3UT9C 1P3KA 5E5AB 1P3GD 4XZQB 3KWQA 3W98D 3KUYB 3MGQC 5CPJC 3AZFC 3LZ1A 3VH5A 5F99B 5DNMD 3MGSB 5GSUD 1EQZC 5AV5B 4NE3A 3MGRC 3AYWB 4Z66D 3AV2B 1P3PB 3AV1C 3KXBD 4QLCB 1P3MD 3W99D 3LJAD 1P3PA 3AZHA 2HIOB 1BH8B 3NQUB 3REJA 5B1MB 4G91B 3REKD 1P3LD 2PYOC 5B2IB 3C1BC 2LY8A 3AZEC 5AVCD 1P3GB 5B0ZD 1P3FC 3WTPE 5AY8C 5B1MA 3X1SA 1KU5A 5BO0B 1F66C 3AZLD 2F8NG 3AZFA 4J8WC 3AZGD 3W96D 3W98A 5DNMB 5GSUB 3MGRA 1M18D 4LD9B 4JJND 4E44A 2NZDD 4Z66B 1AOID 5GT0D 4H9QA 2BYKA 5B24C 1P3MB 3X1TB 4H9PB 2PYOA 4X23B 4DRAA 3KXBA 3C1BA 1P3LB 3W99A 1ULYA 3LJAA 5AVCB 5CPIC 1JFIA 3MNND 3AZJD 4YS3D 5B33B 1KX3D 3REKA 1F66A 4KGCC 1KX4C 1M19D 4Z5TD 4H9NB 3AZGB 1P3BC 3W96B 5AVCA 5B0ZA 4YM6D 4R8PB 3LZ0C 3UTBD 3AZND 3B0DB 4J8VC 2YFVB 3AZLA 3AZID 1M18B 3AFAD 3UTAD 3REID 5AV9C 5B2JD 4CSRA 3R45A 3C1CD 4HGAB 4WZSB 5GT0B 5B24A 4ZUXC 4JJNA 3LELB 2NZDA 1WWSA 4WNNB 5AVBC 3W97D 5CHLB 5JRGD 1AOIA 5GT0A 3TU4D 1ZLAC 4Z2MH 1M1AB 1P3KD 4WNNA 1S32B 5CPIA 5B31C 2FJ7D 3B6GD 4KGCA 3KWQD 2HUEB 3AZJB 1KX3B 1KX4A 1KX5D 1M19B 3X1VC 4Z5TB 4NE6A 3LZ1D 3LZ0A 3MVDB 5CPKC 5B0YB 3O62D 1N1JB 4ZBJB 3MNNA 4J8VA 3UTBB 4YS3A 1P34B 1HQ3D 5GXQD 1P3IC 3AZIB 1F1EA 3AFAB 5B40B 4UUZB 5AV9A 4YM6A 5G49B 3UTBA 5B2JB 3AZNA 4ZUXA 4EO5B 3WTPC 4J8XD 2RVQC 4UUZA 4XUJC 3RELC 3UTAA 3REIA 1HTAA 3WAAD 3AZHD 5JRGB 3C1CA 1ZLAA 4WV4B 3TU4B 5GT3B 5CP6B 3REJD 3UT9D 1P3KB 3W97A 4KUDC 2F8NH 3TU4A 5BNXA 3WA9C 2FJ7B 1P3AC 2JSSA 3MGQD 3KWQB 5CPJD 5E5AC 1KX5B 3AZFD 4Z2MG 3LZ1B 3KUYC 2FJ7A 3B6GA 1EQZD 1HQ3B 5GXQB 3MGRD 4WU8C 1KX5A 1ID3C 2NQBC 5F99C 3MGSC 3O62A 5AV5C 1HQ3A 5GXQA 3AV1D 3RELA 1Q9CA 3WKJC 3AYWC 2F8ND 3WAAB 3AZHB 4J8XA 2PYOD 3REJB 3UT9B 3C1BD 4KUDA 3AZED 3WAAA 3X1UC 1P3FD 5AY8D 5B2IC 3X1SB 3UT9A 1F66D 4J8WD 3AZFB 4H9RA 1TAFA 1TZYC 3MGQA 4WU8A 1EQZB 3W98B 3NQJA 5FUGA 5CPJA 1ID3A 3MGRB 2NQBA 1P3OC 2YFWB 3VH6W 5B32C 1EQZA 4J8UC 3WKJA 5B24D 4H9QB 4LD9C 2BYKB 5C3IB 2YFWA 2F8NB 5BT1C 3AV1A 4WU9C 2PYOB 3KXBB 3X1TC 3C1BB 5B32G 2F8NA 4NE5A 3W99B 3X1UA 3LJAB 5CPID 4X23C 4KGCD 1JFIB 1KX4D 1F66B 3REKB 1P3BD 3AZEA 1U35C 1P3FA 4M6BA 1TZYA 2CWEA 5AY8A 5B0ZB 3LZ0D 5B33C 3AN2C 4J8VD 1P3OA 4J8WA 3AZLB 5AV9D 4R8PC 5B32A 3AZMC 3VH6T 4CSRB 4ZUXD 3R45B 2CV5C 5B24B 4JJNB 5AVBD 2NZDB 2IO5C 1AOIB 1ZLAD 4WU9A 1BH9A 3LELC 3KSYA 3REHC 5B31D 5CPIB 1M1AC 4DRBA 4KGCB 1KX4B 5B1LC 3X1VD 1U35A 1S32C 1P3BB 5CPKD 3AN2A 2HUEC 3LZ0B 1P3ID 3MNNB 4J8VB 4YS3B 1P3BA 3MVDC 5B0YC 5AV9B 3AZMA 4ZBJC 1P34C 4YM6B 3MGPC 2CV5A 3AZNB 3WTPD 4ZUXB 5B40C 2RVQD 3RELD 4XUJD 5B31G 5DNNC 3UTAB 3REIB 4G92C 3B6FC 1ZLAB 3C1CB 3A6NC 2AROC 4AWLC 4KHAA 5AVBA 4KUDD 3W97B 5GT3C 3WA9D 5CP6C 1P3AD 1B67A 5BNXB 1WWIA 5B1LA 5E5AD 3X1VB 5AV6C 5AV8C 5B31A 3KUYD 3AZKC 3B6GB 4WU8D 1ID3D 3X1VA 2NQBD 5F99D 3MGSD 5CPKA 3B0BA 4XZQC 5AV5D 3MGPA 1P3IA 3O62B 1R4VA 2F8NK 5JA4B 3WTPB 3WKJD 3RELB 3AYWD 2BYMA 1H3OA 5JA4A 4H9OA 3WTPA 3VH5W 4XUJA 3A6NA 2AROA 4J8XB 3AV2C 1P3PC 4KUDB 3X1UD 3WA9B 4CAYA 1P3AB 5B2ID 4QLCC 5AV6A 5AV8A 2HIOC 3WA9A 3AZKA 1TZYD 1P3AA 4H9RB 1TAFB 4G91C 5B1MC 3X1SC 5E5AA 3V9RB 3MGQB 4WU8B 3NQJB 5FUGB 5CPJB 1ID3B 1P3OD 2NQBB 1P3GC 4XZQA 3KUYA 5B32D 3W98C 3V9RA 4J8UD 4LD9D 3WKJB 5F99A 3MGSA 5BT1D 5DNMC 5AV5A 5GSUC 5C3IC 4WU9D 3AV1B 3AYWA 3X1TD 3VH5T 3AV2A 4Z66C 3X1UB 4X23D 4QLCA 3KXBC 1P3MC 3W99C 2HIOA 3LJAC 1U35D 1BH8A 3NQUA 3AZEB 5B33D 1P3FB 3AN2D 1TZYB 3VH6A 5AY8B 5B2IA 3REKC 1P3LC 1B6WA
chains in the Genus database with same CATH superfamily
1P3GA 1P3OB 4J8WB 4R8PD 5AVCC 5B0ZC 3AZMD 5BO0A 2ZY5A 5B32B 2Y2JA 3AZLC 2CV5D 4J8UB 3W96C 3AZGC 5DNMA 5GSUA 3EPHA 2Y2OA 2Y2MA 5BS7C 3B0DC 4J8UA 4E45A 1M18C 4LD9A 3LELD 4WU9B 1BH9B 4JJNC 4Z66A 5BNVB 2NZDC 3REHD 2F2AC 3B0CW 1AOIC 4HGAC 5GT0C 1M1AD 1A7WA 4NFTA 1P3MA 5B1LD 3X1TA 5BNVA 1S32D 4H9PA 5KDMB 1U35B 2ZY3A 4X23A 3AN2B 1P3LA 3EG5B 5KDMA 2L5AA 3MVDD 5B0YD 1P34D 5B33A 3AZMB 3MNNC 3AZJC 2Y2HA 4YS3C 3MGPD 1KX3C 5B40D 3EPJA 4H9NA 2CV5B 3W96A 3AZGA 1M19C 4Z5TC 5DNND 4R8PA 5BS7A 4YM6C 2YFVA 2IO5B 3UTBC 1W2EA 3AZNC 1M18A 3B6FD 3AZIC 3AFAC 3UTAC 3A6ND 2AROD 3REIC 3F6TA 5B2JC 4KHAB 5AVBB 3REHB 5GT3D 5CP6D 3C1CC 3B0CT 4EO5C 3LELA 1BFMA 5B1LB 5AV6D 5AV8D 3REHA 3W97C 5JRGC 2G5HC 5B31B 4H9SC 3TU4C 1M1AA 3AZKD 1S32A 1P3KC 4XZQD 3AZJA 5CPKB 1KX3A 2FJ7C 3B6GC 3KWQC 3MGPB 1P3IB 1M19A 1KX5C 4Z5TA 3MVDA 5B0YA 1N1JA 5DNNB 3LZ1C 1P34A 3O62C 4G92B 2BYMB 1H3OB 1HQ3C 5GXQC 3AZIA 3B6FB 3AFAA 5B40A 4H9OB 5DNNA 4XUJB 5G49A 2AROB 5B2JA 3A6NB 4AWLB 3AV2D 1P3PD 3B6FA 4J8XC 4QLCD 4CAYB 2HIOD 5AV6B 5AV8B 5JRGA 3WAAC 4H9SA 5GT3A 3AZHC 5CP6A 5B1MD 3X1SD 3AZKB 3REJC 3UT9C 1P3KA 5E5AB 2FFFB 1P3GD 4XZQB 3KWQA 3W98D 3KUYB 3MGQC 5CPJC 3AZFC 3LZ1A 3VH5A 5F99B 5DNMD 3MGSB 5GSUD 1EQZC 5AV5B 2DF4C 4NE3A 3MGRC 3AYWB 4Z66D 2Y2LA 3AV2B 3FDDA 1P3PB 3AV1C 3KXBD 2Y2KA 4QLCB 1P3MD 3W99D 3LJAD 1P3PA 3AZHA 2HIOB 1BH8B 3NQUB 3REJA 5B1MB 4G91B 3H0LC 3REKD 1P3LD 2PYOC 5B2IB 3C1BC 2LY8A 3AZEC 5AVCD 1P3GB 5B0ZD 1P3FC 3WTPE 5AY8C 5B1MA 3X1SA 1KU5A 5BO0B 1F66C 3AZLD 3EPKA 2F8NG 3AZFA 4J8WC 3AZGD 3W96D 3W98A 5DNMB 5GSUB 3MGRA 1T3UA 1M18D 4LD9B 4JJND 4E44A 2NZDD 4Z66B 1AOID 5GT0D 4H9QA 2BYKA 5B24C 1P3MB 2VQRA 3X1TB 4H9PB 2PYOA 4X23B 4DRAA 3KXBA 3C1BA 1P3LB 3W99A 1ULYA 3LJAA 5AVCB 5CPIC 1JFIA 3MNND 3AZJD 4YS3D 5B33B 1KX3D 3REKA 1F66A 4KGCC 1KX4C 1M19D 4Z5TD 4H9NB 3AZGB 1P3BC 3W96B 2RIQA 5AVCA 5B0ZA 4YM6D 4R8PB 3LZ0C 3UTBD 3AZND 3B0DB 4J8VC 2YFVB 3AZLA 3AZID 1M18B 3AFAD 3UTAD 3REID 5AV9C 5B2JD 4CSRA 3R45A 3C1CD 4HGAB 5GT0B 4WZSB 5B24A 4ZUXC 4JJNA 3LELB 2NZDA 1WWSA 4WNNB 5AVBC 3W97D 5CHLB 5JRGD 1AOIA 5GT0A 3TU4D 1ZLAC 4Z2MH 1M1AB 1P3KD 4WNNA 1S32B 5CPIA 2JE5A 5B31C 2FJ7D 3B6GD 4KGCA 3KWQD 2HUEB 3AZJB 1KX3B 1KX4A 1KX5D 1M19B 3X1VC 4Z5TB 4NE6A 3LZ1D 3LZ0A 3MVDB 5CPKC 5B0YB 3O62D 1N1JB 4ZBJB 3MNNA 4J8VA 3UTBB 4YS3A 1P34B 1HQ3D 5GXQD 1P3IC 3AZIB 1F1EA 3AFAB 5B40B 4UUZB 5AV9A 4YM6A 5G49B 3UTBA 5B2JB 3AZNA 4ZUXA 4UPKA 4EO5B 3WTPC 2W8SA 4J8XD 2RVQC 4UUZA 4XUJC 3RELC 3UTAA 3REIA 1HTAA 3WAAD 3AZHD 5JRGB 3C1CA 1ZLAA 4WV4B 3TU4B 5GT3B 5CP6B 4WJ3C 3REJD 3UT9D 1Z2CB 1P3KB 3W97A 3A1IA 4KUDC 2F8NH 3TU4A 5BNXA 3WA9C 2FJ7B 1P3AC 2JSSA 3MGQD 3KWQB 5CPJD 5E5AC 2JCHA 1KX5B 3AZFD 4Z2MG 3LZ1B 3KUYC 2FJ7A 3B6GA 1EQZD 1HQ3B 5GXQB 3MGRD 4WU8C 1KX5A 1ID3C 2NQBC 5F99C 3MGSC 2ZY2A 3O62A 5AV5C 1HQ3A 5GXQA 3AV1D 3RELA 1Q9CA 3WKJC 3AYWC 2F8ND 2ZM5A 3WAAB 3AZHB 3AL0C 4J8XA 2PYOD 3REJB 3UT9B 3C1BD 4KUDA 3AZED 3WAAA 3X1UC 1P3FD 5AY8D 5B2IC 3X1SB 3UT9A 1F66D 4J8WD 3AZFB 4H9RA 1TAFA 1TZYC 3MGQA 4WU8A 1EQZB 3W98B 3NQJA 5FUGA 2Y2IA 5CPJA 3MGRB 1ID3A 2NQBA 1P3OC 2YFWB 3KFUG 3VH6W 5B32C 1EQZA 4J8UC 3WKJA 5B24D 4H9QB 4LD9C 2BYKB 5C3IB 2YFWA 2F8NB 5BT1C 3AV1A 4WU9C 2PYOB 3KXBB 3X1TC 3C1BB 5B32G 2F8NA 4NE5A 3W99B 3X1UA 3LJAB 5CPID 4X23C 4KGCD 1JFIB 1KX4D 1F66B 3REKB 1P3BD 3AZEA 1U35C 1P3FA 4M6BA 1TZYA 2CWEA 5AY8A 5B0ZB 3LZ0D 5B33C 3AN2C 4J8VD 1P3OA 4J8WA 3AZLB 2UWXA 5AV9D 4R8PC 5B32A 3AZMC 3VH6T 4CSRB 4ZUXD 3R45B 2CV5C 5B24B 4JJNB 5AVBD 2NZDB 2IO5C 1AOIB 1ZLAD 4WU9A 1BH9A 3LELC 3KSYA 2Y2NA 3REHC 5B31D 5CPIB 1M1AC 4DRBA 4KGCB 1KX4B 5B1LC 3X1VD 1U35A 1S32C 1P3BB 5CPKD 3AN2A 2HUEC 3LZ0B 1P3ID 3MNNB 4J8VB 4YS3B 2XD5A 2Y2QA 1P3BA 3MVDC 5B0YC 5AV9B 3AZMA 4ZBJC 1P34C 2J8PA 2Y2GA 3A1KA 4YM6B 3MGPC 2CV5A 3AZNB 3WTPD 4ZUXB 5B40C 2RVQD 3RELD 4XUJD 3H0RC 5B31G 5DNNC 3UTAB 3REIB 4G92C 3B6FC 1ZLAB 3C1CB 3A6NC 2AROC 4AWLC 4KHAA 5AVBA 4KUDD 3W97B 5GT3C 3WA9D 5CP6C 1P3AD 1B67A 5BNXB 1WWIA 5B1LA 5E5AD 4DQYB 3X1VB 5AV6C 5AV8C 5B31A 3KUYD 3AZKC 3B6GB 4WU8D 2DQNC 1ID3D 3X1VA 2NQBD 5F99D 3MGSD 5CPKA 3B0BA 4XZQC 5AV5D 3MGPA 1P3IA 3O62B 1R4VA 2XD1A 2F8NK 5JA4B 3WTPB 3WKJD 3RELB 3AYWD 2BYMA 1H3OA 2G5IC 5JA4A 4H9OA 3WTPA 3VH5W 4XUJA 3A6NA 2AROA 4J8XB 3AV2C 1P3PC 4KUDB 3X1UD 3WA9B 4CAYA 1P3AB 5B2ID 2BG1A 4QLCC 5AV6A 5AV8A 2HIOC 3WA9A 3AZKA 1TZYD 1P3AA 4H9RB 1TAFB 4G91C 5B1MC 3X1SC 5E5AA 3V9RB 3MGQB 4WU8B 3NQJB 5FUGB 5CPJB 1ID3B 1P3OD 2NQBB 1P3GC 4XZQA 2Y2PA 3KUYA 3EPLA 5B32D 3W98C 3V9RA 4J8UD 4LD9D 3WKJB 5F99A 3MGSA 2ZY4A 1PZRA 5BT1D 5DNMC 5AV5A 5GSUC 3H0MC 5C3IC 4WU9D 3AV1B 3AYWA 3X1TD 3VH5T 3AV2A 4Z66C 3X1UB 4X23D 4QLCA 3KXBC 1P3MC 3W99C 2HIOA 3LJAC 1U35D 1BH8A 3NQUA 3AZEB 5B33D 1P3FB 3AN2D 1TZYB 3P5JB 3VH6A 5AY8B 5B2IA 3IP4C 3REKC 1P3LC 1B6WA
chains in the Genus database with same CATH topology
1P3GA 1P3OB 4J8WB 4R8PD 5AVCC 5B0ZC 3AZMD 5BO0A 2ZY5A 5B32B 2Y2JA 3AZLC 2CV5D 4J8UB 3W96C 3AZGC 5DNMA 5GSUA 3EPHA 2Y2OA 2Y2MA 5BS7C 3B0DC 4J8UA 4E45A 1M18C 4LD9A 3LELD 4WU9B 1BH9B 4JJNC 4Z66A 5BNVB 2NZDC 3REHD 2F2AC 3B0CW 1AOIC 4HGAC 5GT0C 1M1AD 1A7WA 4NFTA 1P3MA 5B1LD 3X1TA 5BNVA 1S32D 4H9PA 5KDMB 1U35B 2ZY3A 4X23A 3AN2B 1P3LA 3EG5B 5KDMA 2L5AA 3MVDD 5B0YD 1P34D 5B33A 3AZMB 3MNNC 3AZJC 2Y2HA 4YS3C 3MGPD 1KX3C 5B40D 3EPJA 4H9NA 2CV5B 3W96A 3AZGA 1M19C 4Z5TC 5DNND 4R8PA 5BS7A 4YM6C 2YFVA 2IO5B 3UTBC 1W2EA 3AZNC 1M18A 3B6FD 3AZIC 3AFAC 3UTAC 3A6ND 2AROD 3REIC 3F6TA 5B2JC 4KHAB 5AVBB 3REHB 5GT3D 5CP6D 3C1CC 3B0CT 4EO5C 3LELA 1BFMA 5B1LB 5AV6D 5AV8D 3REHA 3W97C 5JRGC 2G5HC 5B31B 4H9SC 3TU4C 1M1AA 3AZKD 1S32A 1P3KC 4XZQD 3AZJA 5CPKB 1KX3A 2FJ7C 3B6GC 3KWQC 3MGPB 1P3IB 1M19A 1KX5C 4Z5TA 3MVDA 5B0YA 1N1JA 5DNNB 3LZ1C 1P34A 3O62C 4G92B 2BYMB 1H3OB 1HQ3C 5GXQC 3AZIA 3B6FB 3AFAA 5B40A 4H9OB 5DNNA 4XUJB 5G49A 2AROB 5B2JA 3A6NB 4AWLB 3AV2D 1P3PD 3B6FA 4J8XC 4QLCD 4CAYB 2HIOD 5AV6B 5AV8B 5JRGA 3WAAC 4H9SA 5GT3A 3AZHC 5CP6A 5B1MD 3X1SD 3AZKB 3REJC 3UT9C 1P3KA 5E5AB 2FFFB 1P3GD 4XZQB 3KWQA 3W98D 3KUYB 3MGQC 5CPJC 3AZFC 3LZ1A 3VH5A 5F99B 5DNMD 3MGSB 5GSUD 1EQZC 5AV5B 2DF4C 4NE3A 3MGRC 3AYWB 4Z66D 2Y2LA 3AV2B 3FDDA 1P3PB 3AV1C 3KXBD 2Y2KA 4QLCB 1P3MD 3W99D 3LJAD 1P3PA 3AZHA 2HIOB 1BH8B 3NQUB 3REJA 5B1MB 4G91B 3H0LC 3REKD 1P3LD 2PYOC 5B2IB 3C1BC 2LY8A 3AZEC 5AVCD 1P3GB 5B0ZD 1P3FC 3WTPE 5AY8C 5B1MA 3X1SA 1KU5A 5BO0B 1F66C 3AZLD 3EPKA 2F8NG 3AZFA 4J8WC 3AZGD 3W96D 3W98A 5DNMB 5GSUB 3MGRA 1T3UA 1M18D 4LD9B 4JJND 4E44A 2NZDD 4Z66B 1AOID 5GT0D 4H9QA 2BYKA 5B24C 1P3MB 2VQRA 3X1TB 4H9PB 2PYOA 4X23B 4DRAA 3KXBA 3C1BA 1P3LB 3W99A 1ULYA 3LJAA 5AVCB 5CPIC 1JFIA 3MNND 3AZJD 4YS3D 5B33B 1KX3D 3REKA 1F66A 4KGCC 1KX4C 1M19D 4Z5TD 4H9NB 3AZGB 1P3BC 3W96B 2RIQA 5AVCA 5B0ZA 4YM6D 4R8PB 3LZ0C 3UTBD 3AZND 3B0DB 4J8VC 2YFVB 3AZLA 3AZID 1M18B 3AFAD 3UTAD 3REID 5AV9C 5B2JD 4CSRA 3R45A 3C1CD 4HGAB 5GT0B 4WZSB 5B24A 4ZUXC 4JJNA 3LELB 2NZDA 1WWSA 4WNNB 5AVBC 3W97D 5CHLB 5JRGD 1AOIA 5GT0A 3TU4D 1ZLAC 4Z2MH 1M1AB 1P3KD 4WNNA 1S32B 5CPIA 2JE5A 5B31C 2FJ7D 3B6GD 4KGCA 3KWQD 2HUEB 3AZJB 1KX3B 1KX4A 1KX5D 1M19B 3X1VC 4Z5TB 4NE6A 3LZ1D 3LZ0A 3MVDB 5CPKC 5B0YB 3O62D 1N1JB 4ZBJB 3MNNA 4J8VA 3UTBB 4YS3A 1P34B 1HQ3D 5GXQD 1P3IC 3AZIB 1F1EA 3AFAB 5B40B 4UUZB 5AV9A 4YM6A 5G49B 3UTBA 5B2JB 3AZNA 4ZUXA 4UPKA 4EO5B 3WTPC 2W8SA 4J8XD 2RVQC 4UUZA 4XUJC 3RELC 3UTAA 3REIA 1HTAA 3WAAD 3AZHD 5JRGB 3C1CA 1ZLAA 4WV4B 3TU4B 5GT3B 5CP6B 4WJ3C 3REJD 3UT9D 1Z2CB 1P3KB 3W97A 3A1IA 4KUDC 2F8NH 3TU4A 5BNXA 3WA9C 2FJ7B 1P3AC 2JSSA 3MGQD 3KWQB 5CPJD 5E5AC 2JCHA 1KX5B 3AZFD 4Z2MG 3LZ1B 3KUYC 2FJ7A 3B6GA 1EQZD 1HQ3B 5GXQB 3MGRD 4WU8C 1KX5A 1ID3C 2NQBC 5F99C 3MGSC 2ZY2A 3O62A 5AV5C 1HQ3A 5GXQA 3AV1D 3RELA 1Q9CA 3WKJC 3AYWC 2F8ND 2ZM5A 3WAAB 3AZHB 3AL0C 4J8XA 2PYOD 3REJB 3UT9B 3C1BD 4KUDA 3AZED 3WAAA 3X1UC 1P3FD 5AY8D 5B2IC 3X1SB 3UT9A 1F66D 4J8WD 3AZFB 4H9RA 1TAFA 1TZYC 3MGQA 4WU8A 1EQZB 3W98B 3NQJA 5FUGA 2Y2IA 5CPJA 3MGRB 1ID3A 2NQBA 1P3OC 2YFWB 3KFUG 3VH6W 5B32C 1EQZA 4J8UC 3WKJA 5B24D 4H9QB 4LD9C 2BYKB 5C3IB 2YFWA 2F8NB 5BT1C 3AV1A 4WU9C 2PYOB 3KXBB 3X1TC 3C1BB 5B32G 2F8NA 4NE5A 3W99B 3X1UA 3LJAB 5CPID 4X23C 4KGCD 1JFIB 1KX4D 1F66B 3REKB 1P3BD 3AZEA 1U35C 1P3FA 4M6BA 1TZYA 2CWEA 5AY8A 5B0ZB 3LZ0D 5B33C 3AN2C 4J8VD 1P3OA 4J8WA 3AZLB 2UWXA 5AV9D 4R8PC 5B32A 3AZMC 3VH6T 4CSRB 4ZUXD 3R45B 2CV5C 5B24B 4JJNB 5AVBD 2NZDB 2IO5C 1AOIB 1ZLAD 4WU9A 1BH9A 3LELC 3KSYA 2Y2NA 3REHC 5B31D 5CPIB 1M1AC 4DRBA 4KGCB 1KX4B 5B1LC 3X1VD 1U35A 1S32C 1P3BB 5CPKD 3AN2A 2HUEC 3LZ0B 1P3ID 3MNNB 4J8VB 4YS3B 2XD5A 2Y2QA 1P3BA 3MVDC 5B0YC 5AV9B 3AZMA 4ZBJC 1P34C 2J8PA 2Y2GA 3A1KA 4YM6B 3MGPC 2CV5A 3AZNB 3WTPD 4ZUXB 5B40C 2RVQD 3RELD 4XUJD 3H0RC 5B31G 5DNNC 3UTAB 3REIB 4G92C 3B6FC 1ZLAB 3C1CB 3A6NC 2AROC 4AWLC 4KHAA 5AVBA 4KUDD 3W97B 5GT3C 3WA9D 5CP6C 1P3AD 1B67A 5BNXB 1WWIA 5B1LA 5E5AD 4DQYB 3X1VB 5AV6C 5AV8C 5B31A 3KUYD 3AZKC 3B6GB 4WU8D 2DQNC 1ID3D 3X1VA 2NQBD 5F99D 3MGSD 5CPKA 3B0BA 4XZQC 5AV5D 3MGPA 1P3IA 3O62B 1R4VA 2XD1A 2F8NK 5JA4B 3WTPB 3WKJD 3RELB 3AYWD 2BYMA 1H3OA 2G5IC 5JA4A 4H9OA 3WTPA 3VH5W 4XUJA 3A6NA 2AROA 4J8XB 3AV2C 1P3PC 4KUDB 3X1UD 3WA9B 4CAYA 1P3AB 5B2ID 2BG1A 4QLCC 5AV6A 5AV8A 2HIOC 3WA9A 3AZKA 1TZYD 1P3AA 4H9RB 1TAFB 4G91C 5B1MC 3X1SC 5E5AA 3V9RB 3MGQB 4WU8B 3NQJB 5FUGB 5CPJB 1ID3B 1P3OD 2NQBB 1P3GC 4XZQA 2Y2PA 3KUYA 3EPLA 5B32D 3W98C 3V9RA 4J8UD 4LD9D 3WKJB 5F99A 3MGSA 2ZY4A 1PZRA 5BT1D 5DNMC 5AV5A 5GSUC 3H0MC 5C3IC 4WU9D 3AV1B 3AYWA 3X1TD 3VH5T 3AV2A 4Z66C 3X1UB 4X23D 4QLCA 3KXBC 1P3MC 3W99C 2HIOA 3LJAC 1U35D 1BH8A 3NQUA 3AZEB 5B33D 1P3FB 3AN2D 1TZYB 3P5JB 3VH6A 5AY8B 5B2IA 3IP4C 3REKC 1P3LC 1B6WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3G A;  1P3O B;  4J8W B;  4R8P D;  5AVC C;  5B0Z C;  3AZM D;  5BO0 A;  5B32 B;  2CV5 D;  3AZL C;  4J8U B;  3W96 C;  3AZG C;  5DNM A;  5GSU A;  5BS7 C;  3B0D C;  4J8U A;  4E45 A;  1M18 C;  4LD9 A;  3LEL D;  4WU9 B;  1BH9 B;  4JJN C;  4Z66 A;  5BNV B;  2NZD C;  3REH D;  3B0C W;  1AOI C;  4HGA C;  5GT0 C;  1M1A D;  1A7W A;  4NFT A;  1P3M A;  5B1L D;  3X1T A;  5BNV A;  1S32 D;  4H9P A;  5KDM B;  1U35 B;  4X23 A;  3AN2 B;  1P3L A;  5KDM A;  2L5A A;  3MVD D;  5B0Y D;  1P34 D;  5B33 A;  3AZM B;  3MNN C;  3AZJ C;  4YS3 C;  3MGP D;  1KX3 C;  5B40 D;  2CV5 B;  4H9N A;  3W96 A;  3AZG A;  1M19 C;  4Z5T C;  5DNN D;  4R8P A;  5BS7 A;  4YM6 C;  2YFV A;  2IO5 B;  3UTB C;  3AZN C;  1M18 A;  3B6F D;  3AZI C;  3AFA C;  3UTA C;  3A6N D;  2ARO D;  3REI C;  5B2J C;  4KHA B;  5AVB B;  3REH B;  5GT3 D;  5CP6 D;  3C1C C;  3B0C T;  4EO5 C;  3LEL A;  1BFM A;  5B1L B;  5AV6 D;  5AV8 D;  3REH A;  3W97 C;  5JRG C;  1M1A A;  5B31 B;  4H9S C;  3TU4 C;  3AZK D;  1S32 A;  1P3K C;  4XZQ D;  3AZJ A;  5CPK B;  1KX3 A;  2FJ7 C;  3B6G C;  3KWQ C;  3MGP B;  1P3I B;  1M19 A;  1KX5 C;  4Z5T A;  3MVD A;  5B0Y A;  1N1J A;  5DNN B;  3LZ1 C;  1P34 A;  3O62 C;  4G92 B;  2BYM B;  1H3O B;  1HQ3 C;  5GXQ C;  3AZI A;  3B6F B;  3AFA A;  5B40 A;  4H9O B;  5DNN A;  4XUJ B;  5G49 A;  2ARO B;  5B2J A;  3A6N B;  4AWL B;  3AV2 D;  1P3P D;  3B6F A;  4J8X C;  4QLC D;  4CAY B;  5JRG A;  2HIO D;  5AV8 B;  5AV6 B;  3WAA C;  4H9S A;  5GT3 A;  3AZH C;  5CP6 A;  5B1M D;  3X1S D;  3AZK B;  3REJ C;  3UT9 C;  1P3K A;  5E5A B;  1P3G D;  4XZQ B;  3KWQ A;  3W98 D;  3KUY B;  3MGQ C;  5CPJ C;  3AZF C;  3LZ1 A;  3VH5 A;  5F99 B;  5DNM D;  3MGS B;  5GSU D;  1EQZ C;  5AV5 B;  4NE3 A;  3MGR C;  3AYW B;  4Z66 D;  3AV2 B;  1P3P B;  3AV1 C;  3KXB D;  4QLC B;  1P3M D;  3W99 D;  3LJA D;  1P3P A;  3AZH A;  2HIO B;  1BH8 B;  3NQU B;  3REJ A;  5B1M B;  4G91 B;  3REK D;  1P3L D;  2PYO C;  5B2I B;  3C1B C;  2LY8 A;  3AZE C;  5AVC D;  1P3G B;  5B0Z D;  1P3F C;  3WTP E;  5AY8 C;  5B1M A;  3X1S A;  1KU5 A;  5BO0 B;  1F66 C;  3AZL D;  2F8N G;  3AZF A;  4J8W C;  3AZG D;  3W96 D;  3W98 A;  5DNM B;  5GSU B;  3MGR A;  1M18 D;  4LD9 B;  4JJN D;  4E44 A;  2NZD D;  4Z66 B;  1AOI D;  5GT0 D;  4H9Q A;  2BYK A;  5B24 C;  1P3M B;  3X1T B;  4H9P B;  2PYO A;  4X23 B;  4DRA A;  3KXB A;  3C1B A;  1P3L B;  3W99 A;  1ULY A;  3LJA A;  5AVC B;  5CPI C;  1JFI A;  3MNN D;  3AZJ D;  4YS3 D;  5B33 B;  1KX3 D;  3REK A;  1F66 A;  4KGC C;  1KX4 C;  1M19 D;  4Z5T D;  4H9N B;  3AZG B;  1P3B C;  3W96 B;  5AVC A;  5B0Z A;  4YM6 D;  4R8P B;  3LZ0 C;  3UTB D;  3AZN D;  3B0D B;  4J8V C;  2YFV B;  3AZL A;  3AZI D;  1M18 B;  3AFA D;  3UTA D;  3REI D;  5AV9 C;  5B2J D;  4CSR A;  3R45 A;  3C1C D;  4HGA B;  4WZS B;  5GT0 B;  5B24 A;  4ZUX C;  4JJN A;  3LEL B;  2NZD A;  1WWS A;  4WNN B;  5AVB C;  3W97 D;  5CHL B;  5JRG D;  1AOI A;  5GT0 A;  3TU4 D;  1ZLA C;  4Z2M H;  1M1A B;  1P3K D;  4WNN A;  1S32 B;  5CPI A;  5B31 C;  2FJ7 D;  3B6G D;  4KGC A;  3KWQ D;  2HUE B;  3AZJ B;  1KX3 B;  1KX4 A;  1KX5 D;  1M19 B;  3X1V C;  4Z5T B;  4NE6 A;  3LZ1 D;  3LZ0 A;  3MVD B;  5CPK C;  5B0Y B;  3O62 D;  1N1J B;  4ZBJ B;  3MNN A;  4J8V A;  3UTB B;  4YS3 A;  1P34 B;  1HQ3 D;  5GXQ D;  1P3I C;  3AZI B;  1F1E A;  3AFA B;  5B40 B;  4UUZ B;  5AV9 A;  4YM6 A;  5G49 B;  3UTB A;  5B2J B;  3AZN A;  4ZUX A;  4EO5 B;  3WTP C;  4J8X D;  2RVQ C;  4UUZ A;  4XUJ C;  3REL C;  3UTA A;  3REI A;  1HTA A;  3WAA D;  3AZH D;  5JRG B;  3C1C A;  1ZLA A;  4WV4 B;  3TU4 B;  5GT3 B;  5CP6 B;  3REJ D;  3UT9 D;  1P3K B;  3W97 A;  4KUD C;  2F8N H;  3TU4 A;  5BNX A;  3WA9 C;  2FJ7 B;  1P3A C;  2JSS A;  3MGQ D;  3KWQ B;  5CPJ D;  5E5A C;  1KX5 B;  3AZF D;  4Z2M G;  3LZ1 B;  3KUY C;  2FJ7 A;  3B6G A;  1EQZ D;  1HQ3 B;  5GXQ B;  3MGR D;  4WU8 C;  1KX5 A;  1ID3 C;  2NQB C;  5F99 C;  3MGS C;  3O62 A;  5AV5 C;  1HQ3 A;  5GXQ A;  3AV1 D;  3REL A;  1Q9C A;  3WKJ C;  3AYW C;  2F8N D;  3WAA B;  3AZH B;  4J8X A;  2PYO D;  3REJ B;  3UT9 B;  3C1B D;  4KUD A;  3AZE D;  3WAA A;  3X1U C;  1P3F D;  5AY8 D;  5B2I C;  3X1S B;  3UT9 A;  1F66 D;  4J8W D;  3AZF B;  4H9R A;  1TAF A;  1TZY C;  3MGQ A;  4WU8 A;  1EQZ B;  3W98 B;  3NQJ A;  5FUG A;  5CPJ A;  1ID3 A;  3MGR B;  2NQB A;  1P3O C;  2YFW B;  3VH6 W;  5B32 C;  1EQZ A;  4J8U C;  3WKJ A;  5B24 D;  4H9Q B;  4LD9 C;  2BYK B;  5C3I B;  2YFW A;  2F8N B;  5BT1 C;  3AV1 A;  4WU9 C;  2PYO B;  3KXB B;  3X1T C;  3C1B B;  5B32 G;  2F8N A;  4NE5 A;  3W99 B;  3X1U A;  3LJA B;  5CPI D;  4X23 C;  4KGC D;  1JFI B;  1KX4 D;  1F66 B;  3REK B;  1P3B D;  3AZE A;  1U35 C;  1P3F A;  4M6B A;  1TZY A;  2CWE A;  5AY8 A;  5B0Z B;  3LZ0 D;  5B33 C;  3AN2 C;  4J8V D;  1P3O A;  4J8W A;  3AZL B;  5AV9 D;  4R8P C;  5B32 A;  3AZM C;  3VH6 T;  4CSR B;  4ZUX D;  3R45 B;  2CV5 C;  5B24 B;  4JJN B;  5AVB D;  2NZD B;  2IO5 C;  1AOI B;  1ZLA D;  4WU9 A;  1BH9 A;  3LEL C;  3KSY A;  3REH C;  5B31 D;  5CPI B;  1M1A C;  4DRB A;  4KGC B;  1KX4 B;  5B1L C;  3X1V D;  1U35 A;  1S32 C;  1P3B B;  5CPK D;  3AN2 A;  2HUE C;  3LZ0 B;  1P3I D;  3MNN B;  4J8V B;  4YS3 B;  1P3B A;  3MVD C;  5B0Y C;  5AV9 B;  3AZM A;  4ZBJ C;  1P34 C;  4YM6 B;  3MGP C;  2CV5 A;  3AZN B;  3WTP D;  4ZUX B;  5B40 C;  2RVQ D;  3REL D;  4XUJ D;  5B31 G;  5DNN C;  3UTA B;  3REI B;  4G92 C;  3B6F C;  1ZLA B;  3C1C B;  3A6N C;  2ARO C;  4AWL C;  4KHA A;  5AVB A;  4KUD D;  3W97 B;  5GT3 C;  3WA9 D;  5CP6 C;  1P3A D;  1B67 A;  5BNX B;  1WWI A;  5B1L A;  5E5A D;  3X1V B;  5AV6 C;  5AV8 C;  5B31 A;  3KUY D;  3AZK C;  3B6G B;  4WU8 D;  1ID3 D;  3X1V A;  2NQB D;  5F99 D;  3MGS D;  5CPK A;  3B0B A;  4XZQ C;  5AV5 D;  3MGP A;  1P3I A;  3O62 B;  1R4V A;  2F8N K;  5JA4 B;  3WTP B;  3WKJ D;  3REL B;  3AYW D;  2BYM A;  1H3O A;  5JA4 A;  4H9O A;  3WTP A;  3VH5 W;  4XUJ A;  3A6N A;  2ARO A;  4J8X B;  3AV2 C;  1P3P C;  4KUD B;  3X1U D;  3WA9 B;  4CAY A;  1P3A B;  5B2I D;  4QLC C;  5AV6 A;  5AV8 A;  2HIO C;  3WA9 A;  3AZK A;  1TZY D;  1P3A A;  4H9R B;  1TAF B;  4G91 C;  5B1M C;  3X1S C;  5E5A A;  3V9R B;  3MGQ B;  4WU8 B;  3NQJ B;  5FUG B;  5CPJ B;  1ID3 B;  1P3O D;  2NQB B;  1P3G C;  4XZQ A;  3KUY A;  5B32 D;  3W98 C;  3V9R A;  4J8U D;  4LD9 D;  3WKJ B;  5F99 A;  3MGS A;  5BT1 D;  5DNM C;  5AV5 A;  5GSU C;  5C3I C;  4WU9 D;  3AV1 B;  3AYW A;  3X1T D;  3VH5 T;  3AV2 A;  4Z66 C;  3X1U B;  4X23 D;  4QLC A;  3KXB C;  1P3M C;  3W99 C;  2HIO A;  3LJA C;  1U35 D;  1BH8 A;  3NQU A;  3AZE B;  5B33 D;  1P3F B;  3AN2 D;  1TZY B;  3VH6 A;  5AY8 B;  5B2I A;  3REK C;  1P3L C;  1B6W A; 
#chains in the Genus database with same CATH topology
 1P3G A;  1P3O B;  4J8W B;  4R8P D;  5AVC C;  5B0Z C;  3AZM D;  5BO0 A;  2ZY5 A;  5B32 B;  2Y2J A;  3AZL C;  2CV5 D;  4J8U B;  3W96 C;  3AZG C;  5DNM A;  5GSU A;  3EPH A;  2Y2O A;  2Y2M A;  5BS7 C;  3B0D C;  4J8U A;  4E45 A;  1M18 C;  4LD9 A;  3LEL D;  4WU9 B;  1BH9 B;  4JJN C;  4Z66 A;  5BNV B;  2NZD C;  3REH D;  2F2A C;  3B0C W;  1AOI C;  4HGA C;  5GT0 C;  1M1A D;  1A7W A;  4NFT A;  1P3M A;  5B1L D;  3X1T A;  5BNV A;  1S32 D;  4H9P A;  5KDM B;  1U35 B;  2ZY3 A;  4X23 A;  3AN2 B;  1P3L A;  3EG5 B;  5KDM A;  2L5A A;  3MVD D;  5B0Y D;  1P34 D;  5B33 A;  3AZM B;  3MNN C;  3AZJ C;  2Y2H A;  4YS3 C;  3MGP D;  1KX3 C;  5B40 D;  3EPJ A;  4H9N A;  2CV5 B;  3W96 A;  3AZG A;  1M19 C;  4Z5T C;  5DNN D;  4R8P A;  5BS7 A;  4YM6 C;  2YFV A;  2IO5 B;  3UTB C;  1W2E A;  3AZN C;  1M18 A;  3B6F D;  3AZI C;  3AFA C;  3UTA C;  3A6N D;  2ARO D;  3REI C;  3F6T A;  5B2J C;  4KHA B;  5AVB B;  3REH B;  5GT3 D;  5CP6 D;  3C1C C;  3B0C T;  4EO5 C;  3LEL A;  1BFM A;  5B1L B;  5AV6 D;  5AV8 D;  3REH A;  3W97 C;  5JRG C;  2G5H C;  5B31 B;  4H9S C;  3TU4 C;  1M1A A;  3AZK D;  1S32 A;  1P3K C;  4XZQ D;  3AZJ A;  5CPK B;  1KX3 A;  2FJ7 C;  3B6G C;  3KWQ C;  3MGP B;  1P3I B;  1M19 A;  1KX5 C;  4Z5T A;  3MVD A;  5B0Y A;  1N1J A;  5DNN B;  3LZ1 C;  1P34 A;  3O62 C;  4G92 B;  2BYM B;  1H3O B;  1HQ3 C;  5GXQ C;  3AZI A;  3B6F B;  3AFA A;  5B40 A;  4H9O B;  5DNN A;  4XUJ B;  5G49 A;  2ARO B;  5B2J A;  3A6N B;  4AWL B;  3AV2 D;  1P3P D;  3B6F A;  4J8X C;  4QLC D;  4CAY B;  2HIO D;  5AV6 B;  5AV8 B;  5JRG A;  3WAA C;  4H9S A;  5GT3 A;  3AZH C;  5CP6 A;  5B1M D;  3X1S D;  3AZK B;  3REJ C;  3UT9 C;  1P3K A;  5E5A B;  2FFF B;  1P3G D;  4XZQ B;  3KWQ A;  3W98 D;  3KUY B;  3MGQ C;  5CPJ C;  3AZF C;  3LZ1 A;  3VH5 A;  5F99 B;  5DNM D;  3MGS B;  5GSU D;  1EQZ C;  5AV5 B;  2DF4 C;  4NE3 A;  3MGR C;  3AYW B;  4Z66 D;  2Y2L A;  3AV2 B;  3FDD A;  1P3P B;  3AV1 C;  3KXB D;  2Y2K A;  4QLC B;  1P3M D;  3W99 D;  3LJA D;  1P3P A;  3AZH A;  2HIO B;  1BH8 B;  3NQU B;  3REJ A;  5B1M B;  4G91 B;  3H0L C;  3REK D;  1P3L D;  2PYO C;  5B2I B;  3C1B C;  2LY8 A;  3AZE C;  5AVC D;  1P3G B;  5B0Z D;  1P3F C;  3WTP E;  5AY8 C;  5B1M A;  3X1S A;  1KU5 A;  5BO0 B;  1F66 C;  3AZL D;  3EPK A;  2F8N G;  3AZF A;  4J8W C;  3AZG D;  3W96 D;  3W98 A;  5DNM B;  5GSU B;  3MGR A;  1T3U A;  1M18 D;  4LD9 B;  4JJN D;  4E44 A;  2NZD D;  4Z66 B;  1AOI D;  5GT0 D;  4H9Q A;  2BYK A;  5B24 C;  1P3M B;  2VQR A;  3X1T B;  4H9P B;  2PYO A;  4X23 B;  4DRA A;  3KXB A;  3C1B A;  1P3L B;  3W99 A;  1ULY A;  3LJA A;  5AVC B;  5CPI C;  1JFI A;  3MNN D;  3AZJ D;  4YS3 D;  5B33 B;  1KX3 D;  3REK A;  1F66 A;  4KGC C;  1KX4 C;  1M19 D;  4Z5T D;  4H9N B;  3AZG B;  1P3B C;  3W96 B;  2RIQ A;  5AVC A;  5B0Z A;  4YM6 D;  4R8P B;  3LZ0 C;  3UTB D;  3AZN D;  3B0D B;  4J8V C;  2YFV B;  3AZL A;  3AZI D;  1M18 B;  3AFA D;  3UTA D;  3REI D;  5AV9 C;  5B2J D;  4CSR A;  3R45 A;  3C1C D;  4HGA B;  5GT0 B;  4WZS B;  5B24 A;  4ZUX C;  4JJN A;  3LEL B;  2NZD A;  1WWS A;  4WNN B;  5AVB C;  3W97 D;  5CHL B;  5JRG D;  1AOI A;  5GT0 A;  3TU4 D;  1ZLA C;  4Z2M H;  1M1A B;  1P3K D;  4WNN A;  1S32 B;  5CPI A;  2JE5 A;  5B31 C;  2FJ7 D;  3B6G D;  4KGC A;  3KWQ D;  2HUE B;  3AZJ B;  1KX3 B;  1KX4 A;  1KX5 D;  1M19 B;  3X1V C;  4Z5T B;  4NE6 A;  3LZ1 D;  3LZ0 A;  3MVD B;  5CPK C;  5B0Y B;  3O62 D;  1N1J B;  4ZBJ B;  3MNN A;  4J8V A;  3UTB B;  4YS3 A;  1P34 B;  1HQ3 D;  5GXQ D;  1P3I C;  3AZI B;  1F1E A;  3AFA B;  5B40 B;  4UUZ B;  5AV9 A;  4YM6 A;  5G49 B;  3UTB A;  5B2J B;  3AZN A;  4ZUX A;  4UPK A;  4EO5 B;  3WTP C;  2W8S A;  4J8X D;  2RVQ C;  4UUZ A;  4XUJ C;  3REL C;  3UTA A;  3REI A;  1HTA A;  3WAA D;  3AZH D;  5JRG B;  3C1C A;  1ZLA A;  4WV4 B;  3TU4 B;  5GT3 B;  5CP6 B;  4WJ3 C;  3REJ D;  3UT9 D;  1Z2C B;  1P3K B;  3W97 A;  3A1I A;  4KUD C;  2F8N H;  3TU4 A;  5BNX A;  3WA9 C;  2FJ7 B;  1P3A C;  2JSS A;  3MGQ D;  3KWQ B;  5CPJ D;  5E5A C;  2JCH A;  1KX5 B;  3AZF D;  4Z2M G;  3LZ1 B;  3KUY C;  2FJ7 A;  3B6G A;  1EQZ D;  1HQ3 B;  5GXQ B;  3MGR D;  4WU8 C;  1KX5 A;  1ID3 C;  2NQB C;  5F99 C;  3MGS C;  2ZY2 A;  3O62 A;  5AV5 C;  1HQ3 A;  5GXQ A;  3AV1 D;  3REL A;  1Q9C A;  3WKJ C;  3AYW C;  2F8N D;  2ZM5 A;  3WAA B;  3AZH B;  3AL0 C;  4J8X A;  2PYO D;  3REJ B;  3UT9 B;  3C1B D;  4KUD A;  3AZE D;  3WAA A;  3X1U C;  1P3F D;  5AY8 D;  5B2I C;  3X1S B;  3UT9 A;  1F66 D;  4J8W D;  3AZF B;  4H9R A;  1TAF A;  1TZY C;  3MGQ A;  4WU8 A;  1EQZ B;  3W98 B;  3NQJ A;  5FUG A;  2Y2I A;  5CPJ A;  3MGR B;  1ID3 A;  2NQB A;  1P3O C;  2YFW B;  3KFU G;  3VH6 W;  5B32 C;  1EQZ A;  4J8U C;  3WKJ A;  5B24 D;  4H9Q B;  4LD9 C;  2BYK B;  5C3I B;  2YFW A;  2F8N B;  5BT1 C;  3AV1 A;  4WU9 C;  2PYO B;  3KXB B;  3X1T C;  3C1B B;  5B32 G;  2F8N A;  4NE5 A;  3W99 B;  3X1U A;  3LJA B;  5CPI D;  4X23 C;  4KGC D;  1JFI B;  1KX4 D;  1F66 B;  3REK B;  1P3B D;  3AZE A;  1U35 C;  1P3F A;  4M6B A;  1TZY A;  2CWE A;  5AY8 A;  5B0Z B;  3LZ0 D;  5B33 C;  3AN2 C;  4J8V D;  1P3O A;  4J8W A;  3AZL B;  2UWX A;  5AV9 D;  4R8P C;  5B32 A;  3AZM C;  3VH6 T;  4CSR B;  4ZUX D;  3R45 B;  2CV5 C;  5B24 B;  4JJN B;  5AVB D;  2NZD B;  2IO5 C;  1AOI B;  1ZLA D;  4WU9 A;  1BH9 A;  3LEL C;  3KSY A;  2Y2N A;  3REH C;  5B31 D;  5CPI B;  1M1A C;  4DRB A;  4KGC B;  1KX4 B;  5B1L C;  3X1V D;  1U35 A;  1S32 C;  1P3B B;  5CPK D;  3AN2 A;  2HUE C;  3LZ0 B;  1P3I D;  3MNN B;  4J8V B;  4YS3 B;  2XD5 A;  2Y2Q A;  1P3B A;  3MVD C;  5B0Y C;  5AV9 B;  3AZM A;  4ZBJ C;  1P34 C;  2J8P A;  2Y2G A;  3A1K A;  4YM6 B;  3MGP C;  2CV5 A;  3AZN B;  3WTP D;  4ZUX B;  5B40 C;  2RVQ D;  3REL D;  4XUJ D;  3H0R C;  5B31 G;  5DNN C;  3UTA B;  3REI B;  4G92 C;  3B6F C;  1ZLA B;  3C1C B;  3A6N C;  2ARO C;  4AWL C;  4KHA A;  5AVB A;  4KUD D;  3W97 B;  5GT3 C;  3WA9 D;  5CP6 C;  1P3A D;  1B67 A;  5BNX B;  1WWI A;  5B1L A;  5E5A D;  4DQY B;  3X1V B;  5AV6 C;  5AV8 C;  5B31 A;  3KUY D;  3AZK C;  3B6G B;  4WU8 D;  2DQN C;  1ID3 D;  3X1V A;  2NQB D;  5F99 D;  3MGS D;  5CPK A;  3B0B A;  4XZQ C;  5AV5 D;  3MGP A;  1P3I A;  3O62 B;  1R4V A;  2XD1 A;  2F8N K;  5JA4 B;  3WTP B;  3WKJ D;  3REL B;  3AYW D;  2BYM A;  1H3O A;  2G5I C;  5JA4 A;  4H9O A;  3WTP A;  3VH5 W;  4XUJ A;  3A6N A;  2ARO A;  4J8X B;  3AV2 C;  1P3P C;  4KUD B;  3X1U D;  3WA9 B;  4CAY A;  1P3A B;  5B2I D;  2BG1 A;  4QLC C;  5AV6 A;  5AV8 A;  2HIO C;  3WA9 A;  3AZK A;  1TZY D;  1P3A A;  4H9R B;  1TAF B;  4G91 C;  5B1M C;  3X1S C;  5E5A A;  3V9R B;  3MGQ B;  4WU8 B;  3NQJ B;  5FUG B;  5CPJ B;  1ID3 B;  1P3O D;  2NQB B;  1P3G C;  4XZQ A;  2Y2P A;  3KUY A;  3EPL A;  5B32 D;  3W98 C;  3V9R A;  4J8U D;  4LD9 D;  3WKJ B;  5F99 A;  3MGS A;  2ZY4 A;  1PZR A;  5BT1 D;  5DNM C;  5AV5 A;  5GSU C;  3H0M C;  5C3I C;  4WU9 D;  3AV1 B;  3AYW A;  3X1T D;  3VH5 T;  3AV2 A;  4Z66 C;  3X1U B;  4X23 D;  4QLC A;  3KXB C;  1P3M C;  3W99 C;  2HIO A;  3LJA C;  1U35 D;  1BH8 A;  3NQU A;  3AZE B;  5B33 D;  1P3F B;  3AN2 D;  1TZY B;  3P5J B;  3VH6 A;  5AY8 B;  5B2I A;  3IP4 C;  3REK C;  1P3L C;  1B6W A; 
#chains in the Genus database with same CATH homology
 1P3G A;  1P3O B;  4J8W B;  4R8P D;  5AVC C;  5B0Z C;  3AZM D;  5BO0 A;  2ZY5 A;  5B32 B;  2Y2J A;  3AZL C;  2CV5 D;  4J8U B;  3W96 C;  3AZG C;  5DNM A;  5GSU A;  3EPH A;  2Y2O A;  2Y2M A;  5BS7 C;  3B0D C;  4J8U A;  4E45 A;  1M18 C;  4LD9 A;  3LEL D;  4WU9 B;  1BH9 B;  4JJN C;  4Z66 A;  5BNV B;  2NZD C;  3REH D;  2F2A C;  3B0C W;  1AOI C;  4HGA C;  5GT0 C;  1M1A D;  1A7W A;  4NFT A;  1P3M A;  5B1L D;  3X1T A;  5BNV A;  1S32 D;  4H9P A;  5KDM B;  1U35 B;  2ZY3 A;  4X23 A;  3AN2 B;  1P3L A;  3EG5 B;  5KDM A;  2L5A A;  3MVD D;  5B0Y D;  1P34 D;  5B33 A;  3AZM B;  3MNN C;  3AZJ C;  2Y2H A;  4YS3 C;  3MGP D;  1KX3 C;  5B40 D;  3EPJ A;  4H9N A;  2CV5 B;  3W96 A;  3AZG A;  1M19 C;  4Z5T C;  5DNN D;  4R8P A;  5BS7 A;  4YM6 C;  2YFV A;  2IO5 B;  3UTB C;  1W2E A;  3AZN C;  1M18 A;  3B6F D;  3AZI C;  3AFA C;  3UTA C;  3A6N D;  2ARO D;  3REI C;  3F6T A;  5B2J C;  4KHA B;  5AVB B;  3REH B;  5GT3 D;  5CP6 D;  3C1C C;  3B0C T;  4EO5 C;  3LEL A;  1BFM A;  5B1L B;  5AV6 D;  5AV8 D;  3REH A;  3W97 C;  5JRG C;  2G5H C;  5B31 B;  4H9S C;  3TU4 C;  1M1A A;  3AZK D;  1S32 A;  1P3K C;  4XZQ D;  3AZJ A;  5CPK B;  1KX3 A;  2FJ7 C;  3B6G C;  3KWQ C;  3MGP B;  1P3I B;  1M19 A;  1KX5 C;  4Z5T A;  3MVD A;  5B0Y A;  1N1J A;  5DNN B;  3LZ1 C;  1P34 A;  3O62 C;  4G92 B;  2BYM B;  1H3O B;  1HQ3 C;  5GXQ C;  3AZI A;  3B6F B;  3AFA A;  5B40 A;  4H9O B;  5DNN A;  4XUJ B;  5G49 A;  2ARO B;  5B2J A;  3A6N B;  4AWL B;  3AV2 D;  1P3P D;  3B6F A;  4J8X C;  4QLC D;  4CAY B;  2HIO D;  5AV6 B;  5AV8 B;  5JRG A;  3WAA C;  4H9S A;  5GT3 A;  3AZH C;  5CP6 A;  5B1M D;  3X1S D;  3AZK B;  3REJ C;  3UT9 C;  1P3K A;  5E5A B;  2FFF B;  1P3G D;  4XZQ B;  3KWQ A;  3W98 D;  3KUY B;  3MGQ C;  5CPJ C;  3AZF C;  3LZ1 A;  3VH5 A;  5F99 B;  5DNM D;  3MGS B;  5GSU D;  1EQZ C;  5AV5 B;  2DF4 C;  4NE3 A;  3MGR C;  3AYW B;  4Z66 D;  2Y2L A;  3AV2 B;  3FDD A;  1P3P B;  3AV1 C;  3KXB D;  2Y2K A;  4QLC B;  1P3M D;  3W99 D;  3LJA D;  1P3P A;  3AZH A;  2HIO B;  1BH8 B;  3NQU B;  3REJ A;  5B1M B;  4G91 B;  3H0L C;  3REK D;  1P3L D;  2PYO C;  5B2I B;  3C1B C;  2LY8 A;  3AZE C;  5AVC D;  1P3G B;  5B0Z D;  1P3F C;  3WTP E;  5AY8 C;  5B1M A;  3X1S A;  1KU5 A;  5BO0 B;  1F66 C;  3AZL D;  3EPK A;  2F8N G;  3AZF A;  4J8W C;  3AZG D;  3W96 D;  3W98 A;  5DNM B;  5GSU B;  3MGR A;  1T3U A;  1M18 D;  4LD9 B;  4JJN D;  4E44 A;  2NZD D;  4Z66 B;  1AOI D;  5GT0 D;  4H9Q A;  2BYK A;  5B24 C;  1P3M B;  2VQR A;  3X1T B;  4H9P B;  2PYO A;  4X23 B;  4DRA A;  3KXB A;  3C1B A;  1P3L B;  3W99 A;  1ULY A;  3LJA A;  5AVC B;  5CPI C;  1JFI A;  3MNN D;  3AZJ D;  4YS3 D;  5B33 B;  1KX3 D;  3REK A;  1F66 A;  4KGC C;  1KX4 C;  1M19 D;  4Z5T D;  4H9N B;  3AZG B;  1P3B C;  3W96 B;  2RIQ A;  5AVC A;  5B0Z A;  4YM6 D;  4R8P B;  3LZ0 C;  3UTB D;  3AZN D;  3B0D B;  4J8V C;  2YFV B;  3AZL A;  3AZI D;  1M18 B;  3AFA D;  3UTA D;  3REI D;  5AV9 C;  5B2J D;  4CSR A;  3R45 A;  3C1C D;  4HGA B;  5GT0 B;  4WZS B;  5B24 A;  4ZUX C;  4JJN A;  3LEL B;  2NZD A;  1WWS A;  4WNN B;  5AVB C;  3W97 D;  5CHL B;  5JRG D;  1AOI A;  5GT0 A;  3TU4 D;  1ZLA C;  4Z2M H;  1M1A B;  1P3K D;  4WNN A;  1S32 B;  5CPI A;  2JE5 A;  5B31 C;  2FJ7 D;  3B6G D;  4KGC A;  3KWQ D;  2HUE B;  3AZJ B;  1KX3 B;  1KX4 A;  1KX5 D;  1M19 B;  3X1V C;  4Z5T B;  4NE6 A;  3LZ1 D;  3LZ0 A;  3MVD B;  5CPK C;  5B0Y B;  3O62 D;  1N1J B;  4ZBJ B;  3MNN A;  4J8V A;  3UTB B;  4YS3 A;  1P34 B;  1HQ3 D;  5GXQ D;  1P3I C;  3AZI B;  1F1E A;  3AFA B;  5B40 B;  4UUZ B;  5AV9 A;  4YM6 A;  5G49 B;  3UTB A;  5B2J B;  3AZN A;  4ZUX A;  4UPK A;  4EO5 B;  3WTP C;  2W8S A;  4J8X D;  2RVQ C;  4UUZ A;  4XUJ C;  3REL C;  3UTA A;  3REI A;  1HTA A;  3WAA D;  3AZH D;  5JRG B;  3C1C A;  1ZLA A;  4WV4 B;  3TU4 B;  5GT3 B;  5CP6 B;  4WJ3 C;  3REJ D;  3UT9 D;  1Z2C B;  1P3K B;  3W97 A;  3A1I A;  4KUD C;  2F8N H;  3TU4 A;  5BNX A;  3WA9 C;  2FJ7 B;  1P3A C;  2JSS A;  3MGQ D;  3KWQ B;  5CPJ D;  5E5A C;  2JCH A;  1KX5 B;  3AZF D;  4Z2M G;  3LZ1 B;  3KUY C;  2FJ7 A;  3B6G A;  1EQZ D;  1HQ3 B;  5GXQ B;  3MGR D;  4WU8 C;  1KX5 A;  1ID3 C;  2NQB C;  5F99 C;  3MGS C;  2ZY2 A;  3O62 A;  5AV5 C;  1HQ3 A;  5GXQ A;  3AV1 D;  3REL A;  1Q9C A;  3WKJ C;  3AYW C;  2F8N D;  2ZM5 A;  3WAA B;  3AZH B;  3AL0 C;  4J8X A;  2PYO D;  3REJ B;  3UT9 B;  3C1B D;  4KUD A;  3AZE D;  3WAA A;  3X1U C;  1P3F D;  5AY8 D;  5B2I C;  3X1S B;  3UT9 A;  1F66 D;  4J8W D;  3AZF B;  4H9R A;  1TAF A;  1TZY C;  3MGQ A;  4WU8 A;  1EQZ B;  3W98 B;  3NQJ A;  5FUG A;  2Y2I A;  5CPJ A;  3MGR B;  1ID3 A;  2NQB A;  1P3O C;  2YFW B;  3KFU G;  3VH6 W;  5B32 C;  1EQZ A;  4J8U C;  3WKJ A;  5B24 D;  4H9Q B;  4LD9 C;  2BYK B;  5C3I B;  2YFW A;  2F8N B;  5BT1 C;  3AV1 A;  4WU9 C;  2PYO B;  3KXB B;  3X1T C;  3C1B B;  5B32 G;  2F8N A;  4NE5 A;  3W99 B;  3X1U A;  3LJA B;  5CPI D;  4X23 C;  4KGC D;  1JFI B;  1KX4 D;  1F66 B;  3REK B;  1P3B D;  3AZE A;  1U35 C;  1P3F A;  4M6B A;  1TZY A;  2CWE A;  5AY8 A;  5B0Z B;  3LZ0 D;  5B33 C;  3AN2 C;  4J8V D;  1P3O A;  4J8W A;  3AZL B;  2UWX A;  5AV9 D;  4R8P C;  5B32 A;  3AZM C;  3VH6 T;  4CSR B;  4ZUX D;  3R45 B;  2CV5 C;  5B24 B;  4JJN B;  5AVB D;  2NZD B;  2IO5 C;  1AOI B;  1ZLA D;  4WU9 A;  1BH9 A;  3LEL C;  3KSY A;  2Y2N A;  3REH C;  5B31 D;  5CPI B;  1M1A C;  4DRB A;  4KGC B;  1KX4 B;  5B1L C;  3X1V D;  1U35 A;  1S32 C;  1P3B B;  5CPK D;  3AN2 A;  2HUE C;  3LZ0 B;  1P3I D;  3MNN B;  4J8V B;  4YS3 B;  2XD5 A;  2Y2Q A;  1P3B A;  3MVD C;  5B0Y C;  5AV9 B;  3AZM A;  4ZBJ C;  1P34 C;  2J8P A;  2Y2G A;  3A1K A;  4YM6 B;  3MGP C;  2CV5 A;  3AZN B;  3WTP D;  4ZUX B;  5B40 C;  2RVQ D;  3REL D;  4XUJ D;  3H0R C;  5B31 G;  5DNN C;  3UTA B;  3REI B;  4G92 C;  3B6F C;  1ZLA B;  3C1C B;  3A6N C;  2ARO C;  4AWL C;  4KHA A;  5AVB A;  4KUD D;  3W97 B;  5GT3 C;  3WA9 D;  5CP6 C;  1P3A D;  1B67 A;  5BNX B;  1WWI A;  5B1L A;  5E5A D;  4DQY B;  3X1V B;  5AV6 C;  5AV8 C;  5B31 A;  3KUY D;  3AZK C;  3B6G B;  4WU8 D;  2DQN C;  1ID3 D;  3X1V A;  2NQB D;  5F99 D;  3MGS D;  5CPK A;  3B0B A;  4XZQ C;  5AV5 D;  3MGP A;  1P3I A;  3O62 B;  1R4V A;  2XD1 A;  2F8N K;  5JA4 B;  3WTP B;  3WKJ D;  3REL B;  3AYW D;  2BYM A;  1H3O A;  2G5I C;  5JA4 A;  4H9O A;  3WTP A;  3VH5 W;  4XUJ A;  3A6N A;  2ARO A;  4J8X B;  3AV2 C;  1P3P C;  4KUD B;  3X1U D;  3WA9 B;  4CAY A;  1P3A B;  5B2I D;  2BG1 A;  4QLC C;  5AV6 A;  5AV8 A;  2HIO C;  3WA9 A;  3AZK A;  1TZY D;  1P3A A;  4H9R B;  1TAF B;  4G91 C;  5B1M C;  3X1S C;  5E5A A;  3V9R B;  3MGQ B;  4WU8 B;  3NQJ B;  5FUG B;  5CPJ B;  1ID3 B;  1P3O D;  2NQB B;  1P3G C;  4XZQ A;  2Y2P A;  3KUY A;  3EPL A;  5B32 D;  3W98 C;  3V9R A;  4J8U D;  4LD9 D;  3WKJ B;  5F99 A;  3MGS A;  2ZY4 A;  1PZR A;  5BT1 D;  5DNM C;  5AV5 A;  5GSU C;  3H0M C;  5C3I C;  4WU9 D;  3AV1 B;  3AYW A;  3X1T D;  3VH5 T;  3AV2 A;  4Z66 C;  3X1U B;  4X23 D;  4QLC A;  3KXB C;  1P3M C;  3W99 C;  2HIO A;  3LJA C;  1U35 D;  1BH8 A;  3NQU A;  3AZE B;  5B33 D;  1P3F B;  3AN2 D;  1TZY B;  3P5J B;  3VH6 A;  5AY8 B;  5B2I A;  3IP4 C;  3REK C;  1P3L C;  1B6W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...