1EQZC

X-ray structure of the nucleosome core particle at 2.5 a resolution
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
107
structure length
106
Chain Sequence
APATGGVKKPHRYRPGTVALREIRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 146 NUCLEOTIDES LONG DNA
publication title Asymmetries in the nucleosome core particle at 2.5 A resolution.
pubmed doi rcsb
molecule tags Structural protein/dna
total genus 31
structure length 106
sequence length 107
chains with identical sequence G
ec nomenclature
pdb deposition date 2000-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1eqzC00
3MGRB 3AFAA 3RELB 1P3IB 3AZEA 3AZEB 1P34B 2CWEA 4KUDA 1AOIB 4KUDB 1KX3A 1KX5A 3MGPB 3X1VD 1KX5B 2BYMA 5JRGD 3TU4B 5AV8D 3WAAC 3B6GC 2YFVB 5G49A 1TZYD 5CPKD 2NZDC 4QLCD 3X1SC 4Z66C 3B0DC 5DNMD 5B32C 4KHAA 4LD9D 5JRGA 3C1CA 5AV8A 3W97C 4JJNC 4ZUXD 3C1CB 1P3LC 3AZGC 1TZYA 5CPKA 1TZYB 4QLCA 5AVCD 1A7WA 5F99C 4QLCB 5DNMA 5GXQC 2LY8A 3W99D 3NQUB 2IO5C 4LD9A 4ZUXA 3X1TC 5JA4A 5AV6D 5AVCA 5E5AB 1F66C 3W99A 1EQZD 5BO0B 5B32G 3MGRC 3KXBD 2PYOB 4G91B 3RELC 1P3IC 5B2JD 3LELB 5AV6A 5B31D 3AZEC 1P34C 1F1EA 1AOIC 4KUDC 5CPJD 3MGPC 2HIOB 5CPIB 1BH9A 3TU4C 3KXBA 5B2JA 3WKJD 4H9OA 5BT1C 5B31A 3AZND 3NQJB 3REHD 5CPJA 5CPJB 1B67A 3C1CC 1B6WA 1M1AD 3WKJA 1TZYC 3REID 3AZNA 4QLCC 3REHA 3KWQD 4DRBA 1KU5A 1S32D 5KDMA 1P3OD 5KDMB 4UUZA 1M1AA 1BH8A 3REIA 5E5AC 3REIB 2JSSA 2AROB 5AV9B 1H3OB 4ZBJB 3AV1B 5B1MD 3AZID 1S32A 2YFWA 2PYOC 3LJAB 5GT0D 1S32B 2YFWB 4G91C 4NFTA 3AN2D 1P3MD 1P3OA 1BFMA 3R45A 3A6ND 3LELC 4WU9B 4XUJD 2F8NK 4CAYA 5GSUD 3KSYA 5BNVB 5B2IB 2HIOC 5CPIC 3AZMD 5B1MA 3B6FD 3AZIA 3MGQB 1KX4B 5GT0A 3AN2A 1P3MA 1ZLAB 3AN2B 2F8ND 3A6NA 4XUJA 1P3KD 3A6NB 4J8VA 1HQ3D 5CP6B 3AYWD 5GSUA 3WTPE 4J8VB 5GSUB 4R8PD 5CPJC 3LZ0D 4Z2MH 3MGSD 3UTAB 3AZMA 3B6FA 3AZMB 5AV5A 5AV5B 2F8NA 1P3KA 4WU8D 1HQ3A 3AYWA 5GT3B 1HQ3B 4R8PA 3LZ0A 3MGSA 2NQBD 4H9QA 4X23B 3VH6T 3LZ1D 1R4VA 3AZJD 4J8XD 4WU8A 4YM6D 4WU8B 3REIC 3MNNB 3AZHD 2AROC 5AV9C 3REJD 4ZBJC 3AV1C 4CSRA 3AFAB 2RVQC 4CSRB 3LJAC 2NQBA 1S32C 4HGAB 4XZQD 4DRAA 4WU9C 3LZ1A 3AZKD 3AZJA 1P3GD 1KX3B 4J8XA 3AZJB 4YM6A 2BYMB 3B0CW 4YS3D 3AZHA 3REJA 5B2IC 1P3BD 3MGQC 1KX4C 5G49B 3VH5W 2F8NH 1ZLAC 4XZQA 3X1UD 3AZKA 3A6NC 5CP6C 1P3GA 3X1VA 4J8VC 3X1VB 5GSUC 4KHAB 5FUGA 4YS3A 1P3BA 2FJ7D 5JRGB 3VH5A 4YS3B 5AV8B 3UTAC 5AVBD 5AV5C 5CPKB 4H9NA 3UT9D 3X1UA 5DNMB 3W98D 5B0YD 5GT3C 1HQ3C 2FJ7A 1ID3D 4EO5B 4LD9B 5BS7C 5B40D 4ZUXB 5B24D 5AVBA 2CV5D 5JA4B 1N1JA 1N1JB 4X23C 3UT9A 5AVCB 3W98A 3W99B 4WU8C 5B0YA 3MNNC 3W98B 1JFIA 4G92B 1ID3A 3AFAC 5B40A 5B24A 2CV5A 5AV6B 2CV5B 1WWIA 5AY8D 3AZLD 1KX3C 1EQZA 1KX5C 1EQZB 1BH9B 3KXBB 4Z5TD 5B2JB 4H9OB 5B31B 5AY8A 3AZLA 3X1VC 3C1BD 3KUYD 5JRGC 4YS3C 3WTPD 5AV8C 4Z5TA 3WKJB 5CPKC 3AZNB 4H9SA 5DNMC 4NE3A 3O62D 3REHB 3C1BA 1M19D 4LD9C 5B1LD 4EO5C 3KUYA 3WTPA 4M6BA 3C1BB 4J8UD 3KUYB 3WTPB 4UUZB 4ZUXC 4WNNA 4J8WD 4WNNB 1M1AB 1BH8B 5AVCC 5B0ZD 3UTBD 3O62A 5B33D 3KWQA 3W99C 3V9RA 3KWQB 3WA9D 3W98C 1M19A 1WWSA 4NE6A 5B1LA 4G92C 1P3OB 1M19B 4J8UA 1M18D 4J8WA 3R45B 1HTAA 5AV6C 2CV5C 4CAYB 5B0ZA 3UTBA 5B33A 1EQZC 5B33B 3WA9A 5B1MB 3WA9B 2L5AA 3AZIB 3KXBC 5GT0B 1P3MB 1M18A 5B2JC 4XUJB 5B31C 3WAAD 3B6GD 3B0BA 2NZDD 3B6FB 3X1SD 4E44A 1P3FD 5B32D 2F8NB 3WKJC 1P3KB 4JJND 3AZNC 1P3LD 3AYWB 3WAAA 3B6GA 4H9SC 1P3PD 3REHC 4R8PB 2NZDA 3LZ0B 4H9PA 3X1SA 3MGSB 5F99D 3KUYC 3WTPC 5GXQD 1P3FA 1P3FB 4H9QB 5B32A 1M1AC 5CHLB 5B31G 4JJNA 1P3LA 3X1TD 1P3PA 3KWQC 1P3PB 1P3OC 2NQBB 5F99A 4WV4B 1F66D 5GXQA 1Q9CA 3AZFD 3LZ1B 3MGRD 4J8XB 3RELD 1P3ID 4YM6B 3X1TA 3AZHB 3X1TB 4NE5A 3REJB 3MVDD 1TAFA 1P34D 5B1MC 3WA9C 3AZIC 1AOID 5GT0C 4E45A 3AN2C 1P3MC 1F66A 4XZQB 1F66B 3MGPD 3AZFA 4XUJC 3TU4D 3MGRA 3AZKB 3AZFB 1P3GB 3RELA 1P3IA 5FUGB 1P3BB 5BT1D 3MVDA 1P34A 3AZMC 3B6FC 3MVDB 1AOIA 4H9NB 3MGPA 3X1UB 1P3KC 3TU4A 3C1CD 3AYWC 2YFVA 2FJ7B 4R8PC 3LZ0C 5DNND 3MGSC 5AVBB 4H9RA 4H9RB 1P3FC 3UT9B 1P3AD 5B0YB 1JFIB 1ID3B 1P3PC 5B40B 5DNNA 5B24B 2NQBC 4HGAC 5E5AD 5DNNB 3REKD 3NQUA 2PYOD 3LZ1C 3AZJC 4WZSB 2F8NG 4J8XC 1P3AA 4YM6C 1P3AB 4AWLB 3AZHC 3LELD 3REJC 5BNXA 1U35D 5BNXB 5E5AA 4XZQC 3REKA 2HIOD 3REKB 5CPID 3W96D 3VH6W 5BO0A 5AY8B 3AZFC 3AZKC 3AZLB 2PYOA 1P3GC 1P3BC 3LELA 1U35A 4KGCD 1U35B 3MVDC 4Z5TB 3VH6A 2HIOA 5CPIA 3AV2D 3W96A 3X1UC 3W96B 2FJ7C 4KGCA 4KGCB 5AVBC 3NQJA 3UT9C 3AV2A 3O62B 3AV2B 3V9RB 5B0YC 1ID3C 5B1LB 4J8UB 5B40C 5B24C 5C3IB 1ULYA 5DNNC 4J8WB 3B0CT 2AROD 5AV9D 3AV1D 2RVQD 5B0ZB 3LJAD 3VH5T 3UTBB 1P3AC 4AWLC 4WU9D 1M18B 2HUEB 2AROA 5AV9A 1H3OA 5B2ID 3REKC 3AV1A 3MGQD 5AY8C 3AZLC 3LJAA 1KX4D 1ZLAD 4Z66D 4WU9A 1U35C 5CP6D 4Z5TC 4J8VD 2BYKA 5BNVA 3W97D 5B2IA 2BYKB 3WAAB 3UTAD 3AZGD 3MGQA 1KX4A 3W96C 3B6GB 5AV5D 1ZLAA 2NZDB 4Z66A 3C1BC 4H9PB 3X1SB 4Z66B 3B0DB 4KGCC 5CP6A 5GT3D 5B32B 3W97A 3W97B 4JJNB 3UTAA 3AZGA 1P3LB 3AZGB 3O62C 3AV2C 4X23D 1M19C 5B1LC 5F99B 4J8UC 5GXQB 5C3IC 4J8WC 5GT3A 3MNND 2IO5B 5BS7A 3AFAD 5B0ZC 3UTBC 3AZED 5B33C 1TAFB 4KUDD 4X23A 4Z2MG 1KX3D 1M18C 1KX5D 2HUEC 3MNNA
chains in the Genus database with same CATH superfamily
3MGRB 3AFAA 3RELB 1P3IB 3AZEA 3AZEB 1P34B 2CWEA 4KUDA 1AOIB 4KUDB 1KX3A 1KX5A 3MGPB 3X1VD 1KX5B 2BYMA 3A1IA 5JRGD 3TU4B 5AV8D 3WAAC 3B6GC 2YFVB 5G49A 1TZYD 5CPKD 2NZDC 3EPLA 4QLCD 3X1SC 4Z66C 3B0DC 5DNMD 2ZY5A 5B32C 4KHAA 4LD9D 2ZY4A 5JRGA 3C1CA 5AV8A 3W97C 4JJNC 4ZUXD 3C1CB 1P3LC 3AZGC 1TZYA 5CPKA 3F6TA 1TZYB 4QLCA 5AVCD 1A7WA 5F99C 4QLCB 5DNMA 5GXQC 2LY8A 3W99D 3NQUB 2IO5C 4LD9A 4ZUXA 3X1TC 5JA4A 5AV6D 5AVCA 5E5AB 2ZY3A 1F66C 2G5IC 3W99A 1EQZD 5BO0B 5B32G 3MGRC 3KXBD 2PYOB 1W2EA 4G91B 3RELC 1P3IC 5B2JD 3LELB 2Y2LA 5AV6A 5B31D 2BG1A 3AZEC 1P34C 1F1EA 1AOIC 4KUDC 5CPJD 3MGPC 2HIOB 5CPIB 1BH9A 3TU4C 3KXBA 5B2JA 3WKJD 4H9OA 5BT1C 5B31A 3AZND 3NQJB 3REHD 5CPJA 5CPJB 1B67A 3C1CC 1B6WA 3H0RC 2DF4C 1M1AD 3WKJA 1TZYC 3REID 3AZNA 4QLCC 3REHA 3KWQD 4DRBA 1KU5A 1S32D 5KDMA 1P3OD 5KDMB 4UUZA 2G5HC 1M1AA 1BH8A 3REIA 5E5AC 3REIB 2JSSA 2AROB 5AV9B 1H3OB 4ZBJB 3AV1B 5B1MD 3AZID 1S32A 2YFWA 2PYOC 3LJAB 5GT0D 1S32B 2YFWB 4G91C 4NFTA 3AN2D 1P3MD 1P3OA 1BFMA 3R45A 3A6ND 3LELC 4WU9B 4XUJD 2F8NK 4CAYA 5GSUD 3KSYA 5BNVB 5B2IB 2HIOC 5CPIC 3AZMD 5B1MA 3B6FD 2Y2QA 3AZIA 3MGQB 1KX4B 5GT0A 3AN2A 1P3MA 1ZLAB 3AN2B 3EPKA 1Z2CB 3A6NA 2F8ND 4XUJA 1P3KD 3A6NB 4J8VA 1HQ3D 5CP6B 3AYWD 5GSUA 3WTPE 4J8VB 5GSUB 4R8PD 5CPJC 3LZ0D 4Z2MH 3MGSD 3UTAB 3AZMA 3B6FA 3AZMB 5AV5A 5AV5B 2DQNC 2F8NA 1P3KA 4WU8D 1HQ3A 3AYWA 5GT3B 1HQ3B 4R8PA 3LZ0A 3MGSA 2NQBD 4H9QA 4X23B 3VH6T 3LZ1D 1R4VA 3AZJD 3H0LC 4J8XD 4WU8A 4YM6D 4WU8B 3REIC 3MNNB 3AZHD 2AROC 5AV9C 3REJD 4ZBJC 3AV1C 4CSRA 3AFAB 2RVQC 4CSRB 3LJAC 2NQBA 1S32C 4HGAB 4XZQD 4DRAA 4WU9C 3LZ1A 3AZKD 3AZJA 1P3GD 1KX3B 4J8XA 3AZJB 4YM6A 3EPJA 2BYMB 3B0CW 2Y2HA 4YS3D 3REJA 5B2IC 3AZHA 1P3BD 3MGQC 1KX4C 5G49B 3VH5W 2XD1A 2F8NH 1ZLAC 4XZQA 3X1UD 3AZKA 3A6NC 5CP6C 1P3GA 3X1VA 4J8VC 3X1VB 5GSUC 4KHAB 5FUGA 4YS3A 1P3BA 2FJ7D 5JRGB 3VH5A 4YS3B 5AV8B 3UTAC 5AVBD 5AV5C 5CPKB 4H9NA 3UT9D 3X1UA 5DNMB 3W98D 5B0YD 5GT3C 1HQ3C 2FJ7A 1ID3D 4EO5B 4LD9B 5BS7C 5B40D 4ZUXB 5B24D 5AVBA 2CV5D 5JA4B 1N1JA 2JE5A 1N1JB 4X23C 3UT9A 5AVCB 3W98A 3W99B 4WU8C 5B0YA 2Y2KA 3MNNC 3W98B 1JFIA 4G92B 1ID3A 2F2AC 3AFAC 5B40A 5B24A 3EPHA 2CV5A 5AV6B 3A1KA 2CV5B 1WWIA 5AY8D 3AZLD 2Y2NA 1KX3C 1EQZA 1KX5C 1EQZB 1BH9B 3KXBB 4Z5TD 5B2JB 4H9OB 5B31B 3AL0C 4WJ3C 5AY8A 3AZLA 3X1VC 3C1BD 3KUYD 5JRGC 4YS3C 3WTPD 5AV8C 4Z5TA 3WKJB 5CPKC 3AZNB 4H9SA 5DNMC 4NE3A 3O62D 3REHB 3C1BA 1M19D 4LD9C 5B1LD 4EO5C 3KUYA 3WTPA 4M6BA 3C1BB 4J8UD 3KUYB 3WTPB 4UUZB 4ZUXC 4WNNA 4J8WD 4WNNB 1M1AB 1BH8B 5AVCC 5B0ZD 3UTBD 3O62A 5B33D 3KWQA 3W99C 3V9RA 3KWQB 3WA9D 3W98C 1M19A 1WWSA 4NE6A 5B1LA 4G92C 1P3OB 1M19B 4J8UA 1M18D 4J8WA 3R45B 1HTAA 5AV6C 2CV5C 2VQRA 2Y2JA 4CAYB 5B0ZA 3UTBA 5B33A 1EQZC 5B33B 3WA9A 5B1MB 3WA9B 2L5AA 3AZIB 3KXBC 5GT0B 1P3MB 1M18A 5B2JC 4XUJB 5B31C 3WAAD 3P5JB 3B6GD 3B0BA 2NZDD 3B6FB 3X1SD 1PZRA 4E44A 4UPKA 1P3FD 5B32D 2F8NB 3WKJC 1P3KB 4JJND 3AZNC 1P3LD 3AYWB 3WAAA 3B6GA 4H9SC 1P3PD 3REHC 4R8PB 2NZDA 3LZ0B 4H9PA 3X1SA 3MGSB 5F99D 3KUYC 3WTPC 5GXQD 1P3FA 1P3FB 4H9QB 5B32A 1M1AC 5CHLB 5B31G 4JJNA 1P3LA 3X1TD 1P3PA 2UWXA 3KWQC 1P3PB 1P3OC 2NQBB 5F99A 4WV4B 1T3UA 1F66D 5GXQA 1Q9CA 3AZFD 3LZ1B 3MGRD 4J8XB 3RELD 1P3ID 4YM6B 3X1TA 3AZHB 3X1TB 4NE5A 3REJB 3MVDD 1TAFA 1P34D 1KX5D 5B1MC 3WA9C 3AZIC 1AOID 5GT0C 4E45A 3AN2C 1P3MC 1F66A 4XZQB 1F66B 3MGPD 3AZFA 4XUJC 3TU4D 2ZY2A 3MGRA 3AZKB 3AZFB 1P3GB 3RELA 1P3IA 2J8PA 5FUGB 1P3BB 5BT1D 3MVDA 1P34A 3AZMC 3B6FC 3MVDB 1AOIA 4H9NB 3MGPA 3X1UB 1P3KC 3TU4A 3C1CD 3AYWC 2YFVA 2FJ7B 4R8PC 3LZ0C 5DNND 3MGSC 5AVBB 4H9RA 4H9RB 1P3FC 3UT9B 1P3AD 5B0YB 1JFIB 1ID3B 1P3PC 5B40B 5DNNA 5B24B 2NQBC 4HGAC 5E5AD 5DNNB 3FDDA 3REKD 3NQUA 2PYOD 3LZ1C 3AZJC 4WZSB 2F8NG 4J8XC 1P3AA 4YM6C 1P3AB 4AWLB 2W8SA 3AZHC 3LELD 3REJC 5BNXA 1U35D 5BNXB 5E5AA 4XZQC 3REKA 2HIOD 3REKB 5CPID 3IP4C 3W96D 3VH6W 5BO0A 5AY8B 3AZFC 3AZKC 3AZLB 2PYOA 1P3GC 2XD5A 1P3BC 3LELA 1U35A 4KGCD 1U35B 3MVDC 4Z5TB 3VH6A 3H0MC 2HIOA 5CPIA 3AV2D 3W96A 3X1UC 2Y2MA 3W96B 2FJ7C 4KGCA 2Y2PA 2ZM5A 4KGCB 2FFFB 5AVBC 3NQJA 3UT9C 3AV2A 3O62B 3AV2B 3V9RB 5B0YC 1ID3C 5B1LB 4J8UB 5B40C 5B24C 5C3IB 1ULYA 5DNNC 2Y2OA 3B0CT 2AROD 4J8WB 5AV9D 3AV1D 2RVQD 3KFUG 5B0ZB 3LJAD 3VH5T 3UTBB 1P3AC 4AWLC 4WU9D 1M18B 2HUEB 4DQYB 2AROA 5AV9A 1H3OA 5B2ID 3REKC 3AV1A 3EG5B 3MGQD 5AY8C 3AZLC 3LJAA 1KX4D 1ZLAD 4Z66D 4WU9A 1U35C 5CP6D 4Z5TC 4J8VD 2BYKA 5BNVA 3W97D 5B2IA 2BYKB 3WAAB 3UTAD 3AZGD 3MGQA 1KX4A 3W96C 3B6GB 5AV5D 1ZLAA 2NZDB 4Z66A 3C1BC 4H9PB 3X1SB 4Z66B 2Y2GA 3B0DB 4KGCC 5CP6A 5GT3D 5B32B 3W97A 2RIQA 3W97B 4JJNB 3UTAA 3AZGA 1P3LB 3AZGB 3O62C 3AV2C 4X23D 1M19C 5B1LC 5F99B 4J8UC 5GXQB 2Y2IA 5C3IC 4J8WC 5GT3A 3MNND 2IO5B 5BS7A 3AFAD 5B0ZC 3UTBC 3AZED 5B33C 1TAFB 4KUDD 4X23A 4Z2MG 1KX3D 1M18C 2JCHA 2HUEC 3MNNA
chains in the Genus database with same CATH topology
3MGRB 3AFAA 3RELB 1P3IB 3AZEA 3AZEB 1P34B 2CWEA 4KUDA 1AOIB 4KUDB 1KX3A 1KX5A 3MGPB 3X1VD 1KX5B 2BYMA 3A1IA 5JRGD 3TU4B 5AV8D 3WAAC 3B6GC 2YFVB 5G49A 1TZYD 5CPKD 2NZDC 3EPLA 4QLCD 3X1SC 4Z66C 3B0DC 5DNMD 2ZY5A 5B32C 4KHAA 4LD9D 2ZY4A 5JRGA 3C1CA 5AV8A 3W97C 4JJNC 4ZUXD 3C1CB 1P3LC 3AZGC 1TZYA 5CPKA 3F6TA 1TZYB 4QLCA 5AVCD 1A7WA 5F99C 4QLCB 5DNMA 5GXQC 2LY8A 3W99D 3NQUB 2IO5C 4LD9A 4ZUXA 3X1TC 5JA4A 5AV6D 5AVCA 5E5AB 2ZY3A 1F66C 2G5IC 3W99A 1EQZD 5BO0B 5B32G 3MGRC 3KXBD 2PYOB 1W2EA 4G91B 3RELC 1P3IC 5B2JD 3LELB 2Y2LA 5AV6A 5B31D 2BG1A 3AZEC 1P34C 1F1EA 1AOIC 4KUDC 5CPJD 3MGPC 2HIOB 5CPIB 1BH9A 3TU4C 3KXBA 5B2JA 3WKJD 4H9OA 5BT1C 5B31A 3AZND 3NQJB 3REHD 5CPJA 5CPJB 1B67A 3C1CC 1B6WA 3H0RC 2DF4C 1M1AD 3WKJA 1TZYC 3REID 3AZNA 4QLCC 3REHA 3KWQD 4DRBA 1KU5A 1S32D 5KDMA 1P3OD 5KDMB 4UUZA 2G5HC 1M1AA 1BH8A 3REIA 5E5AC 3REIB 2JSSA 2AROB 5AV9B 1H3OB 4ZBJB 3AV1B 5B1MD 3AZID 1S32A 2YFWA 2PYOC 3LJAB 5GT0D 1S32B 2YFWB 4G91C 4NFTA 3AN2D 1P3MD 1P3OA 1BFMA 3R45A 3A6ND 3LELC 4WU9B 4XUJD 2F8NK 4CAYA 5GSUD 3KSYA 5BNVB 5B2IB 2HIOC 5CPIC 3AZMD 5B1MA 3B6FD 2Y2QA 3AZIA 3MGQB 1KX4B 5GT0A 3AN2A 1P3MA 1ZLAB 3AN2B 3EPKA 1Z2CB 3A6NA 2F8ND 4XUJA 1P3KD 3A6NB 4J8VA 1HQ3D 5CP6B 3AYWD 5GSUA 3WTPE 4J8VB 5GSUB 4R8PD 5CPJC 3LZ0D 4Z2MH 3MGSD 3UTAB 3AZMA 3B6FA 3AZMB 5AV5A 5AV5B 2DQNC 2F8NA 1P3KA 4WU8D 1HQ3A 3AYWA 5GT3B 1HQ3B 4R8PA 3LZ0A 3MGSA 2NQBD 4H9QA 4X23B 3VH6T 3LZ1D 1R4VA 3AZJD 3H0LC 4J8XD 4WU8A 4YM6D 4WU8B 3REIC 3MNNB 3AZHD 2AROC 5AV9C 3REJD 4ZBJC 3AV1C 4CSRA 3AFAB 2RVQC 4CSRB 3LJAC 2NQBA 1S32C 4HGAB 4XZQD 4DRAA 4WU9C 3LZ1A 3AZKD 3AZJA 1P3GD 1KX3B 4J8XA 3AZJB 4YM6A 3EPJA 2BYMB 3B0CW 2Y2HA 4YS3D 3REJA 5B2IC 3AZHA 1P3BD 3MGQC 1KX4C 5G49B 3VH5W 2XD1A 2F8NH 1ZLAC 4XZQA 3X1UD 3AZKA 3A6NC 5CP6C 1P3GA 3X1VA 4J8VC 3X1VB 5GSUC 4KHAB 5FUGA 4YS3A 1P3BA 2FJ7D 5JRGB 3VH5A 4YS3B 5AV8B 3UTAC 5AVBD 5AV5C 5CPKB 4H9NA 3UT9D 3X1UA 5DNMB 3W98D 5B0YD 5GT3C 1HQ3C 2FJ7A 1ID3D 4EO5B 4LD9B 5BS7C 5B40D 4ZUXB 5B24D 5AVBA 2CV5D 5JA4B 1N1JA 2JE5A 1N1JB 4X23C 3UT9A 5AVCB 3W98A 3W99B 4WU8C 5B0YA 2Y2KA 3MNNC 3W98B 1JFIA 4G92B 1ID3A 2F2AC 3AFAC 5B40A 5B24A 3EPHA 2CV5A 5AV6B 3A1KA 2CV5B 1WWIA 5AY8D 3AZLD 2Y2NA 1KX3C 1EQZA 1KX5C 1EQZB 1BH9B 3KXBB 4Z5TD 5B2JB 4H9OB 5B31B 3AL0C 4WJ3C 5AY8A 3AZLA 3X1VC 3C1BD 3KUYD 5JRGC 4YS3C 3WTPD 5AV8C 4Z5TA 3WKJB 5CPKC 3AZNB 4H9SA 5DNMC 4NE3A 3O62D 3REHB 3C1BA 1M19D 4LD9C 5B1LD 4EO5C 3KUYA 3WTPA 4M6BA 3C1BB 4J8UD 3KUYB 3WTPB 4UUZB 4ZUXC 4WNNA 4J8WD 4WNNB 1M1AB 1BH8B 5AVCC 5B0ZD 3UTBD 3O62A 5B33D 3KWQA 3W99C 3V9RA 3KWQB 3WA9D 3W98C 1M19A 1WWSA 4NE6A 5B1LA 4G92C 1P3OB 1M19B 4J8UA 1M18D 4J8WA 3R45B 1HTAA 5AV6C 2CV5C 2VQRA 2Y2JA 4CAYB 5B0ZA 3UTBA 5B33A 1EQZC 5B33B 3WA9A 5B1MB 3WA9B 2L5AA 3AZIB 3KXBC 5GT0B 1P3MB 1M18A 5B2JC 4XUJB 5B31C 3WAAD 3P5JB 3B6GD 3B0BA 2NZDD 3B6FB 3X1SD 1PZRA 4E44A 4UPKA 1P3FD 5B32D 2F8NB 3WKJC 1P3KB 4JJND 3AZNC 1P3LD 3AYWB 3WAAA 3B6GA 4H9SC 1P3PD 3REHC 4R8PB 2NZDA 3LZ0B 4H9PA 3X1SA 3MGSB 5F99D 3KUYC 3WTPC 5GXQD 1P3FA 1P3FB 4H9QB 5B32A 1M1AC 5CHLB 5B31G 4JJNA 1P3LA 3X1TD 1P3PA 2UWXA 3KWQC 1P3PB 1P3OC 2NQBB 5F99A 4WV4B 1T3UA 1F66D 5GXQA 1Q9CA 3AZFD 3LZ1B 3MGRD 4J8XB 3RELD 1P3ID 4YM6B 3X1TA 3AZHB 3X1TB 4NE5A 3REJB 3MVDD 1TAFA 1P34D 1KX5D 5B1MC 3WA9C 3AZIC 1AOID 5GT0C 4E45A 3AN2C 1P3MC 1F66A 4XZQB 1F66B 3MGPD 3AZFA 4XUJC 3TU4D 2ZY2A 3MGRA 3AZKB 3AZFB 1P3GB 3RELA 1P3IA 2J8PA 5FUGB 1P3BB 5BT1D 3MVDA 1P34A 3AZMC 3B6FC 3MVDB 1AOIA 4H9NB 3MGPA 3X1UB 1P3KC 3TU4A 3C1CD 3AYWC 2YFVA 2FJ7B 4R8PC 3LZ0C 5DNND 3MGSC 5AVBB 4H9RA 4H9RB 1P3FC 3UT9B 1P3AD 5B0YB 1JFIB 1ID3B 1P3PC 5B40B 5DNNA 5B24B 2NQBC 4HGAC 5E5AD 5DNNB 3FDDA 3REKD 3NQUA 2PYOD 3LZ1C 3AZJC 4WZSB 2F8NG 4J8XC 1P3AA 4YM6C 1P3AB 4AWLB 2W8SA 3AZHC 3LELD 3REJC 5BNXA 1U35D 5BNXB 5E5AA 4XZQC 3REKA 2HIOD 3REKB 5CPID 3IP4C 3W96D 3VH6W 5BO0A 5AY8B 3AZFC 3AZKC 3AZLB 2PYOA 1P3GC 2XD5A 1P3BC 3LELA 1U35A 4KGCD 1U35B 3MVDC 4Z5TB 3VH6A 3H0MC 2HIOA 5CPIA 3AV2D 3W96A 3X1UC 2Y2MA 3W96B 2FJ7C 4KGCA 2Y2PA 2ZM5A 4KGCB 2FFFB 5AVBC 3NQJA 3UT9C 3AV2A 3O62B 3AV2B 3V9RB 5B0YC 1ID3C 5B1LB 4J8UB 5B40C 5B24C 5C3IB 1ULYA 5DNNC 2Y2OA 3B0CT 2AROD 4J8WB 5AV9D 3AV1D 2RVQD 3KFUG 5B0ZB 3LJAD 3VH5T 3UTBB 1P3AC 4AWLC 4WU9D 1M18B 2HUEB 4DQYB 2AROA 5AV9A 1H3OA 5B2ID 3REKC 3AV1A 3EG5B 3MGQD 5AY8C 3AZLC 3LJAA 1KX4D 1ZLAD 4Z66D 4WU9A 1U35C 5CP6D 4Z5TC 4J8VD 2BYKA 5BNVA 3W97D 5B2IA 2BYKB 3WAAB 3UTAD 3AZGD 3MGQA 1KX4A 3W96C 3B6GB 5AV5D 1ZLAA 2NZDB 4Z66A 3C1BC 4H9PB 3X1SB 4Z66B 2Y2GA 3B0DB 4KGCC 5CP6A 5GT3D 5B32B 3W97A 2RIQA 3W97B 4JJNB 3UTAA 3AZGA 1P3LB 3AZGB 3O62C 3AV2C 4X23D 1M19C 5B1LC 5F99B 4J8UC 5GXQB 2Y2IA 5C3IC 4J8WC 5GT3A 3MNND 2IO5B 5BS7A 3AFAD 5B0ZC 3UTBC 3AZED 5B33C 1TAFB 4KUDD 4X23A 4Z2MG 1KX3D 1M18C 2JCHA 2HUEC 3MNNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MGR B;  3AFA A;  3REL B;  1P3I B;  3AZE A;  3AZE B;  1P34 B;  2CWE A;  4KUD A;  1AOI B;  4KUD B;  1KX3 A;  1KX5 A;  3MGP B;  3X1V D;  1KX5 B;  2BYM A;  5JRG D;  3TU4 B;  5AV8 D;  3WAA C;  3B6G C;  2YFV B;  5G49 A;  1TZY D;  5CPK D;  2NZD C;  4QLC D;  3X1S C;  4Z66 C;  3B0D C;  5DNM D;  5B32 C;  4KHA A;  4LD9 D;  5JRG A;  3C1C A;  5AV8 A;  3W97 C;  4JJN C;  4ZUX D;  3C1C B;  1P3L C;  3AZG C;  1TZY A;  5CPK A;  1TZY B;  4QLC A;  5AVC D;  1A7W A;  5F99 C;  4QLC B;  5DNM A;  5GXQ C;  2LY8 A;  3W99 D;  3NQU B;  2IO5 C;  4LD9 A;  4ZUX A;  3X1T C;  5JA4 A;  5AV6 D;  5AVC A;  5E5A B;  1F66 C;  3W99 A;  1EQZ D;  5BO0 B;  5B32 G;  3MGR C;  3KXB D;  2PYO B;  4G91 B;  3REL C;  1P3I C;  5B2J D;  3LEL B;  5AV6 A;  5B31 D;  3AZE C;  1P34 C;  1F1E A;  1AOI C;  4KUD C;  5CPJ D;  3MGP C;  2HIO B;  5CPI B;  1BH9 A;  3TU4 C;  3KXB A;  5B2J A;  3WKJ D;  4H9O A;  5BT1 C;  5B31 A;  3AZN D;  3NQJ B;  3REH D;  5CPJ A;  5CPJ B;  1B67 A;  3C1C C;  1B6W A;  1M1A D;  3WKJ A;  1TZY C;  3REI D;  3AZN A;  4QLC C;  3REH A;  3KWQ D;  4DRB A;  1KU5 A;  1S32 D;  5KDM A;  1P3O D;  5KDM B;  4UUZ A;  1M1A A;  1BH8 A;  3REI A;  5E5A C;  3REI B;  2JSS A;  2ARO B;  5AV9 B;  1H3O B;  4ZBJ B;  3AV1 B;  5B1M D;  3AZI D;  1S32 A;  2YFW A;  2PYO C;  3LJA B;  5GT0 D;  1S32 B;  2YFW B;  4G91 C;  4NFT A;  3AN2 D;  1P3M D;  1P3O A;  1BFM A;  3R45 A;  3A6N D;  3LEL C;  4WU9 B;  4XUJ D;  2F8N K;  4CAY A;  5GSU D;  3KSY A;  5BNV B;  5B2I B;  2HIO C;  5CPI C;  3AZM D;  5B1M A;  3B6F D;  3AZI A;  3MGQ B;  1KX4 B;  5GT0 A;  3AN2 A;  1P3M A;  1ZLA B;  3AN2 B;  2F8N D;  3A6N A;  4XUJ A;  1P3K D;  3A6N B;  4J8V A;  1HQ3 D;  5CP6 B;  3AYW D;  5GSU A;  3WTP E;  4J8V B;  5GSU B;  4R8P D;  5CPJ C;  3LZ0 D;  4Z2M H;  3MGS D;  3UTA B;  3AZM A;  3B6F A;  3AZM B;  5AV5 A;  5AV5 B;  2F8N A;  1P3K A;  4WU8 D;  1HQ3 A;  3AYW A;  5GT3 B;  1HQ3 B;  4R8P A;  3LZ0 A;  3MGS A;  2NQB D;  4H9Q A;  4X23 B;  3VH6 T;  3LZ1 D;  1R4V A;  3AZJ D;  4J8X D;  4WU8 A;  4YM6 D;  4WU8 B;  3REI C;  3MNN B;  3AZH D;  2ARO C;  5AV9 C;  3REJ D;  4ZBJ C;  3AV1 C;  4CSR A;  3AFA B;  2RVQ C;  4CSR B;  3LJA C;  2NQB A;  1S32 C;  4HGA B;  4XZQ D;  4DRA A;  4WU9 C;  3LZ1 A;  3AZK D;  3AZJ A;  1P3G D;  1KX3 B;  4J8X A;  3AZJ B;  4YM6 A;  2BYM B;  3B0C W;  4YS3 D;  3AZH A;  3REJ A;  5B2I C;  1P3B D;  3MGQ C;  1KX4 C;  5G49 B;  3VH5 W;  2F8N H;  1ZLA C;  4XZQ A;  3X1U D;  3AZK A;  3A6N C;  5CP6 C;  1P3G A;  3X1V A;  4J8V C;  3X1V B;  5GSU C;  4KHA B;  5FUG A;  4YS3 A;  1P3B A;  2FJ7 D;  5JRG B;  3VH5 A;  4YS3 B;  5AV8 B;  3UTA C;  5AVB D;  5AV5 C;  5CPK B;  4H9N A;  3UT9 D;  3X1U A;  5DNM B;  3W98 D;  5B0Y D;  5GT3 C;  1HQ3 C;  2FJ7 A;  1ID3 D;  4EO5 B;  4LD9 B;  5BS7 C;  5B40 D;  4ZUX B;  5B24 D;  5AVB A;  2CV5 D;  5JA4 B;  1N1J A;  1N1J B;  4X23 C;  3UT9 A;  5AVC B;  3W98 A;  3W99 B;  4WU8 C;  5B0Y A;  3MNN C;  3W98 B;  1JFI A;  4G92 B;  1ID3 A;  3AFA C;  5B40 A;  5B24 A;  2CV5 A;  5AV6 B;  2CV5 B;  1WWI A;  5AY8 D;  3AZL D;  1KX3 C;  1EQZ A;  1KX5 C;  1EQZ B;  1BH9 B;  3KXB B;  4Z5T D;  5B2J B;  4H9O B;  5B31 B;  5AY8 A;  3AZL A;  3X1V C;  3C1B D;  3KUY D;  5JRG C;  4YS3 C;  3WTP D;  5AV8 C;  4Z5T A;  3WKJ B;  5CPK C;  3AZN B;  4H9S A;  5DNM C;  4NE3 A;  3O62 D;  3REH B;  3C1B A;  1M19 D;  4LD9 C;  5B1L D;  4EO5 C;  3KUY A;  3WTP A;  4M6B A;  3C1B B;  4J8U D;  3KUY B;  3WTP B;  4UUZ B;  4ZUX C;  4WNN A;  4J8W D;  4WNN B;  1M1A B;  1BH8 B;  5AVC C;  5B0Z D;  3UTB D;  3O62 A;  5B33 D;  3KWQ A;  3W99 C;  3V9R A;  3KWQ B;  3WA9 D;  3W98 C;  1M19 A;  1WWS A;  4NE6 A;  5B1L A;  4G92 C;  1P3O B;  1M19 B;  4J8U A;  1M18 D;  4J8W A;  3R45 B;  1HTA A;  5AV6 C;  2CV5 C;  4CAY B;  5B0Z A;  3UTB A;  5B33 A;  1EQZ C;  5B33 B;  3WA9 A;  5B1M B;  3WA9 B;  2L5A A;  3AZI B;  3KXB C;  5GT0 B;  1P3M B;  1M18 A;  5B2J C;  4XUJ B;  5B31 C;  3WAA D;  3B6G D;  3B0B A;  2NZD D;  3B6F B;  3X1S D;  4E44 A;  1P3F D;  5B32 D;  2F8N B;  3WKJ C;  1P3K B;  4JJN D;  3AZN C;  1P3L D;  3AYW B;  3WAA A;  3B6G A;  4H9S C;  1P3P D;  3REH C;  4R8P B;  2NZD A;  3LZ0 B;  4H9P A;  3X1S A;  3MGS B;  5F99 D;  3KUY C;  3WTP C;  5GXQ D;  1P3F A;  1P3F B;  4H9Q B;  5B32 A;  1M1A C;  5CHL B;  5B31 G;  4JJN A;  1P3L A;  3X1T D;  1P3P A;  3KWQ C;  1P3P B;  1P3O C;  2NQB B;  5F99 A;  4WV4 B;  1F66 D;  5GXQ A;  1Q9C A;  3AZF D;  3LZ1 B;  3MGR D;  4J8X B;  3REL D;  1P3I D;  4YM6 B;  3X1T A;  3AZH B;  3X1T B;  4NE5 A;  3REJ B;  3MVD D;  1TAF A;  1P34 D;  5B1M C;  3WA9 C;  3AZI C;  1AOI D;  5GT0 C;  4E45 A;  3AN2 C;  1P3M C;  1F66 A;  4XZQ B;  1F66 B;  3MGP D;  3AZF A;  4XUJ C;  3TU4 D;  3MGR A;  3AZK B;  3AZF B;  1P3G B;  3REL A;  1P3I A;  5FUG B;  1P3B B;  5BT1 D;  3MVD A;  1P34 A;  3AZM C;  3B6F C;  3MVD B;  1AOI A;  4H9N B;  3MGP A;  3X1U B;  1P3K C;  3TU4 A;  3C1C D;  3AYW C;  2YFV A;  2FJ7 B;  4R8P C;  3LZ0 C;  5DNN D;  3MGS C;  5AVB B;  4H9R A;  4H9R B;  1P3F C;  3UT9 B;  1P3A D;  5B0Y B;  1JFI B;  1ID3 B;  1P3P C;  5B40 B;  5DNN A;  5B24 B;  2NQB C;  4HGA C;  5E5A D;  5DNN B;  3REK D;  3NQU A;  2PYO D;  3LZ1 C;  3AZJ C;  4WZS B;  2F8N G;  4J8X C;  1P3A A;  4YM6 C;  1P3A B;  4AWL B;  3AZH C;  3LEL D;  3REJ C;  5BNX A;  1U35 D;  5BNX B;  5E5A A;  4XZQ C;  3REK A;  2HIO D;  3REK B;  5CPI D;  3W96 D;  3VH6 W;  5BO0 A;  5AY8 B;  3AZF C;  3AZK C;  3AZL B;  2PYO A;  1P3G C;  1P3B C;  3LEL A;  1U35 A;  4KGC D;  1U35 B;  3MVD C;  4Z5T B;  3VH6 A;  2HIO A;  5CPI A;  3AV2 D;  3W96 A;  3X1U C;  3W96 B;  2FJ7 C;  4KGC A;  4KGC B;  5AVB C;  3NQJ A;  3UT9 C;  3AV2 A;  3O62 B;  3AV2 B;  3V9R B;  5B0Y C;  1ID3 C;  5B1L B;  4J8U B;  5B40 C;  5B24 C;  5C3I B;  1ULY A;  5DNN C;  4J8W B;  3B0C T;  2ARO D;  5AV9 D;  3AV1 D;  2RVQ D;  5B0Z B;  3LJA D;  3VH5 T;  3UTB B;  1P3A C;  4AWL C;  4WU9 D;  1M18 B;  2HUE B;  2ARO A;  5AV9 A;  1H3O A;  5B2I D;  3REK C;  3AV1 A;  3MGQ D;  5AY8 C;  3AZL C;  3LJA A;  1KX4 D;  1ZLA D;  4Z66 D;  4WU9 A;  1U35 C;  5CP6 D;  4Z5T C;  4J8V D;  2BYK A;  5BNV A;  3W97 D;  5B2I A;  2BYK B;  3WAA B;  3UTA D;  3AZG D;  3MGQ A;  1KX4 A;  3W96 C;  3B6G B;  5AV5 D;  1ZLA A;  2NZD B;  4Z66 A;  3C1B C;  4H9P B;  3X1S B;  4Z66 B;  3B0D B;  4KGC C;  5CP6 A;  5GT3 D;  5B32 B;  3W97 A;  3W97 B;  4JJN B;  3UTA A;  3AZG A;  1P3L B;  3AZG B;  3O62 C;  3AV2 C;  4X23 D;  1M19 C;  5B1L C;  5F99 B;  4J8U C;  5GXQ B;  5C3I C;  4J8W C;  5GT3 A;  3MNN D;  2IO5 B;  5BS7 A;  3AFA D;  5B0Z C;  3UTB C;  3AZE D;  5B33 C;  1TAF B;  4KUD D;  4X23 A;  4Z2M G;  1KX3 D;  1M18 C;  1KX5 D;  2HUE C;  3MNN A; 
#chains in the Genus database with same CATH topology
 3MGR B;  3AFA A;  3REL B;  1P3I B;  3AZE A;  3AZE B;  1P34 B;  2CWE A;  4KUD A;  1AOI B;  4KUD B;  1KX3 A;  1KX5 A;  3MGP B;  3X1V D;  1KX5 B;  2BYM A;  3A1I A;  5JRG D;  3TU4 B;  5AV8 D;  3WAA C;  3B6G C;  2YFV B;  5G49 A;  1TZY D;  5CPK D;  2NZD C;  3EPL A;  4QLC D;  3X1S C;  4Z66 C;  3B0D C;  5DNM D;  2ZY5 A;  5B32 C;  4KHA A;  4LD9 D;  2ZY4 A;  5JRG A;  3C1C A;  5AV8 A;  3W97 C;  4JJN C;  4ZUX D;  3C1C B;  1P3L C;  3AZG C;  1TZY A;  5CPK A;  3F6T A;  1TZY B;  4QLC A;  5AVC D;  1A7W A;  5F99 C;  4QLC B;  5DNM A;  5GXQ C;  2LY8 A;  3W99 D;  3NQU B;  2IO5 C;  4LD9 A;  4ZUX A;  3X1T C;  5JA4 A;  5AV6 D;  5AVC A;  5E5A B;  2ZY3 A;  1F66 C;  2G5I C;  3W99 A;  1EQZ D;  5BO0 B;  5B32 G;  3MGR C;  3KXB D;  2PYO B;  1W2E A;  4G91 B;  3REL C;  1P3I C;  5B2J D;  3LEL B;  2Y2L A;  5AV6 A;  5B31 D;  2BG1 A;  3AZE C;  1P34 C;  1F1E A;  1AOI C;  4KUD C;  5CPJ D;  3MGP C;  2HIO B;  5CPI B;  1BH9 A;  3TU4 C;  3KXB A;  5B2J A;  3WKJ D;  4H9O A;  5BT1 C;  5B31 A;  3AZN D;  3NQJ B;  3REH D;  5CPJ A;  5CPJ B;  1B67 A;  3C1C C;  1B6W A;  3H0R C;  2DF4 C;  1M1A D;  3WKJ A;  1TZY C;  3REI D;  3AZN A;  4QLC C;  3REH A;  3KWQ D;  4DRB A;  1KU5 A;  1S32 D;  5KDM A;  1P3O D;  5KDM B;  4UUZ A;  2G5H C;  1M1A A;  1BH8 A;  3REI A;  5E5A C;  3REI B;  2JSS A;  2ARO B;  5AV9 B;  1H3O B;  4ZBJ B;  3AV1 B;  5B1M D;  3AZI D;  1S32 A;  2YFW A;  2PYO C;  3LJA B;  5GT0 D;  1S32 B;  2YFW B;  4G91 C;  4NFT A;  3AN2 D;  1P3M D;  1P3O A;  1BFM A;  3R45 A;  3A6N D;  3LEL C;  4WU9 B;  4XUJ D;  2F8N K;  4CAY A;  5GSU D;  3KSY A;  5BNV B;  5B2I B;  2HIO C;  5CPI C;  3AZM D;  5B1M A;  3B6F D;  2Y2Q A;  3AZI A;  3MGQ B;  1KX4 B;  5GT0 A;  3AN2 A;  1P3M A;  1ZLA B;  3AN2 B;  3EPK A;  1Z2C B;  3A6N A;  2F8N D;  4XUJ A;  1P3K D;  3A6N B;  4J8V A;  1HQ3 D;  5CP6 B;  3AYW D;  5GSU A;  3WTP E;  4J8V B;  5GSU B;  4R8P D;  5CPJ C;  3LZ0 D;  4Z2M H;  3MGS D;  3UTA B;  3AZM A;  3B6F A;  3AZM B;  5AV5 A;  5AV5 B;  2DQN C;  2F8N A;  1P3K A;  4WU8 D;  1HQ3 A;  3AYW A;  5GT3 B;  1HQ3 B;  4R8P A;  3LZ0 A;  3MGS A;  2NQB D;  4H9Q A;  4X23 B;  3VH6 T;  3LZ1 D;  1R4V A;  3AZJ D;  3H0L C;  4J8X D;  4WU8 A;  4YM6 D;  4WU8 B;  3REI C;  3MNN B;  3AZH D;  2ARO C;  5AV9 C;  3REJ D;  4ZBJ C;  3AV1 C;  4CSR A;  3AFA B;  2RVQ C;  4CSR B;  3LJA C;  2NQB A;  1S32 C;  4HGA B;  4XZQ D;  4DRA A;  4WU9 C;  3LZ1 A;  3AZK D;  3AZJ A;  1P3G D;  1KX3 B;  4J8X A;  3AZJ B;  4YM6 A;  3EPJ A;  2BYM B;  3B0C W;  2Y2H A;  4YS3 D;  3REJ A;  5B2I C;  3AZH A;  1P3B D;  3MGQ C;  1KX4 C;  5G49 B;  3VH5 W;  2XD1 A;  2F8N H;  1ZLA C;  4XZQ A;  3X1U D;  3AZK A;  3A6N C;  5CP6 C;  1P3G A;  3X1V A;  4J8V C;  3X1V B;  5GSU C;  4KHA B;  5FUG A;  4YS3 A;  1P3B A;  2FJ7 D;  5JRG B;  3VH5 A;  4YS3 B;  5AV8 B;  3UTA C;  5AVB D;  5AV5 C;  5CPK B;  4H9N A;  3UT9 D;  3X1U A;  5DNM B;  3W98 D;  5B0Y D;  5GT3 C;  1HQ3 C;  2FJ7 A;  1ID3 D;  4EO5 B;  4LD9 B;  5BS7 C;  5B40 D;  4ZUX B;  5B24 D;  5AVB A;  2CV5 D;  5JA4 B;  1N1J A;  2JE5 A;  1N1J B;  4X23 C;  3UT9 A;  5AVC B;  3W98 A;  3W99 B;  4WU8 C;  5B0Y A;  2Y2K A;  3MNN C;  3W98 B;  1JFI A;  4G92 B;  1ID3 A;  2F2A C;  3AFA C;  5B40 A;  5B24 A;  3EPH A;  2CV5 A;  5AV6 B;  3A1K A;  2CV5 B;  1WWI A;  5AY8 D;  3AZL D;  2Y2N A;  1KX3 C;  1EQZ A;  1KX5 C;  1EQZ B;  1BH9 B;  3KXB B;  4Z5T D;  5B2J B;  4H9O B;  5B31 B;  3AL0 C;  4WJ3 C;  5AY8 A;  3AZL A;  3X1V C;  3C1B D;  3KUY D;  5JRG C;  4YS3 C;  3WTP D;  5AV8 C;  4Z5T A;  3WKJ B;  5CPK C;  3AZN B;  4H9S A;  5DNM C;  4NE3 A;  3O62 D;  3REH B;  3C1B A;  1M19 D;  4LD9 C;  5B1L D;  4EO5 C;  3KUY A;  3WTP A;  4M6B A;  3C1B B;  4J8U D;  3KUY B;  3WTP B;  4UUZ B;  4ZUX C;  4WNN A;  4J8W D;  4WNN B;  1M1A B;  1BH8 B;  5AVC C;  5B0Z D;  3UTB D;  3O62 A;  5B33 D;  3KWQ A;  3W99 C;  3V9R A;  3KWQ B;  3WA9 D;  3W98 C;  1M19 A;  1WWS A;  4NE6 A;  5B1L A;  4G92 C;  1P3O B;  1M19 B;  4J8U A;  1M18 D;  4J8W A;  3R45 B;  1HTA A;  5AV6 C;  2CV5 C;  2VQR A;  2Y2J A;  4CAY B;  5B0Z A;  3UTB A;  5B33 A;  1EQZ C;  5B33 B;  3WA9 A;  5B1M B;  3WA9 B;  2L5A A;  3AZI B;  3KXB C;  5GT0 B;  1P3M B;  1M18 A;  5B2J C;  4XUJ B;  5B31 C;  3WAA D;  3P5J B;  3B6G D;  3B0B A;  2NZD D;  3B6F B;  3X1S D;  1PZR A;  4E44 A;  4UPK A;  1P3F D;  5B32 D;  2F8N B;  3WKJ C;  1P3K B;  4JJN D;  3AZN C;  1P3L D;  3AYW B;  3WAA A;  3B6G A;  4H9S C;  1P3P D;  3REH C;  4R8P B;  2NZD A;  3LZ0 B;  4H9P A;  3X1S A;  3MGS B;  5F99 D;  3KUY C;  3WTP C;  5GXQ D;  1P3F A;  1P3F B;  4H9Q B;  5B32 A;  1M1A C;  5CHL B;  5B31 G;  4JJN A;  1P3L A;  3X1T D;  1P3P A;  2UWX A;  3KWQ C;  1P3P B;  1P3O C;  2NQB B;  5F99 A;  4WV4 B;  1T3U A;  1F66 D;  5GXQ A;  1Q9C A;  3AZF D;  3LZ1 B;  3MGR D;  4J8X B;  3REL D;  1P3I D;  4YM6 B;  3X1T A;  3AZH B;  3X1T B;  4NE5 A;  3REJ B;  3MVD D;  1TAF A;  1P34 D;  1KX5 D;  5B1M C;  3WA9 C;  3AZI C;  1AOI D;  5GT0 C;  4E45 A;  3AN2 C;  1P3M C;  1F66 A;  4XZQ B;  1F66 B;  3MGP D;  3AZF A;  4XUJ C;  3TU4 D;  2ZY2 A;  3MGR A;  3AZK B;  3AZF B;  1P3G B;  3REL A;  1P3I A;  2J8P A;  5FUG B;  1P3B B;  5BT1 D;  3MVD A;  1P34 A;  3AZM C;  3B6F C;  3MVD B;  1AOI A;  4H9N B;  3MGP A;  3X1U B;  1P3K C;  3TU4 A;  3C1C D;  3AYW C;  2YFV A;  2FJ7 B;  4R8P C;  3LZ0 C;  5DNN D;  3MGS C;  5AVB B;  4H9R A;  4H9R B;  1P3F C;  3UT9 B;  1P3A D;  5B0Y B;  1JFI B;  1ID3 B;  1P3P C;  5B40 B;  5DNN A;  5B24 B;  2NQB C;  4HGA C;  5E5A D;  5DNN B;  3FDD A;  3REK D;  3NQU A;  2PYO D;  3LZ1 C;  3AZJ C;  4WZS B;  2F8N G;  4J8X C;  1P3A A;  4YM6 C;  1P3A B;  4AWL B;  2W8S A;  3AZH C;  3LEL D;  3REJ C;  5BNX A;  1U35 D;  5BNX B;  5E5A A;  4XZQ C;  3REK A;  2HIO D;  3REK B;  5CPI D;  3IP4 C;  3W96 D;  3VH6 W;  5BO0 A;  5AY8 B;  3AZF C;  3AZK C;  3AZL B;  2PYO A;  1P3G C;  2XD5 A;  1P3B C;  3LEL A;  1U35 A;  4KGC D;  1U35 B;  3MVD C;  4Z5T B;  3VH6 A;  3H0M C;  2HIO A;  5CPI A;  3AV2 D;  3W96 A;  3X1U C;  2Y2M A;  3W96 B;  2FJ7 C;  4KGC A;  2Y2P A;  2ZM5 A;  4KGC B;  2FFF B;  5AVB C;  3NQJ A;  3UT9 C;  3AV2 A;  3O62 B;  3AV2 B;  3V9R B;  5B0Y C;  1ID3 C;  5B1L B;  4J8U B;  5B40 C;  5B24 C;  5C3I B;  1ULY A;  5DNN C;  2Y2O A;  3B0C T;  2ARO D;  4J8W B;  5AV9 D;  3AV1 D;  2RVQ D;  3KFU G;  5B0Z B;  3LJA D;  3VH5 T;  3UTB B;  1P3A C;  4AWL C;  4WU9 D;  1M18 B;  2HUE B;  4DQY B;  2ARO A;  5AV9 A;  1H3O A;  5B2I D;  3REK C;  3AV1 A;  3EG5 B;  3MGQ D;  5AY8 C;  3AZL C;  3LJA A;  1KX4 D;  1ZLA D;  4Z66 D;  4WU9 A;  1U35 C;  5CP6 D;  4Z5T C;  4J8V D;  2BYK A;  5BNV A;  3W97 D;  5B2I A;  2BYK B;  3WAA B;  3UTA D;  3AZG D;  3MGQ A;  1KX4 A;  3W96 C;  3B6G B;  5AV5 D;  1ZLA A;  2NZD B;  4Z66 A;  3C1B C;  4H9P B;  3X1S B;  4Z66 B;  2Y2G A;  3B0D B;  4KGC C;  5CP6 A;  5GT3 D;  5B32 B;  3W97 A;  2RIQ A;  3W97 B;  4JJN B;  3UTA A;  3AZG A;  1P3L B;  3AZG B;  3O62 C;  3AV2 C;  4X23 D;  1M19 C;  5B1L C;  5F99 B;  4J8U C;  5GXQ B;  2Y2I A;  5C3I C;  4J8W C;  5GT3 A;  3MNN D;  2IO5 B;  5BS7 A;  3AFA D;  5B0Z C;  3UTB C;  3AZE D;  5B33 C;  1TAF B;  4KUD D;  4X23 A;  4Z2M G;  1KX3 D;  1M18 C;  2JCH A;  2HUE C;  3MNN A; 
#chains in the Genus database with same CATH homology
 3MGR B;  3AFA A;  3REL B;  1P3I B;  3AZE A;  3AZE B;  1P34 B;  2CWE A;  4KUD A;  1AOI B;  4KUD B;  1KX3 A;  1KX5 A;  3MGP B;  3X1V D;  1KX5 B;  2BYM A;  3A1I A;  5JRG D;  3TU4 B;  5AV8 D;  3WAA C;  3B6G C;  2YFV B;  5G49 A;  1TZY D;  5CPK D;  2NZD C;  3EPL A;  4QLC D;  3X1S C;  4Z66 C;  3B0D C;  5DNM D;  2ZY5 A;  5B32 C;  4KHA A;  4LD9 D;  2ZY4 A;  5JRG A;  3C1C A;  5AV8 A;  3W97 C;  4JJN C;  4ZUX D;  3C1C B;  1P3L C;  3AZG C;  1TZY A;  5CPK A;  3F6T A;  1TZY B;  4QLC A;  5AVC D;  1A7W A;  5F99 C;  4QLC B;  5DNM A;  5GXQ C;  2LY8 A;  3W99 D;  3NQU B;  2IO5 C;  4LD9 A;  4ZUX A;  3X1T C;  5JA4 A;  5AV6 D;  5AVC A;  5E5A B;  2ZY3 A;  1F66 C;  2G5I C;  3W99 A;  1EQZ D;  5BO0 B;  5B32 G;  3MGR C;  3KXB D;  2PYO B;  1W2E A;  4G91 B;  3REL C;  1P3I C;  5B2J D;  3LEL B;  2Y2L A;  5AV6 A;  5B31 D;  2BG1 A;  3AZE C;  1P34 C;  1F1E A;  1AOI C;  4KUD C;  5CPJ D;  3MGP C;  2HIO B;  5CPI B;  1BH9 A;  3TU4 C;  3KXB A;  5B2J A;  3WKJ D;  4H9O A;  5BT1 C;  5B31 A;  3AZN D;  3NQJ B;  3REH D;  5CPJ A;  5CPJ B;  1B67 A;  3C1C C;  1B6W A;  3H0R C;  2DF4 C;  1M1A D;  3WKJ A;  1TZY C;  3REI D;  3AZN A;  4QLC C;  3REH A;  3KWQ D;  4DRB A;  1KU5 A;  1S32 D;  5KDM A;  1P3O D;  5KDM B;  4UUZ A;  2G5H C;  1M1A A;  1BH8 A;  3REI A;  5E5A C;  3REI B;  2JSS A;  2ARO B;  5AV9 B;  1H3O B;  4ZBJ B;  3AV1 B;  5B1M D;  3AZI D;  1S32 A;  2YFW A;  2PYO C;  3LJA B;  5GT0 D;  1S32 B;  2YFW B;  4G91 C;  4NFT A;  3AN2 D;  1P3M D;  1P3O A;  1BFM A;  3R45 A;  3A6N D;  3LEL C;  4WU9 B;  4XUJ D;  2F8N K;  4CAY A;  5GSU D;  3KSY A;  5BNV B;  5B2I B;  2HIO C;  5CPI C;  3AZM D;  5B1M A;  3B6F D;  2Y2Q A;  3AZI A;  3MGQ B;  1KX4 B;  5GT0 A;  3AN2 A;  1P3M A;  1ZLA B;  3AN2 B;  3EPK A;  1Z2C B;  3A6N A;  2F8N D;  4XUJ A;  1P3K D;  3A6N B;  4J8V A;  1HQ3 D;  5CP6 B;  3AYW D;  5GSU A;  3WTP E;  4J8V B;  5GSU B;  4R8P D;  5CPJ C;  3LZ0 D;  4Z2M H;  3MGS D;  3UTA B;  3AZM A;  3B6F A;  3AZM B;  5AV5 A;  5AV5 B;  2DQN C;  2F8N A;  1P3K A;  4WU8 D;  1HQ3 A;  3AYW A;  5GT3 B;  1HQ3 B;  4R8P A;  3LZ0 A;  3MGS A;  2NQB D;  4H9Q A;  4X23 B;  3VH6 T;  3LZ1 D;  1R4V A;  3AZJ D;  3H0L C;  4J8X D;  4WU8 A;  4YM6 D;  4WU8 B;  3REI C;  3MNN B;  3AZH D;  2ARO C;  5AV9 C;  3REJ D;  4ZBJ C;  3AV1 C;  4CSR A;  3AFA B;  2RVQ C;  4CSR B;  3LJA C;  2NQB A;  1S32 C;  4HGA B;  4XZQ D;  4DRA A;  4WU9 C;  3LZ1 A;  3AZK D;  3AZJ A;  1P3G D;  1KX3 B;  4J8X A;  3AZJ B;  4YM6 A;  3EPJ A;  2BYM B;  3B0C W;  2Y2H A;  4YS3 D;  3REJ A;  5B2I C;  3AZH A;  1P3B D;  3MGQ C;  1KX4 C;  5G49 B;  3VH5 W;  2XD1 A;  2F8N H;  1ZLA C;  4XZQ A;  3X1U D;  3AZK A;  3A6N C;  5CP6 C;  1P3G A;  3X1V A;  4J8V C;  3X1V B;  5GSU C;  4KHA B;  5FUG A;  4YS3 A;  1P3B A;  2FJ7 D;  5JRG B;  3VH5 A;  4YS3 B;  5AV8 B;  3UTA C;  5AVB D;  5AV5 C;  5CPK B;  4H9N A;  3UT9 D;  3X1U A;  5DNM B;  3W98 D;  5B0Y D;  5GT3 C;  1HQ3 C;  2FJ7 A;  1ID3 D;  4EO5 B;  4LD9 B;  5BS7 C;  5B40 D;  4ZUX B;  5B24 D;  5AVB A;  2CV5 D;  5JA4 B;  1N1J A;  2JE5 A;  1N1J B;  4X23 C;  3UT9 A;  5AVC B;  3W98 A;  3W99 B;  4WU8 C;  5B0Y A;  2Y2K A;  3MNN C;  3W98 B;  1JFI A;  4G92 B;  1ID3 A;  2F2A C;  3AFA C;  5B40 A;  5B24 A;  3EPH A;  2CV5 A;  5AV6 B;  3A1K A;  2CV5 B;  1WWI A;  5AY8 D;  3AZL D;  2Y2N A;  1KX3 C;  1EQZ A;  1KX5 C;  1EQZ B;  1BH9 B;  3KXB B;  4Z5T D;  5B2J B;  4H9O B;  5B31 B;  3AL0 C;  4WJ3 C;  5AY8 A;  3AZL A;  3X1V C;  3C1B D;  3KUY D;  5JRG C;  4YS3 C;  3WTP D;  5AV8 C;  4Z5T A;  3WKJ B;  5CPK C;  3AZN B;  4H9S A;  5DNM C;  4NE3 A;  3O62 D;  3REH B;  3C1B A;  1M19 D;  4LD9 C;  5B1L D;  4EO5 C;  3KUY A;  3WTP A;  4M6B A;  3C1B B;  4J8U D;  3KUY B;  3WTP B;  4UUZ B;  4ZUX C;  4WNN A;  4J8W D;  4WNN B;  1M1A B;  1BH8 B;  5AVC C;  5B0Z D;  3UTB D;  3O62 A;  5B33 D;  3KWQ A;  3W99 C;  3V9R A;  3KWQ B;  3WA9 D;  3W98 C;  1M19 A;  1WWS A;  4NE6 A;  5B1L A;  4G92 C;  1P3O B;  1M19 B;  4J8U A;  1M18 D;  4J8W A;  3R45 B;  1HTA A;  5AV6 C;  2CV5 C;  2VQR A;  2Y2J A;  4CAY B;  5B0Z A;  3UTB A;  5B33 A;  1EQZ C;  5B33 B;  3WA9 A;  5B1M B;  3WA9 B;  2L5A A;  3AZI B;  3KXB C;  5GT0 B;  1P3M B;  1M18 A;  5B2J C;  4XUJ B;  5B31 C;  3WAA D;  3P5J B;  3B6G D;  3B0B A;  2NZD D;  3B6F B;  3X1S D;  1PZR A;  4E44 A;  4UPK A;  1P3F D;  5B32 D;  2F8N B;  3WKJ C;  1P3K B;  4JJN D;  3AZN C;  1P3L D;  3AYW B;  3WAA A;  3B6G A;  4H9S C;  1P3P D;  3REH C;  4R8P B;  2NZD A;  3LZ0 B;  4H9P A;  3X1S A;  3MGS B;  5F99 D;  3KUY C;  3WTP C;  5GXQ D;  1P3F A;  1P3F B;  4H9Q B;  5B32 A;  1M1A C;  5CHL B;  5B31 G;  4JJN A;  1P3L A;  3X1T D;  1P3P A;  2UWX A;  3KWQ C;  1P3P B;  1P3O C;  2NQB B;  5F99 A;  4WV4 B;  1T3U A;  1F66 D;  5GXQ A;  1Q9C A;  3AZF D;  3LZ1 B;  3MGR D;  4J8X B;  3REL D;  1P3I D;  4YM6 B;  3X1T A;  3AZH B;  3X1T B;  4NE5 A;  3REJ B;  3MVD D;  1TAF A;  1P34 D;  1KX5 D;  5B1M C;  3WA9 C;  3AZI C;  1AOI D;  5GT0 C;  4E45 A;  3AN2 C;  1P3M C;  1F66 A;  4XZQ B;  1F66 B;  3MGP D;  3AZF A;  4XUJ C;  3TU4 D;  2ZY2 A;  3MGR A;  3AZK B;  3AZF B;  1P3G B;  3REL A;  1P3I A;  2J8P A;  5FUG B;  1P3B B;  5BT1 D;  3MVD A;  1P34 A;  3AZM C;  3B6F C;  3MVD B;  1AOI A;  4H9N B;  3MGP A;  3X1U B;  1P3K C;  3TU4 A;  3C1C D;  3AYW C;  2YFV A;  2FJ7 B;  4R8P C;  3LZ0 C;  5DNN D;  3MGS C;  5AVB B;  4H9R A;  4H9R B;  1P3F C;  3UT9 B;  1P3A D;  5B0Y B;  1JFI B;  1ID3 B;  1P3P C;  5B40 B;  5DNN A;  5B24 B;  2NQB C;  4HGA C;  5E5A D;  5DNN B;  3FDD A;  3REK D;  3NQU A;  2PYO D;  3LZ1 C;  3AZJ C;  4WZS B;  2F8N G;  4J8X C;  1P3A A;  4YM6 C;  1P3A B;  4AWL B;  2W8S A;  3AZH C;  3LEL D;  3REJ C;  5BNX A;  1U35 D;  5BNX B;  5E5A A;  4XZQ C;  3REK A;  2HIO D;  3REK B;  5CPI D;  3IP4 C;  3W96 D;  3VH6 W;  5BO0 A;  5AY8 B;  3AZF C;  3AZK C;  3AZL B;  2PYO A;  1P3G C;  2XD5 A;  1P3B C;  3LEL A;  1U35 A;  4KGC D;  1U35 B;  3MVD C;  4Z5T B;  3VH6 A;  3H0M C;  2HIO A;  5CPI A;  3AV2 D;  3W96 A;  3X1U C;  2Y2M A;  3W96 B;  2FJ7 C;  4KGC A;  2Y2P A;  2ZM5 A;  4KGC B;  2FFF B;  5AVB C;  3NQJ A;  3UT9 C;  3AV2 A;  3O62 B;  3AV2 B;  3V9R B;  5B0Y C;  1ID3 C;  5B1L B;  4J8U B;  5B40 C;  5B24 C;  5C3I B;  1ULY A;  5DNN C;  2Y2O A;  3B0C T;  2ARO D;  4J8W B;  5AV9 D;  3AV1 D;  2RVQ D;  3KFU G;  5B0Z B;  3LJA D;  3VH5 T;  3UTB B;  1P3A C;  4AWL C;  4WU9 D;  1M18 B;  2HUE B;  4DQY B;  2ARO A;  5AV9 A;  1H3O A;  5B2I D;  3REK C;  3AV1 A;  3EG5 B;  3MGQ D;  5AY8 C;  3AZL C;  3LJA A;  1KX4 D;  1ZLA D;  4Z66 D;  4WU9 A;  1U35 C;  5CP6 D;  4Z5T C;  4J8V D;  2BYK A;  5BNV A;  3W97 D;  5B2I A;  2BYK B;  3WAA B;  3UTA D;  3AZG D;  3MGQ A;  1KX4 A;  3W96 C;  3B6G B;  5AV5 D;  1ZLA A;  2NZD B;  4Z66 A;  3C1B C;  4H9P B;  3X1S B;  4Z66 B;  2Y2G A;  3B0D B;  4KGC C;  5CP6 A;  5GT3 D;  5B32 B;  3W97 A;  2RIQ A;  3W97 B;  4JJN B;  3UTA A;  3AZG A;  1P3L B;  3AZG B;  3O62 C;  3AV2 C;  4X23 D;  1M19 C;  5B1L C;  5F99 B;  4J8U C;  5GXQ B;  2Y2I A;  5C3I C;  4J8W C;  5GT3 A;  3MNN D;  2IO5 B;  5BS7 A;  3AFA D;  5B0Z C;  3UTB C;  3AZE D;  5B33 C;  1TAF B;  4KUD D;  4X23 A;  4Z2M G;  1KX3 D;  1M18 C;  2JCH A;  2HUE C;  3MNN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...