5JRGB

Crystal structure of the nucleosome containing the dna with tetrahydrofuran (thf)
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
78
structure length
78
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords Histone H3.1
publication title Polymorphism of apyrimidinic DNA structures in the nucleosome
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2016-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5jrgB00
3MGPD 3TU4A 3REHA 4YM6A 1P3MC 5B2IA 1KX3B 5DNMC 1Q9CA 5JA4A 3AZHB 3RELB 3AYWC 5CPIB 5AV5B 4J8XC 1P3MD 4H9RA 3AZLA 5AY8C 3AZKA 5DNMD 3W96B 3B0CW 3LZ0C 4HGAB 1KX4B 3X1SC 1HTAA 3AYWD 3X1TB 4WU9A 5AV9B 3WTPB 5CPKD 3AV2B 3UT9C 5AY8D 3X1SD 5CP6A 3C1BA 4LD9A 3W97C 4ZUXA 5G49B 3NQJB 3LJAC 1H3OB 5BNVB 3VH5W 4X23B 3UT9D 3KXBA 3TU4C 5E5AC 3REHC 1P3LA 4YM6C 5B2IC 5B1MA 3KWQC 3UTBB 1ID3A 3W97D 5BNXA 4Z5TB 2HIOB 3VH5A 3LJAD 3AZMC 2BYKA 3TU4D 3REHD 4CAYA 5FUGA 4YM6D 5AVCB 5B2ID 4WZSB 1ZLAB 4CSRA 4R8PA 3R45B 1KX5B 3AZMD 5B2JB 3MGQB 1WWIA 3REIB 5GXQB 3B6FB 5CPJA 3AZKD 3MNNB 2AROA 1P3IA 3UTAC 3C1BC 4LD9C 1P3GC 4KUDA 4ZUXC 2L5AA 4KGCB 5C3IB 4WU9D 4J8UC 2NZDC 4H9NA 2PYOA 3UTAD 5B1MC 3C1BD 4LD9D 3WKJC 3KUYC 4G92B 4ZUXD 1ID3C 5B31A 4J8UD 2NZDD 3W99C 4WU8C 5B1MD 4R8PC 3KUYD 1ID3D 1P3OA 3AFAC 3W99D 1HQ3C 4DRAA 2YFWA 1EQZB 1S32A 4WU8D 4NE6A 4R8PD 2AROC 4WV4B 5B33C 5JRGC 4KUDC 3LELA 1R4VA 5CPJD 2FJ7A 2AROD 5GSUA 5B33D 4M6BA 1F66C 5JRGD 1B6WA 4KUDD 5B1LC 3AV1C 3C1CC 3AZGB 1P3PA 3AZIB 3WA9C 1F66D 3WTPE 1P3OC 1P34C 4JJNA 1AOIA 3AV1D 3C1CD 3WA9D 1TZYA 5AV6B 1P3OD 1P34D 1BFMA 4H9SC 3VH6T 3MGRC 1S32D 4NE5A 5AV8A 3X1UA 3LZ1C 4J8VB 2NQBC 2FJ7C 1BH8B 4XUJB 3W98C 4Z66A 3AN2B 2BYMA 5GT0A 3MGRD 2NQBD 3LZ1D 1KX3A 4E44A 2FJ7D 2JSSA 4YS3B 3A6NC 3AZHA 3REKB 3RELA 3B6GB 3AZJC 3AZFB 5CPIA 1P3FB 4EO5B 5AVBB 4ZBJC 1U35C 5B0YB 1M19B 1P3PD 4G91C 3MGSC 3AZJD 3X1TA 2YFVB 5AV9A 1U35D 5KDMB 3WTPA 3AV2A 3MGSD 3O62A 4XZQA 5AV8C 3X1UC 4J8WC 1P3KB 4Z66C 1P3BB 5BNVA 5GT0C 5AV8D 3X1UD 4J8WD 4H9PB 1P3AA 5CPKC 3MGPB 4Z5TA 2HIOA 4Z66D 3MVDB 2IO5B 5GT0D 1KX3D 5GT3C 1KX5A 2HUEC 4Z2MH 3AZHD 3RELD 1P3MB 1JFIA 5B24A 5B31G 5DNMB 3REIA 1A7WA 3B6FA 3B0DC 4AWLC 5GT3D 3MNNA 1M18C 3AYWB 3O62C 5DNNA 4XZQC 2CV5C 4J8XB 1BH9B 5AY8B 3WTPD 3LZ0B 3X1SB 4KHAB 1M18D 2F8NB 3O62D 2CV5D 4XZQD 1P3AC 5BO0A 3UT9B 5F99A 3AZLC 3AZKC 3W97B 3LJAB 2F8NK 4WU9C 1N1JB 1P3AD 2HIOD 5E5AB 3REHB 3TU4B 4YM6B 3AZLD 5B2IB 3KWQB 5B24C 5CP6C 1EQZA 3AZMB 5DNNC 3NQUB 1KX5D 3KXBC 1P3LC 5B24D 5CP6D 3REID 4WNNB 4NFTA 3B6FD 4QLCA 5BT1C 5DNND 3KXBD 4NE3A 1P3LD 5F99C 3UTAB 3C1BB 3AZGA 4LD9B 1P3GB 5BT1D 4ZUXB 4UUZB 5B32A 4J8UB 2NZDB 5F99D 5CPJC 5B1MB 1P3IC 3WKJB 3KUYB 1ID3B 3AZNA 1B67A 3W99B 4WU8B 2PYOC 1P3ID 1TAFB 4R8PB 4QLCC 4J8VA 3AFAB 5B31C 1HQ3B 4XUJA 3WAAA 5B40A 2PYOD 3AN2A 2AROB 5B33B 5B0ZB 4Z2MG 4QLCD 5JRGB 4KUDB 5B31D 3AZEA 1M1AA 4YS3A 2RVQC 5B32C 3B6GA 1S32C 1P3FA 3REJA 5B0YA 1F66B 1ULYA 5B1LB 3AZNC 3LELC 2RVQD 5B32D 3AV1B 3X1VA 3C1CB 3WA9B 5KDMA 5GSUC 5CHLB 3AZND 1P34B 1P3OB 3LELD 1P3KA 4H9OB 3WAAC 1P3PC 5B40C 5GSUD 4JJNC 1AOIC 4H9PA 5AV5A 3AZEC 1M1AC 3WAAD 3MGRB 2NQBB 5B40D 3MVDA 3W96A 3LZ1B 1TZYC 3AN2D 1KX4A 2FJ7B 3REJC 4JJND 1AOID 3W98B 3AZED 1M1AD 3B6GD 3X1VC 1TZYD 5DNMA 3REJD 3A6NB 5G49A 3NQJA 3AZJB 1H3OA 3VH5T 4ZBJB 4X23A 4J8XA 3X1VD 1U35B 3B0BA 1BH9A 4G91B 5AY8A 3UTBA 3MGSB 1KX3C 3LZ0A 3X1SA 2F8NA 5BS7A 3AZHC 3RELC 5CPIC 5AV5C 3UT9A 1P3KD 1ZLAA 5AVCA 3VH6W 5AV8B 3R45A 3W96C 3X1UB 4J8WB 2IO5C 4HGAC 3W97A 1KX4C 5B2JA 3MGQA 3X1TC 4Z66B 5CPID 5AV5D 1N1JA 3VH6A 5AV9C 2BYMB 5GXQA 3WTPC 5GT0B 5E5AA 3AV2C 3MVDD 3KWQA 3W96D 1KX4D 5CPKB 3X1TD 3AZMA 4KGCA 2CWEA 5AV9D 5B32G 3NQUA 4X23C 3AV2D 4H9QB 2F8NH 5GT3B 3UTBC 4WNNA 2HUEB 3V9RB 4Z5TC 2HIOC 4E45A 5BS7C 4X23D 4J8XD 3B0DB 5AVCC 4AWLB 3UTBD 1M18B 1ZLAC 1KU5A 3O62B 4XZQB 3LZ0D 3UTAA 2CV5B 1P3GA 2F8ND 4Z5TD 1KX5C 4UUZA 5B2JC 3MGQC 4J8UA 2NZDA 3REIC 5GXQC 5JA4B 5AVCD 1ZLAD 3KSYA 3B6FC 3MNNC 3WKJA 3KUYA 1P3AB 5B2JD 4H9RB 3MGQD 3AZLB 3AZKB 5C3IC 3W99A 4KGCC 5GXQD 5E5AD 4WU8A 3MNND 3KWQD 1TAFA 4WU9B 4G92C 3AFAA 1JFIB 4KGCD 1HQ3A 5B24B 5CP6B 3AZIA 5B33A 5DNNB 5B0ZA 5JRGA 3KXBB 1P3LB 1EQZC 5BNXB 2BYKB 5AV6A 1F66A 1P3GD 5B1LA 4CAYB 2LY8A 5FUGB 5BO0B 3AV1A 5F99B 4CSRB 3C1CA 1EQZD 3WA9A 1WWSA 4DRBA 3WKJD 1BH8A 1P34A 5CPJB 1P3IB 3AZGC 4H9OA 3AZIC 3REKA 5B0ZC 3AZFA 4H9NB 3AFAD 2PYOB 5AVBA 1HQ3D 1M19A 4H9SA 3AZGD 3MGRA 2NQBA 3AZID 4QLCB 3LZ1A 5B31B 5AV6C 5B0ZD 3W98A 2F8NG 2YFVA 4J8VC 5AV6D 5B32B 3A6NA 4XUJC 2YFWB 5B1LD 3AZJA 1P3BA 1S32B 3AN2C 1U35A 4J8VD 3AZNB 3MGSA 3LELB 4YS3C 3MGPA 4XUJD 3B6GC 3REKC 3AZFC 3B0CT 1P3FC 5AVBC 4EO5C 5GSUB 5B0YC 1M19C 4J8WA 4YS3D 3REKD 1P3MA 3AZFD 3WAAB 1P3FD 1P3PB 5B40B 5AVBD 5B0YD 1M19D 4JJNB 3AYWA 1AOIB 3AZEB 1M1AB 5CPKA 3W98D 1P3KC 1P3BC 1TZYB 4KHAA 3REJB 4H9QA 5GT3A 3A6ND 3MGPC 3V9RA 3X1VB 1F1EA 1P3BD 3MVDC 1M18A 3LJAA 2CV5A
chains in the Genus database with same CATH superfamily
3MGPD 3TU4A 3REHA 4YM6A 1P3MC 5B2IA 1KX3B 5DNMC 1Q9CA 5JA4A 3AZHB 3RELB 3AYWC 5CPIB 5AV5B 4J8XC 1P3MD 4H9RA 3AZLA 4WJ3C 5AY8C 1W2EA 5DNMD 3AZKA 3B0CW 3W96B 3LZ0C 4HGAB 1KX4B 3X1SC 1HTAA 3AYWD 3X1TB 4WU9A 5AV9B 3WTPB 5CPKD 3AV2B 3UT9C 5AY8D 3X1SD 5CP6A 3C1BA 4LD9A 3W97C 2G5IC 4ZUXA 3EPJA 5G49B 3NQJB 3LJAC 1H3OB 5BNVB 3VH5W 4X23B 3UT9D 3KXBA 3TU4C 5E5AC 3REHC 1P3LA 2JE5A 4YM6C 5B2IC 5B1MA 3KWQC 3UTBB 1ID3A 3W97D 5BNXA 4Z5TB 2HIOB 3VH5A 3LJAD 3AZMC 2BYKA 4DQYB 3TU4D 3REHD 4CAYA 5FUGA 4YM6D 5AVCB 5B2ID 4WZSB 1ZLAB 4CSRA 4R8PA 3R45B 1KX5B 3AZMD 5B2JB 3MGQB 3AL0C 1WWIA 3REIB 5GXQB 3B6FB 5CPJA 3AZKD 3MNNB 2AROA 1P3IA 3UTAC 3C1BC 4LD9C 1P3GC 4KUDA 4ZUXC 2L5AA 4KGCB 5C3IB 4WU9D 4J8UC 2NZDC 4H9NA 2PYOA 3UTAD 5B1MC 3C1BD 4LD9D 3WKJC 3KUYC 4G92B 4ZUXD 1ID3C 5B31A 4J8UD 2NZDD 3W99C 4WU8C 5B1MD 4R8PC 3KUYD 1ID3D 1P3OA 3KFUG 3AFAC 3W99D 1HQ3C 4DRAA 2YFWA 1EQZB 1S32A 4WU8D 4NE6A 4R8PD 2AROC 4WV4B 5B33C 5JRGC 4KUDC 3LELA 2Y2JA 1R4VA 5CPJD 2FJ7A 2AROD 5GSUA 5B33D 4M6BA 1F66C 5JRGD 1B6WA 2RIQA 4KUDD 5B1LC 3AV1C 3C1CC 3AZGB 1P3PA 3AZIB 2UWXA 3WA9C 1F66D 2DF4C 3WTPE 1P3OC 1P34C 4JJNA 1AOIA 1PZRA 3AV1D 3C1CD 3WA9D 1TZYA 5AV6B 1P3OD 1P34D 2BG1A 1BFMA 4H9SC 3VH6T 3MGRC 1S32D 4NE5A 5AV8A 3X1UA 3LZ1C 4J8VB 2NQBC 2FJ7C 1BH8B 4XUJB 3W98C 3IP4C 4Z66A 3AN2B 2BYMA 5GT0A 2JCHA 3MGRD 2NQBD 3LZ1D 1KX3A 4E44A 2FJ7D 2JSSA 4YS3B 3A6NC 3AZHA 3REKB 3RELA 3B6GB 3AZJC 3AZFB 5CPIA 1P3FB 4EO5B 5AVBB 3A1KA 4ZBJC 1U35C 5B0YB 1M19B 1P3PD 3H0MC 4G91C 3MGSC 3AZJD 3X1TA 2YFVB 5AV9A 1U35D 5KDMB 3WTPA 3AV2A 3MGSD 3O62A 4XZQA 5AV8C 3X1UC 4J8WC 1P3KB 4Z66C 1P3BB 5BNVA 5GT0C 2Y2NA 5AV8D 3X1UD 4J8WD 2ZY3A 4H9PB 1P3AA 2ZY5A 5CPKC 3MGPB 4Z5TA 2HIOA 4Z66D 3A1IA 3MVDB 2Y2LA 2IO5B 5GT0D 2Y2IA 1KX3D 5GT3C 1KX5A 2HUEC 4Z2MH 3AZHD 3RELD 1P3MB 1JFIA 5B24A 5B31G 5DNMB 3REIA 1A7WA 2FFFB 3B6FA 3B0DC 4AWLC 5GT3D 3MNNA 1M18C 3AYWB 3O62C 5DNNA 4XZQC 2CV5C 4J8XB 1BH9B 5AY8B 3WTPD 3LZ0B 3X1SB 4KHAB 1M18D 2F8NB 3O62D 2CV5D 4XZQD 3EPLA 1P3AC 5BO0A 3UT9B 5F99A 2ZM5A 3AZLC 3AZKC 3W97B 3LJAB 2F8NK 4WU9C 1N1JB 1P3AD 2HIOD 5E5AB 3REHB 3TU4B 4YM6B 3AZLD 5B2IB 3KWQB 5B24C 5CP6C 1EQZA 3AZMB 5DNNC 3NQUB 1KX5D 3KXBC 1P3LC 5B24D 5CP6D 3REID 4WNNB 4NFTA 3B6FD 4QLCA 5BT1C 2W8SA 5DNND 3KXBD 4NE3A 1P3LD 5F99C 3UTAB 3FDDA 3C1BB 3AZGA 1P3GB 5BT1D 4LD9B 2Y2OA 4ZUXB 2J8PA 4UUZB 5B32A 4J8UB 2NZDB 5F99D 5CPJC 5B1MB 1P3IC 3WKJB 3KUYB 1ID3B 3AZNA 2ZY4A 1B67A 3W99B 2Y2MA 4WU8B 2PYOC 1P3ID 1TAFB 4R8PB 4QLCC 4J8VA 3AFAB 2F2AC 5B31C 1HQ3B 4XUJA 3WAAA 5B40A 2PYOD 3AN2A 2AROB 5B33B 5B0ZB 4Z2MG 4QLCD 5JRGB 4KUDB 5B31D 3AZEA 1M1AA 4YS3A 2RVQC 5B32C 3B6GA 1S32C 1P3FA 3REJA 5B0YA 1F66B 1ULYA 5B1LB 3AZNC 3LELC 2RVQD 5B32D 3AV1B 2Y2KA 3X1VA 3C1CB 3WA9B 5KDMA 5GSUC 5CHLB 3AZND 1P34B 1P3OB 3LELD 2Y2PA 1P3KA 4H9OB 3WAAC 1P3PC 5B40C 5GSUD 4JJNC 1AOIC 4H9PA 5AV5A 3AZEC 1M1AC 3WAAD 3MGRB 2NQBB 5B40D 3MVDA 3W96A 3LZ1B 1TZYC 3AN2D 1KX4A 2FJ7B 3REJC 4JJND 1AOID 3W98B 3AZED 2Y2QA 1M1AD 3B6GD 3X1VC 1TZYD 5DNMA 3REJD 3A6NB 5G49A 3NQJA 3AZJB 1H3OA 3VH5T 4ZBJB 4X23A 4J8XA 3X1VD 1U35B 3B0BA 1BH9A 4G91B 5AY8A 3UTBA 3MGSB 1KX3C 3LZ0A 3X1SA 2F8NA 5BS7A 3AZHC 3RELC 5CPIC 5AV5C 3UT9A 1P3KD 1ZLAA 5AVCA 3VH6W 3F6TA 5AV8B 3R45A 3W96C 3X1UB 4J8WB 2IO5C 4HGAC 3W97A 1KX4C 5B2JA 3MGQA 3X1TC 4Z66B 5CPID 5AV5D 1N1JA 3VH6A 5AV9C 2BYMB 2ZY2A 5GXQA 3WTPC 5GT0B 5E5AA 3AV2C 3MVDD 3KWQA 3W96D 2XD5A 1KX4D 2Y2HA 5CPKB 3X1TD 3AZMA 3EPKA 4KGCA 2CWEA 5AV9D 5B32G 3NQUA 4X23C 3AV2D 4H9QB 2F8NH 5GT3B 3UTBC 4WNNA 3H0LC 2HUEB 3V9RB 4Z5TC 2HIOC 4E45A 5BS7C 4X23D 4J8XD 3B0DB 5AVCC 4AWLB 3UTBD 1M18B 1ZLAC 1KU5A 3O62B 4XZQB 3LZ0D 3UTAA 2CV5B 1P3GA 2F8ND 4Z5TD 1KX5C 4UUZA 5B2JC 3MGQC 4J8UA 2NZDA 3REIC 5GXQC 5JA4B 5AVCD 1ZLAD 3KSYA 3B6FC 3MNNC 3P5JB 3WKJA 3KUYA 1P3AB 5B2JD 4H9RB 3MGQD 3AZLB 3AZKB 5C3IC 3W99A 4KGCC 5GXQD 5E5AD 4WU8A 3MNND 3KWQD 1TAFA 4WU9B 4G92C 3AFAA 1JFIB 4KGCD 1HQ3A 5B24B 5CP6B 3AZIA 2Y2GA 5B33A 5DNNB 5B0ZA 5JRGA 2VQRA 2XD1A 3KXBB 1P3LB 1EQZC 5BNXB 1Z2CB 2BYKB 5AV6A 1F66A 1P3GD 5B1LA 4CAYB 2LY8A 5FUGB 5BO0B 3AV1A 5F99B 4CSRB 3C1CA 1EQZD 3WA9A 1WWSA 4DRBA 3WKJD 1BH8A 1P34A 5CPJB 1P3IB 4UPKA 3AZGC 4H9OA 3AZIC 3REKA 5B0ZC 3AZFA 4H9NB 3AFAD 2PYOB 5AVBA 1HQ3D 1M19A 4H9SA 3AZGD 3MGRA 2NQBA 3AZID 4QLCB 3LZ1A 5B31B 5AV6C 5B0ZD 3W98A 2F8NG 2YFVA 4J8VC 5AV6D 5B32B 3A6NA 4XUJC 2DQNC 2YFWB 5B1LD 3AZJA 1S32B 1P3BA 3AN2C 1U35A 4J8VD 3AZNB 3MGSA 3LELB 4YS3C 3MGPA 4XUJD 3B6GC 3REKC 3AZFC 3B0CT 1P3FC 5AVBC 4EO5C 5GSUB 5B0YC 1M19C 4J8WA 4YS3D 3REKD 1P3MA 3AZFD 3WAAB 1P3FD 1P3PB 5B40B 5AVBD 5B0YD 1M19D 4JJNB 3AYWA 1AOIB 3H0RC 3AZEB 1M1AB 5CPKA 3W98D 1P3KC 1P3BC 1TZYB 3EG5B 4KHAA 3REJB 4H9QA 5GT3A 2G5HC 3A6ND 3MGPC 3V9RA 3X1VB 1F1EA 1P3BD 3EPHA 3MVDC 1M18A 3LJAA 2CV5A 1T3UA
chains in the Genus database with same CATH topology
3MGPD 3TU4A 3REHA 4YM6A 1P3MC 5B2IA 1KX3B 5DNMC 1Q9CA 5JA4A 3AZHB 3RELB 3AYWC 5CPIB 5AV5B 4J8XC 1P3MD 4H9RA 3AZLA 4WJ3C 5AY8C 1W2EA 5DNMD 3AZKA 3B0CW 3W96B 3LZ0C 4HGAB 1KX4B 3X1SC 1HTAA 3AYWD 3X1TB 4WU9A 5AV9B 3WTPB 5CPKD 3AV2B 3UT9C 5AY8D 3X1SD 5CP6A 3C1BA 4LD9A 3W97C 2G5IC 4ZUXA 3EPJA 5G49B 3NQJB 3LJAC 1H3OB 5BNVB 3VH5W 4X23B 3UT9D 3KXBA 3TU4C 5E5AC 3REHC 1P3LA 2JE5A 4YM6C 5B2IC 5B1MA 3KWQC 3UTBB 1ID3A 3W97D 5BNXA 4Z5TB 2HIOB 3VH5A 3LJAD 3AZMC 2BYKA 4DQYB 3TU4D 3REHD 4CAYA 5FUGA 4YM6D 5AVCB 5B2ID 4WZSB 1ZLAB 4CSRA 4R8PA 3R45B 1KX5B 3AZMD 5B2JB 3MGQB 3AL0C 1WWIA 3REIB 5GXQB 3B6FB 5CPJA 3AZKD 3MNNB 2AROA 1P3IA 3UTAC 3C1BC 4LD9C 1P3GC 4KUDA 4ZUXC 2L5AA 4KGCB 5C3IB 4WU9D 4J8UC 2NZDC 4H9NA 2PYOA 3UTAD 5B1MC 3C1BD 4LD9D 3WKJC 3KUYC 4G92B 4ZUXD 1ID3C 5B31A 4J8UD 2NZDD 3W99C 4WU8C 5B1MD 4R8PC 3KUYD 1ID3D 1P3OA 3KFUG 3AFAC 3W99D 1HQ3C 4DRAA 2YFWA 1EQZB 1S32A 4WU8D 4NE6A 4R8PD 2AROC 4WV4B 5B33C 5JRGC 4KUDC 3LELA 2Y2JA 1R4VA 5CPJD 2FJ7A 2AROD 5GSUA 5B33D 4M6BA 1F66C 5JRGD 1B6WA 2RIQA 4KUDD 5B1LC 3AV1C 3C1CC 3AZGB 1P3PA 3AZIB 2UWXA 3WA9C 1F66D 2DF4C 3WTPE 1P3OC 1P34C 4JJNA 1AOIA 1PZRA 3AV1D 3C1CD 3WA9D 1TZYA 5AV6B 1P3OD 1P34D 2BG1A 1BFMA 4H9SC 3VH6T 3MGRC 1S32D 4NE5A 5AV8A 3X1UA 3LZ1C 4J8VB 2NQBC 2FJ7C 1BH8B 4XUJB 3W98C 3IP4C 4Z66A 3AN2B 2BYMA 5GT0A 2JCHA 3MGRD 2NQBD 3LZ1D 1KX3A 4E44A 2FJ7D 2JSSA 4YS3B 3A6NC 3AZHA 3REKB 3RELA 3B6GB 3AZJC 3AZFB 5CPIA 1P3FB 4EO5B 5AVBB 3A1KA 4ZBJC 1U35C 5B0YB 1M19B 1P3PD 3H0MC 4G91C 3MGSC 3AZJD 3X1TA 2YFVB 5AV9A 1U35D 5KDMB 3WTPA 3AV2A 3MGSD 3O62A 4XZQA 5AV8C 3X1UC 4J8WC 1P3KB 4Z66C 1P3BB 5BNVA 5GT0C 2Y2NA 5AV8D 3X1UD 4J8WD 2ZY3A 4H9PB 1P3AA 2ZY5A 5CPKC 3MGPB 4Z5TA 2HIOA 4Z66D 3A1IA 3MVDB 2Y2LA 2IO5B 5GT0D 2Y2IA 1KX3D 5GT3C 1KX5A 2HUEC 4Z2MH 3AZHD 3RELD 1P3MB 1JFIA 5B24A 5B31G 5DNMB 3REIA 1A7WA 2FFFB 3B6FA 3B0DC 4AWLC 5GT3D 3MNNA 1M18C 3AYWB 3O62C 5DNNA 4XZQC 2CV5C 4J8XB 1BH9B 5AY8B 3WTPD 3LZ0B 3X1SB 4KHAB 1M18D 2F8NB 3O62D 2CV5D 4XZQD 3EPLA 1P3AC 5BO0A 3UT9B 5F99A 2ZM5A 3AZLC 3AZKC 3W97B 3LJAB 2F8NK 4WU9C 1N1JB 1P3AD 2HIOD 5E5AB 3REHB 3TU4B 4YM6B 3AZLD 5B2IB 3KWQB 5B24C 5CP6C 1EQZA 3AZMB 5DNNC 3NQUB 1KX5D 3KXBC 1P3LC 5B24D 5CP6D 3REID 4WNNB 4NFTA 3B6FD 4QLCA 5BT1C 2W8SA 5DNND 3KXBD 4NE3A 1P3LD 5F99C 3UTAB 3FDDA 3C1BB 3AZGA 1P3GB 5BT1D 4LD9B 2Y2OA 4ZUXB 2J8PA 4UUZB 5B32A 4J8UB 2NZDB 5F99D 5CPJC 5B1MB 1P3IC 3WKJB 3KUYB 1ID3B 3AZNA 2ZY4A 1B67A 3W99B 2Y2MA 4WU8B 2PYOC 1P3ID 1TAFB 4R8PB 4QLCC 4J8VA 3AFAB 2F2AC 5B31C 1HQ3B 4XUJA 3WAAA 5B40A 2PYOD 3AN2A 2AROB 5B33B 5B0ZB 4Z2MG 4QLCD 5JRGB 4KUDB 5B31D 3AZEA 1M1AA 4YS3A 2RVQC 5B32C 3B6GA 1S32C 1P3FA 3REJA 5B0YA 1F66B 1ULYA 5B1LB 3AZNC 3LELC 2RVQD 5B32D 3AV1B 2Y2KA 3X1VA 3C1CB 3WA9B 5KDMA 5GSUC 5CHLB 3AZND 1P34B 1P3OB 3LELD 2Y2PA 1P3KA 4H9OB 3WAAC 1P3PC 5B40C 5GSUD 4JJNC 1AOIC 4H9PA 5AV5A 3AZEC 1M1AC 3WAAD 3MGRB 2NQBB 5B40D 3MVDA 3W96A 3LZ1B 1TZYC 3AN2D 1KX4A 2FJ7B 3REJC 4JJND 1AOID 3W98B 3AZED 2Y2QA 1M1AD 3B6GD 3X1VC 1TZYD 5DNMA 3REJD 3A6NB 5G49A 3NQJA 3AZJB 1H3OA 3VH5T 4ZBJB 4X23A 4J8XA 3X1VD 1U35B 3B0BA 1BH9A 4G91B 5AY8A 3UTBA 3MGSB 1KX3C 3LZ0A 3X1SA 2F8NA 5BS7A 3AZHC 3RELC 5CPIC 5AV5C 3UT9A 1P3KD 1ZLAA 5AVCA 3VH6W 3F6TA 5AV8B 3R45A 3W96C 3X1UB 4J8WB 2IO5C 4HGAC 3W97A 1KX4C 5B2JA 3MGQA 3X1TC 4Z66B 5CPID 5AV5D 1N1JA 3VH6A 5AV9C 2BYMB 2ZY2A 5GXQA 3WTPC 5GT0B 5E5AA 3AV2C 3MVDD 3KWQA 3W96D 2XD5A 1KX4D 2Y2HA 5CPKB 3X1TD 3AZMA 3EPKA 4KGCA 2CWEA 5AV9D 5B32G 3NQUA 4X23C 3AV2D 4H9QB 2F8NH 5GT3B 3UTBC 4WNNA 3H0LC 2HUEB 3V9RB 4Z5TC 2HIOC 4E45A 5BS7C 4X23D 4J8XD 3B0DB 5AVCC 4AWLB 3UTBD 1M18B 1ZLAC 1KU5A 3O62B 4XZQB 3LZ0D 3UTAA 2CV5B 1P3GA 2F8ND 4Z5TD 1KX5C 4UUZA 5B2JC 3MGQC 4J8UA 2NZDA 3REIC 5GXQC 5JA4B 5AVCD 1ZLAD 3KSYA 3B6FC 3MNNC 3P5JB 3WKJA 3KUYA 1P3AB 5B2JD 4H9RB 3MGQD 3AZLB 3AZKB 5C3IC 3W99A 4KGCC 5GXQD 5E5AD 4WU8A 3MNND 3KWQD 1TAFA 4WU9B 4G92C 3AFAA 1JFIB 4KGCD 1HQ3A 5B24B 5CP6B 3AZIA 2Y2GA 5B33A 5DNNB 5B0ZA 5JRGA 2VQRA 2XD1A 3KXBB 1P3LB 1EQZC 5BNXB 1Z2CB 2BYKB 5AV6A 1F66A 1P3GD 5B1LA 4CAYB 2LY8A 5FUGB 5BO0B 3AV1A 5F99B 4CSRB 3C1CA 1EQZD 3WA9A 1WWSA 4DRBA 3WKJD 1BH8A 1P34A 5CPJB 1P3IB 4UPKA 3AZGC 4H9OA 3AZIC 3REKA 5B0ZC 3AZFA 4H9NB 3AFAD 2PYOB 5AVBA 1HQ3D 1M19A 4H9SA 3AZGD 3MGRA 2NQBA 3AZID 4QLCB 3LZ1A 5B31B 5AV6C 5B0ZD 3W98A 2F8NG 2YFVA 4J8VC 5AV6D 5B32B 3A6NA 4XUJC 2DQNC 2YFWB 5B1LD 3AZJA 1S32B 1P3BA 3AN2C 1U35A 4J8VD 3AZNB 3MGSA 3LELB 4YS3C 3MGPA 4XUJD 3B6GC 3REKC 3AZFC 3B0CT 1P3FC 5AVBC 4EO5C 5GSUB 5B0YC 1M19C 4J8WA 4YS3D 3REKD 1P3MA 3AZFD 3WAAB 1P3FD 1P3PB 5B40B 5AVBD 5B0YD 1M19D 4JJNB 3AYWA 1AOIB 3H0RC 3AZEB 1M1AB 5CPKA 3W98D 1P3KC 1P3BC 1TZYB 3EG5B 4KHAA 3REJB 4H9QA 5GT3A 2G5HC 3A6ND 3MGPC 3V9RA 3X1VB 1F1EA 1P3BD 3EPHA 3MVDC 1M18A 3LJAA 2CV5A 1T3UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MGP D;  3TU4 A;  3REH A;  4YM6 A;  1P3M C;  5B2I A;  1KX3 B;  5DNM C;  1Q9C A;  5JA4 A;  3AZH B;  3REL B;  3AYW C;  5CPI B;  5AV5 B;  4J8X C;  1P3M D;  4H9R A;  3AZL A;  5AY8 C;  3AZK A;  5DNM D;  3W96 B;  3B0C W;  3LZ0 C;  4HGA B;  1KX4 B;  3X1S C;  1HTA A;  3AYW D;  3X1T B;  4WU9 A;  5AV9 B;  3WTP B;  5CPK D;  3AV2 B;  3UT9 C;  5AY8 D;  3X1S D;  5CP6 A;  3C1B A;  4LD9 A;  3W97 C;  4ZUX A;  5G49 B;  3NQJ B;  3LJA C;  1H3O B;  5BNV B;  3VH5 W;  4X23 B;  3UT9 D;  3KXB A;  3TU4 C;  5E5A C;  3REH C;  1P3L A;  4YM6 C;  5B2I C;  5B1M A;  3KWQ C;  3UTB B;  1ID3 A;  3W97 D;  5BNX A;  4Z5T B;  2HIO B;  3VH5 A;  3LJA D;  3AZM C;  2BYK A;  3TU4 D;  3REH D;  4CAY A;  5FUG A;  4YM6 D;  5AVC B;  5B2I D;  4WZS B;  1ZLA B;  4CSR A;  4R8P A;  3R45 B;  1KX5 B;  3AZM D;  5B2J B;  3MGQ B;  1WWI A;  3REI B;  5GXQ B;  3B6F B;  5CPJ A;  3AZK D;  3MNN B;  2ARO A;  1P3I A;  3UTA C;  3C1B C;  4LD9 C;  1P3G C;  4KUD A;  4ZUX C;  2L5A A;  4KGC B;  5C3I B;  4WU9 D;  4J8U C;  2NZD C;  4H9N A;  2PYO A;  3UTA D;  5B1M C;  3C1B D;  4LD9 D;  3WKJ C;  3KUY C;  4G92 B;  4ZUX D;  1ID3 C;  5B31 A;  4J8U D;  2NZD D;  3W99 C;  4WU8 C;  5B1M D;  4R8P C;  3KUY D;  1ID3 D;  1P3O A;  3AFA C;  3W99 D;  1HQ3 C;  4DRA A;  2YFW A;  1EQZ B;  1S32 A;  4WU8 D;  4NE6 A;  4R8P D;  2ARO C;  4WV4 B;  5B33 C;  5JRG C;  4KUD C;  3LEL A;  1R4V A;  5CPJ D;  2FJ7 A;  2ARO D;  5GSU A;  5B33 D;  4M6B A;  1F66 C;  5JRG D;  1B6W A;  4KUD D;  5B1L C;  3AV1 C;  3C1C C;  3AZG B;  1P3P A;  3AZI B;  3WA9 C;  1F66 D;  3WTP E;  1P3O C;  1P34 C;  4JJN A;  1AOI A;  3AV1 D;  3C1C D;  3WA9 D;  1TZY A;  5AV6 B;  1P3O D;  1P34 D;  1BFM A;  4H9S C;  3VH6 T;  3MGR C;  1S32 D;  4NE5 A;  5AV8 A;  3X1U A;  3LZ1 C;  4J8V B;  2NQB C;  2FJ7 C;  1BH8 B;  4XUJ B;  3W98 C;  4Z66 A;  3AN2 B;  2BYM A;  5GT0 A;  3MGR D;  2NQB D;  3LZ1 D;  1KX3 A;  4E44 A;  2FJ7 D;  2JSS A;  4YS3 B;  3A6N C;  3AZH A;  3REK B;  3REL A;  3B6G B;  3AZJ C;  3AZF B;  5CPI A;  1P3F B;  4EO5 B;  5AVB B;  4ZBJ C;  1U35 C;  5B0Y B;  1M19 B;  1P3P D;  4G91 C;  3MGS C;  3AZJ D;  3X1T A;  2YFV B;  5AV9 A;  1U35 D;  5KDM B;  3WTP A;  3AV2 A;  3MGS D;  3O62 A;  4XZQ A;  5AV8 C;  3X1U C;  4J8W C;  1P3K B;  4Z66 C;  1P3B B;  5BNV A;  5GT0 C;  5AV8 D;  3X1U D;  4J8W D;  4H9P B;  1P3A A;  5CPK C;  3MGP B;  4Z5T A;  2HIO A;  4Z66 D;  3MVD B;  2IO5 B;  5GT0 D;  1KX3 D;  5GT3 C;  1KX5 A;  2HUE C;  4Z2M H;  3AZH D;  3REL D;  1P3M B;  1JFI A;  5B24 A;  5B31 G;  5DNM B;  3REI A;  1A7W A;  3B6F A;  3B0D C;  4AWL C;  5GT3 D;  3MNN A;  1M18 C;  3AYW B;  3O62 C;  5DNN A;  4XZQ C;  2CV5 C;  4J8X B;  1BH9 B;  5AY8 B;  3WTP D;  3LZ0 B;  3X1S B;  4KHA B;  1M18 D;  2F8N B;  3O62 D;  2CV5 D;  4XZQ D;  1P3A C;  5BO0 A;  3UT9 B;  5F99 A;  3AZL C;  3AZK C;  3W97 B;  3LJA B;  2F8N K;  4WU9 C;  1N1J B;  1P3A D;  2HIO D;  5E5A B;  3REH B;  3TU4 B;  4YM6 B;  3AZL D;  5B2I B;  3KWQ B;  5B24 C;  5CP6 C;  1EQZ A;  3AZM B;  5DNN C;  3NQU B;  1KX5 D;  3KXB C;  1P3L C;  5B24 D;  5CP6 D;  3REI D;  4WNN B;  4NFT A;  3B6F D;  4QLC A;  5BT1 C;  5DNN D;  3KXB D;  4NE3 A;  1P3L D;  5F99 C;  3UTA B;  3C1B B;  3AZG A;  4LD9 B;  1P3G B;  5BT1 D;  4ZUX B;  4UUZ B;  5B32 A;  4J8U B;  2NZD B;  5F99 D;  5CPJ C;  5B1M B;  1P3I C;  3WKJ B;  3KUY B;  1ID3 B;  3AZN A;  1B67 A;  3W99 B;  4WU8 B;  2PYO C;  1P3I D;  1TAF B;  4R8P B;  4QLC C;  4J8V A;  3AFA B;  5B31 C;  1HQ3 B;  4XUJ A;  3WAA A;  5B40 A;  2PYO D;  3AN2 A;  2ARO B;  5B33 B;  5B0Z B;  4Z2M G;  4QLC D;  5JRG B;  4KUD B;  5B31 D;  3AZE A;  1M1A A;  4YS3 A;  2RVQ C;  5B32 C;  3B6G A;  1S32 C;  1P3F A;  3REJ A;  5B0Y A;  1F66 B;  1ULY A;  5B1L B;  3AZN C;  3LEL C;  2RVQ D;  5B32 D;  3AV1 B;  3X1V A;  3C1C B;  3WA9 B;  5KDM A;  5GSU C;  5CHL B;  3AZN D;  1P34 B;  1P3O B;  3LEL D;  1P3K A;  4H9O B;  3WAA C;  1P3P C;  5B40 C;  5GSU D;  4JJN C;  1AOI C;  4H9P A;  5AV5 A;  3AZE C;  1M1A C;  3WAA D;  3MGR B;  2NQB B;  5B40 D;  3MVD A;  3W96 A;  3LZ1 B;  1TZY C;  3AN2 D;  1KX4 A;  2FJ7 B;  3REJ C;  4JJN D;  1AOI D;  3W98 B;  3AZE D;  1M1A D;  3B6G D;  3X1V C;  1TZY D;  5DNM A;  3REJ D;  3A6N B;  5G49 A;  3NQJ A;  3AZJ B;  1H3O A;  3VH5 T;  4ZBJ B;  4X23 A;  4J8X A;  3X1V D;  1U35 B;  3B0B A;  1BH9 A;  4G91 B;  5AY8 A;  3UTB A;  3MGS B;  1KX3 C;  3LZ0 A;  3X1S A;  2F8N A;  5BS7 A;  3AZH C;  3REL C;  5CPI C;  5AV5 C;  3UT9 A;  1P3K D;  1ZLA A;  5AVC A;  3VH6 W;  5AV8 B;  3R45 A;  3W96 C;  3X1U B;  4J8W B;  2IO5 C;  4HGA C;  3W97 A;  1KX4 C;  5B2J A;  3MGQ A;  3X1T C;  4Z66 B;  5CPI D;  5AV5 D;  1N1J A;  3VH6 A;  5AV9 C;  2BYM B;  5GXQ A;  3WTP C;  5GT0 B;  5E5A A;  3AV2 C;  3MVD D;  3KWQ A;  3W96 D;  1KX4 D;  5CPK B;  3X1T D;  3AZM A;  4KGC A;  2CWE A;  5AV9 D;  5B32 G;  3NQU A;  4X23 C;  3AV2 D;  4H9Q B;  2F8N H;  5GT3 B;  3UTB C;  4WNN A;  2HUE B;  3V9R B;  4Z5T C;  2HIO C;  4E45 A;  5BS7 C;  4X23 D;  4J8X D;  3B0D B;  5AVC C;  4AWL B;  3UTB D;  1M18 B;  1ZLA C;  1KU5 A;  3O62 B;  4XZQ B;  3LZ0 D;  3UTA A;  2CV5 B;  1P3G A;  2F8N D;  4Z5T D;  1KX5 C;  4UUZ A;  5B2J C;  3MGQ C;  4J8U A;  2NZD A;  3REI C;  5GXQ C;  5JA4 B;  5AVC D;  1ZLA D;  3KSY A;  3B6F C;  3MNN C;  3WKJ A;  3KUY A;  1P3A B;  5B2J D;  4H9R B;  3MGQ D;  3AZL B;  3AZK B;  5C3I C;  3W99 A;  4KGC C;  5GXQ D;  5E5A D;  4WU8 A;  3MNN D;  3KWQ D;  1TAF A;  4WU9 B;  4G92 C;  3AFA A;  1JFI B;  4KGC D;  1HQ3 A;  5B24 B;  5CP6 B;  3AZI A;  5B33 A;  5DNN B;  5B0Z A;  5JRG A;  3KXB B;  1P3L B;  1EQZ C;  5BNX B;  2BYK B;  5AV6 A;  1F66 A;  1P3G D;  5B1L A;  4CAY B;  2LY8 A;  5FUG B;  5BO0 B;  3AV1 A;  5F99 B;  4CSR B;  3C1C A;  1EQZ D;  3WA9 A;  1WWS A;  4DRB A;  3WKJ D;  1BH8 A;  1P34 A;  5CPJ B;  1P3I B;  3AZG C;  4H9O A;  3AZI C;  3REK A;  5B0Z C;  3AZF A;  4H9N B;  3AFA D;  2PYO B;  5AVB A;  1HQ3 D;  1M19 A;  4H9S A;  3AZG D;  3MGR A;  2NQB A;  3AZI D;  4QLC B;  3LZ1 A;  5B31 B;  5AV6 C;  5B0Z D;  3W98 A;  2F8N G;  2YFV A;  4J8V C;  5AV6 D;  5B32 B;  3A6N A;  4XUJ C;  2YFW B;  5B1L D;  3AZJ A;  1P3B A;  1S32 B;  3AN2 C;  1U35 A;  4J8V D;  3AZN B;  3MGS A;  3LEL B;  4YS3 C;  3MGP A;  4XUJ D;  3B6G C;  3REK C;  3AZF C;  3B0C T;  1P3F C;  5AVB C;  4EO5 C;  5GSU B;  5B0Y C;  1M19 C;  4J8W A;  4YS3 D;  3REK D;  1P3M A;  3AZF D;  3WAA B;  1P3F D;  1P3P B;  5B40 B;  5AVB D;  5B0Y D;  1M19 D;  4JJN B;  3AYW A;  1AOI B;  3AZE B;  1M1A B;  5CPK A;  3W98 D;  1P3K C;  1P3B C;  1TZY B;  4KHA A;  3REJ B;  4H9Q A;  5GT3 A;  3A6N D;  3MGP C;  3V9R A;  3X1V B;  1F1E A;  1P3B D;  3MVD C;  1M18 A;  3LJA A;  2CV5 A; 
#chains in the Genus database with same CATH topology
 3MGP D;  3TU4 A;  3REH A;  4YM6 A;  1P3M C;  5B2I A;  1KX3 B;  5DNM C;  1Q9C A;  5JA4 A;  3AZH B;  3REL B;  3AYW C;  5CPI B;  5AV5 B;  4J8X C;  1P3M D;  4H9R A;  3AZL A;  4WJ3 C;  5AY8 C;  1W2E A;  5DNM D;  3AZK A;  3B0C W;  3W96 B;  3LZ0 C;  4HGA B;  1KX4 B;  3X1S C;  1HTA A;  3AYW D;  3X1T B;  4WU9 A;  5AV9 B;  3WTP B;  5CPK D;  3AV2 B;  3UT9 C;  5AY8 D;  3X1S D;  5CP6 A;  3C1B A;  4LD9 A;  3W97 C;  2G5I C;  4ZUX A;  3EPJ A;  5G49 B;  3NQJ B;  3LJA C;  1H3O B;  5BNV B;  3VH5 W;  4X23 B;  3UT9 D;  3KXB A;  3TU4 C;  5E5A C;  3REH C;  1P3L A;  2JE5 A;  4YM6 C;  5B2I C;  5B1M A;  3KWQ C;  3UTB B;  1ID3 A;  3W97 D;  5BNX A;  4Z5T B;  2HIO B;  3VH5 A;  3LJA D;  3AZM C;  2BYK A;  4DQY B;  3TU4 D;  3REH D;  4CAY A;  5FUG A;  4YM6 D;  5AVC B;  5B2I D;  4WZS B;  1ZLA B;  4CSR A;  4R8P A;  3R45 B;  1KX5 B;  3AZM D;  5B2J B;  3MGQ B;  3AL0 C;  1WWI A;  3REI B;  5GXQ B;  3B6F B;  5CPJ A;  3AZK D;  3MNN B;  2ARO A;  1P3I A;  3UTA C;  3C1B C;  4LD9 C;  1P3G C;  4KUD A;  4ZUX C;  2L5A A;  4KGC B;  5C3I B;  4WU9 D;  4J8U C;  2NZD C;  4H9N A;  2PYO A;  3UTA D;  5B1M C;  3C1B D;  4LD9 D;  3WKJ C;  3KUY C;  4G92 B;  4ZUX D;  1ID3 C;  5B31 A;  4J8U D;  2NZD D;  3W99 C;  4WU8 C;  5B1M D;  4R8P C;  3KUY D;  1ID3 D;  1P3O A;  3KFU G;  3AFA C;  3W99 D;  1HQ3 C;  4DRA A;  2YFW A;  1EQZ B;  1S32 A;  4WU8 D;  4NE6 A;  4R8P D;  2ARO C;  4WV4 B;  5B33 C;  5JRG C;  4KUD C;  3LEL A;  2Y2J A;  1R4V A;  5CPJ D;  2FJ7 A;  2ARO D;  5GSU A;  5B33 D;  4M6B A;  1F66 C;  5JRG D;  1B6W A;  2RIQ A;  4KUD D;  5B1L C;  3AV1 C;  3C1C C;  3AZG B;  1P3P A;  3AZI B;  2UWX A;  3WA9 C;  1F66 D;  2DF4 C;  3WTP E;  1P3O C;  1P34 C;  4JJN A;  1AOI A;  1PZR A;  3AV1 D;  3C1C D;  3WA9 D;  1TZY A;  5AV6 B;  1P3O D;  1P34 D;  2BG1 A;  1BFM A;  4H9S C;  3VH6 T;  3MGR C;  1S32 D;  4NE5 A;  5AV8 A;  3X1U A;  3LZ1 C;  4J8V B;  2NQB C;  2FJ7 C;  1BH8 B;  4XUJ B;  3W98 C;  3IP4 C;  4Z66 A;  3AN2 B;  2BYM A;  5GT0 A;  2JCH A;  3MGR D;  2NQB D;  3LZ1 D;  1KX3 A;  4E44 A;  2FJ7 D;  2JSS A;  4YS3 B;  3A6N C;  3AZH A;  3REK B;  3REL A;  3B6G B;  3AZJ C;  3AZF B;  5CPI A;  1P3F B;  4EO5 B;  5AVB B;  3A1K A;  4ZBJ C;  1U35 C;  5B0Y B;  1M19 B;  1P3P D;  3H0M C;  4G91 C;  3MGS C;  3AZJ D;  3X1T A;  2YFV B;  5AV9 A;  1U35 D;  5KDM B;  3WTP A;  3AV2 A;  3MGS D;  3O62 A;  4XZQ A;  5AV8 C;  3X1U C;  4J8W C;  1P3K B;  4Z66 C;  1P3B B;  5BNV A;  5GT0 C;  2Y2N A;  5AV8 D;  3X1U D;  4J8W D;  2ZY3 A;  4H9P B;  1P3A A;  2ZY5 A;  5CPK C;  3MGP B;  4Z5T A;  2HIO A;  4Z66 D;  3A1I A;  3MVD B;  2Y2L A;  2IO5 B;  5GT0 D;  2Y2I A;  1KX3 D;  5GT3 C;  1KX5 A;  2HUE C;  4Z2M H;  3AZH D;  3REL D;  1P3M B;  1JFI A;  5B24 A;  5B31 G;  5DNM B;  3REI A;  1A7W A;  2FFF B;  3B6F A;  3B0D C;  4AWL C;  5GT3 D;  3MNN A;  1M18 C;  3AYW B;  3O62 C;  5DNN A;  4XZQ C;  2CV5 C;  4J8X B;  1BH9 B;  5AY8 B;  3WTP D;  3LZ0 B;  3X1S B;  4KHA B;  1M18 D;  2F8N B;  3O62 D;  2CV5 D;  4XZQ D;  3EPL A;  1P3A C;  5BO0 A;  3UT9 B;  5F99 A;  2ZM5 A;  3AZL C;  3AZK C;  3W97 B;  3LJA B;  2F8N K;  4WU9 C;  1N1J B;  1P3A D;  2HIO D;  5E5A B;  3REH B;  3TU4 B;  4YM6 B;  3AZL D;  5B2I B;  3KWQ B;  5B24 C;  5CP6 C;  1EQZ A;  3AZM B;  5DNN C;  3NQU B;  1KX5 D;  3KXB C;  1P3L C;  5B24 D;  5CP6 D;  3REI D;  4WNN B;  4NFT A;  3B6F D;  4QLC A;  5BT1 C;  2W8S A;  5DNN D;  3KXB D;  4NE3 A;  1P3L D;  5F99 C;  3UTA B;  3FDD A;  3C1B B;  3AZG A;  1P3G B;  5BT1 D;  4LD9 B;  2Y2O A;  4ZUX B;  2J8P A;  4UUZ B;  5B32 A;  4J8U B;  2NZD B;  5F99 D;  5CPJ C;  5B1M B;  1P3I C;  3WKJ B;  3KUY B;  1ID3 B;  3AZN A;  2ZY4 A;  1B67 A;  3W99 B;  2Y2M A;  4WU8 B;  2PYO C;  1P3I D;  1TAF B;  4R8P B;  4QLC C;  4J8V A;  3AFA B;  2F2A C;  5B31 C;  1HQ3 B;  4XUJ A;  3WAA A;  5B40 A;  2PYO D;  3AN2 A;  2ARO B;  5B33 B;  5B0Z B;  4Z2M G;  4QLC D;  5JRG B;  4KUD B;  5B31 D;  3AZE A;  1M1A A;  4YS3 A;  2RVQ C;  5B32 C;  3B6G A;  1S32 C;  1P3F A;  3REJ A;  5B0Y A;  1F66 B;  1ULY A;  5B1L B;  3AZN C;  3LEL C;  2RVQ D;  5B32 D;  3AV1 B;  2Y2K A;  3X1V A;  3C1C B;  3WA9 B;  5KDM A;  5GSU C;  5CHL B;  3AZN D;  1P34 B;  1P3O B;  3LEL D;  2Y2P A;  1P3K A;  4H9O B;  3WAA C;  1P3P C;  5B40 C;  5GSU D;  4JJN C;  1AOI C;  4H9P A;  5AV5 A;  3AZE C;  1M1A C;  3WAA D;  3MGR B;  2NQB B;  5B40 D;  3MVD A;  3W96 A;  3LZ1 B;  1TZY C;  3AN2 D;  1KX4 A;  2FJ7 B;  3REJ C;  4JJN D;  1AOI D;  3W98 B;  3AZE D;  2Y2Q A;  1M1A D;  3B6G D;  3X1V C;  1TZY D;  5DNM A;  3REJ D;  3A6N B;  5G49 A;  3NQJ A;  3AZJ B;  1H3O A;  3VH5 T;  4ZBJ B;  4X23 A;  4J8X A;  3X1V D;  1U35 B;  3B0B A;  1BH9 A;  4G91 B;  5AY8 A;  3UTB A;  3MGS B;  1KX3 C;  3LZ0 A;  3X1S A;  2F8N A;  5BS7 A;  3AZH C;  3REL C;  5CPI C;  5AV5 C;  3UT9 A;  1P3K D;  1ZLA A;  5AVC A;  3VH6 W;  3F6T A;  5AV8 B;  3R45 A;  3W96 C;  3X1U B;  4J8W B;  2IO5 C;  4HGA C;  3W97 A;  1KX4 C;  5B2J A;  3MGQ A;  3X1T C;  4Z66 B;  5CPI D;  5AV5 D;  1N1J A;  3VH6 A;  5AV9 C;  2BYM B;  2ZY2 A;  5GXQ A;  3WTP C;  5GT0 B;  5E5A A;  3AV2 C;  3MVD D;  3KWQ A;  3W96 D;  2XD5 A;  1KX4 D;  2Y2H A;  5CPK B;  3X1T D;  3AZM A;  3EPK A;  4KGC A;  2CWE A;  5AV9 D;  5B32 G;  3NQU A;  4X23 C;  3AV2 D;  4H9Q B;  2F8N H;  5GT3 B;  3UTB C;  4WNN A;  3H0L C;  2HUE B;  3V9R B;  4Z5T C;  2HIO C;  4E45 A;  5BS7 C;  4X23 D;  4J8X D;  3B0D B;  5AVC C;  4AWL B;  3UTB D;  1M18 B;  1ZLA C;  1KU5 A;  3O62 B;  4XZQ B;  3LZ0 D;  3UTA A;  2CV5 B;  1P3G A;  2F8N D;  4Z5T D;  1KX5 C;  4UUZ A;  5B2J C;  3MGQ C;  4J8U A;  2NZD A;  3REI C;  5GXQ C;  5JA4 B;  5AVC D;  1ZLA D;  3KSY A;  3B6F C;  3MNN C;  3P5J B;  3WKJ A;  3KUY A;  1P3A B;  5B2J D;  4H9R B;  3MGQ D;  3AZL B;  3AZK B;  5C3I C;  3W99 A;  4KGC C;  5GXQ D;  5E5A D;  4WU8 A;  3MNN D;  3KWQ D;  1TAF A;  4WU9 B;  4G92 C;  3AFA A;  1JFI B;  4KGC D;  1HQ3 A;  5B24 B;  5CP6 B;  3AZI A;  2Y2G A;  5B33 A;  5DNN B;  5B0Z A;  5JRG A;  2VQR A;  2XD1 A;  3KXB B;  1P3L B;  1EQZ C;  5BNX B;  1Z2C B;  2BYK B;  5AV6 A;  1F66 A;  1P3G D;  5B1L A;  4CAY B;  2LY8 A;  5FUG B;  5BO0 B;  3AV1 A;  5F99 B;  4CSR B;  3C1C A;  1EQZ D;  3WA9 A;  1WWS A;  4DRB A;  3WKJ D;  1BH8 A;  1P34 A;  5CPJ B;  1P3I B;  4UPK A;  3AZG C;  4H9O A;  3AZI C;  3REK A;  5B0Z C;  3AZF A;  4H9N B;  3AFA D;  2PYO B;  5AVB A;  1HQ3 D;  1M19 A;  4H9S A;  3AZG D;  3MGR A;  2NQB A;  3AZI D;  4QLC B;  3LZ1 A;  5B31 B;  5AV6 C;  5B0Z D;  3W98 A;  2F8N G;  2YFV A;  4J8V C;  5AV6 D;  5B32 B;  3A6N A;  4XUJ C;  2DQN C;  2YFW B;  5B1L D;  3AZJ A;  1S32 B;  1P3B A;  3AN2 C;  1U35 A;  4J8V D;  3AZN B;  3MGS A;  3LEL B;  4YS3 C;  3MGP A;  4XUJ D;  3B6G C;  3REK C;  3AZF C;  3B0C T;  1P3F C;  5AVB C;  4EO5 C;  5GSU B;  5B0Y C;  1M19 C;  4J8W A;  4YS3 D;  3REK D;  1P3M A;  3AZF D;  3WAA B;  1P3F D;  1P3P B;  5B40 B;  5AVB D;  5B0Y D;  1M19 D;  4JJN B;  3AYW A;  1AOI B;  3H0R C;  3AZE B;  1M1A B;  5CPK A;  3W98 D;  1P3K C;  1P3B C;  1TZY B;  3EG5 B;  4KHA A;  3REJ B;  4H9Q A;  5GT3 A;  2G5H C;  3A6N D;  3MGP C;  3V9R A;  3X1V B;  1F1E A;  1P3B D;  3EPH A;  3MVD C;  1M18 A;  3LJA A;  2CV5 A;  1T3U A; 
#chains in the Genus database with same CATH homology
 3MGP D;  3TU4 A;  3REH A;  4YM6 A;  1P3M C;  5B2I A;  1KX3 B;  5DNM C;  1Q9C A;  5JA4 A;  3AZH B;  3REL B;  3AYW C;  5CPI B;  5AV5 B;  4J8X C;  1P3M D;  4H9R A;  3AZL A;  4WJ3 C;  5AY8 C;  1W2E A;  5DNM D;  3AZK A;  3B0C W;  3W96 B;  3LZ0 C;  4HGA B;  1KX4 B;  3X1S C;  1HTA A;  3AYW D;  3X1T B;  4WU9 A;  5AV9 B;  3WTP B;  5CPK D;  3AV2 B;  3UT9 C;  5AY8 D;  3X1S D;  5CP6 A;  3C1B A;  4LD9 A;  3W97 C;  2G5I C;  4ZUX A;  3EPJ A;  5G49 B;  3NQJ B;  3LJA C;  1H3O B;  5BNV B;  3VH5 W;  4X23 B;  3UT9 D;  3KXB A;  3TU4 C;  5E5A C;  3REH C;  1P3L A;  2JE5 A;  4YM6 C;  5B2I C;  5B1M A;  3KWQ C;  3UTB B;  1ID3 A;  3W97 D;  5BNX A;  4Z5T B;  2HIO B;  3VH5 A;  3LJA D;  3AZM C;  2BYK A;  4DQY B;  3TU4 D;  3REH D;  4CAY A;  5FUG A;  4YM6 D;  5AVC B;  5B2I D;  4WZS B;  1ZLA B;  4CSR A;  4R8P A;  3R45 B;  1KX5 B;  3AZM D;  5B2J B;  3MGQ B;  3AL0 C;  1WWI A;  3REI B;  5GXQ B;  3B6F B;  5CPJ A;  3AZK D;  3MNN B;  2ARO A;  1P3I A;  3UTA C;  3C1B C;  4LD9 C;  1P3G C;  4KUD A;  4ZUX C;  2L5A A;  4KGC B;  5C3I B;  4WU9 D;  4J8U C;  2NZD C;  4H9N A;  2PYO A;  3UTA D;  5B1M C;  3C1B D;  4LD9 D;  3WKJ C;  3KUY C;  4G92 B;  4ZUX D;  1ID3 C;  5B31 A;  4J8U D;  2NZD D;  3W99 C;  4WU8 C;  5B1M D;  4R8P C;  3KUY D;  1ID3 D;  1P3O A;  3KFU G;  3AFA C;  3W99 D;  1HQ3 C;  4DRA A;  2YFW A;  1EQZ B;  1S32 A;  4WU8 D;  4NE6 A;  4R8P D;  2ARO C;  4WV4 B;  5B33 C;  5JRG C;  4KUD C;  3LEL A;  2Y2J A;  1R4V A;  5CPJ D;  2FJ7 A;  2ARO D;  5GSU A;  5B33 D;  4M6B A;  1F66 C;  5JRG D;  1B6W A;  2RIQ A;  4KUD D;  5B1L C;  3AV1 C;  3C1C C;  3AZG B;  1P3P A;  3AZI B;  2UWX A;  3WA9 C;  1F66 D;  2DF4 C;  3WTP E;  1P3O C;  1P34 C;  4JJN A;  1AOI A;  1PZR A;  3AV1 D;  3C1C D;  3WA9 D;  1TZY A;  5AV6 B;  1P3O D;  1P34 D;  2BG1 A;  1BFM A;  4H9S C;  3VH6 T;  3MGR C;  1S32 D;  4NE5 A;  5AV8 A;  3X1U A;  3LZ1 C;  4J8V B;  2NQB C;  2FJ7 C;  1BH8 B;  4XUJ B;  3W98 C;  3IP4 C;  4Z66 A;  3AN2 B;  2BYM A;  5GT0 A;  2JCH A;  3MGR D;  2NQB D;  3LZ1 D;  1KX3 A;  4E44 A;  2FJ7 D;  2JSS A;  4YS3 B;  3A6N C;  3AZH A;  3REK B;  3REL A;  3B6G B;  3AZJ C;  3AZF B;  5CPI A;  1P3F B;  4EO5 B;  5AVB B;  3A1K A;  4ZBJ C;  1U35 C;  5B0Y B;  1M19 B;  1P3P D;  3H0M C;  4G91 C;  3MGS C;  3AZJ D;  3X1T A;  2YFV B;  5AV9 A;  1U35 D;  5KDM B;  3WTP A;  3AV2 A;  3MGS D;  3O62 A;  4XZQ A;  5AV8 C;  3X1U C;  4J8W C;  1P3K B;  4Z66 C;  1P3B B;  5BNV A;  5GT0 C;  2Y2N A;  5AV8 D;  3X1U D;  4J8W D;  2ZY3 A;  4H9P B;  1P3A A;  2ZY5 A;  5CPK C;  3MGP B;  4Z5T A;  2HIO A;  4Z66 D;  3A1I A;  3MVD B;  2Y2L A;  2IO5 B;  5GT0 D;  2Y2I A;  1KX3 D;  5GT3 C;  1KX5 A;  2HUE C;  4Z2M H;  3AZH D;  3REL D;  1P3M B;  1JFI A;  5B24 A;  5B31 G;  5DNM B;  3REI A;  1A7W A;  2FFF B;  3B6F A;  3B0D C;  4AWL C;  5GT3 D;  3MNN A;  1M18 C;  3AYW B;  3O62 C;  5DNN A;  4XZQ C;  2CV5 C;  4J8X B;  1BH9 B;  5AY8 B;  3WTP D;  3LZ0 B;  3X1S B;  4KHA B;  1M18 D;  2F8N B;  3O62 D;  2CV5 D;  4XZQ D;  3EPL A;  1P3A C;  5BO0 A;  3UT9 B;  5F99 A;  2ZM5 A;  3AZL C;  3AZK C;  3W97 B;  3LJA B;  2F8N K;  4WU9 C;  1N1J B;  1P3A D;  2HIO D;  5E5A B;  3REH B;  3TU4 B;  4YM6 B;  3AZL D;  5B2I B;  3KWQ B;  5B24 C;  5CP6 C;  1EQZ A;  3AZM B;  5DNN C;  3NQU B;  1KX5 D;  3KXB C;  1P3L C;  5B24 D;  5CP6 D;  3REI D;  4WNN B;  4NFT A;  3B6F D;  4QLC A;  5BT1 C;  2W8S A;  5DNN D;  3KXB D;  4NE3 A;  1P3L D;  5F99 C;  3UTA B;  3FDD A;  3C1B B;  3AZG A;  1P3G B;  5BT1 D;  4LD9 B;  2Y2O A;  4ZUX B;  2J8P A;  4UUZ B;  5B32 A;  4J8U B;  2NZD B;  5F99 D;  5CPJ C;  5B1M B;  1P3I C;  3WKJ B;  3KUY B;  1ID3 B;  3AZN A;  2ZY4 A;  1B67 A;  3W99 B;  2Y2M A;  4WU8 B;  2PYO C;  1P3I D;  1TAF B;  4R8P B;  4QLC C;  4J8V A;  3AFA B;  2F2A C;  5B31 C;  1HQ3 B;  4XUJ A;  3WAA A;  5B40 A;  2PYO D;  3AN2 A;  2ARO B;  5B33 B;  5B0Z B;  4Z2M G;  4QLC D;  5JRG B;  4KUD B;  5B31 D;  3AZE A;  1M1A A;  4YS3 A;  2RVQ C;  5B32 C;  3B6G A;  1S32 C;  1P3F A;  3REJ A;  5B0Y A;  1F66 B;  1ULY A;  5B1L B;  3AZN C;  3LEL C;  2RVQ D;  5B32 D;  3AV1 B;  2Y2K A;  3X1V A;  3C1C B;  3WA9 B;  5KDM A;  5GSU C;  5CHL B;  3AZN D;  1P34 B;  1P3O B;  3LEL D;  2Y2P A;  1P3K A;  4H9O B;  3WAA C;  1P3P C;  5B40 C;  5GSU D;  4JJN C;  1AOI C;  4H9P A;  5AV5 A;  3AZE C;  1M1A C;  3WAA D;  3MGR B;  2NQB B;  5B40 D;  3MVD A;  3W96 A;  3LZ1 B;  1TZY C;  3AN2 D;  1KX4 A;  2FJ7 B;  3REJ C;  4JJN D;  1AOI D;  3W98 B;  3AZE D;  2Y2Q A;  1M1A D;  3B6G D;  3X1V C;  1TZY D;  5DNM A;  3REJ D;  3A6N B;  5G49 A;  3NQJ A;  3AZJ B;  1H3O A;  3VH5 T;  4ZBJ B;  4X23 A;  4J8X A;  3X1V D;  1U35 B;  3B0B A;  1BH9 A;  4G91 B;  5AY8 A;  3UTB A;  3MGS B;  1KX3 C;  3LZ0 A;  3X1S A;  2F8N A;  5BS7 A;  3AZH C;  3REL C;  5CPI C;  5AV5 C;  3UT9 A;  1P3K D;  1ZLA A;  5AVC A;  3VH6 W;  3F6T A;  5AV8 B;  3R45 A;  3W96 C;  3X1U B;  4J8W B;  2IO5 C;  4HGA C;  3W97 A;  1KX4 C;  5B2J A;  3MGQ A;  3X1T C;  4Z66 B;  5CPI D;  5AV5 D;  1N1J A;  3VH6 A;  5AV9 C;  2BYM B;  2ZY2 A;  5GXQ A;  3WTP C;  5GT0 B;  5E5A A;  3AV2 C;  3MVD D;  3KWQ A;  3W96 D;  2XD5 A;  1KX4 D;  2Y2H A;  5CPK B;  3X1T D;  3AZM A;  3EPK A;  4KGC A;  2CWE A;  5AV9 D;  5B32 G;  3NQU A;  4X23 C;  3AV2 D;  4H9Q B;  2F8N H;  5GT3 B;  3UTB C;  4WNN A;  3H0L C;  2HUE B;  3V9R B;  4Z5T C;  2HIO C;  4E45 A;  5BS7 C;  4X23 D;  4J8X D;  3B0D B;  5AVC C;  4AWL B;  3UTB D;  1M18 B;  1ZLA C;  1KU5 A;  3O62 B;  4XZQ B;  3LZ0 D;  3UTA A;  2CV5 B;  1P3G A;  2F8N D;  4Z5T D;  1KX5 C;  4UUZ A;  5B2J C;  3MGQ C;  4J8U A;  2NZD A;  3REI C;  5GXQ C;  5JA4 B;  5AVC D;  1ZLA D;  3KSY A;  3B6F C;  3MNN C;  3P5J B;  3WKJ A;  3KUY A;  1P3A B;  5B2J D;  4H9R B;  3MGQ D;  3AZL B;  3AZK B;  5C3I C;  3W99 A;  4KGC C;  5GXQ D;  5E5A D;  4WU8 A;  3MNN D;  3KWQ D;  1TAF A;  4WU9 B;  4G92 C;  3AFA A;  1JFI B;  4KGC D;  1HQ3 A;  5B24 B;  5CP6 B;  3AZI A;  2Y2G A;  5B33 A;  5DNN B;  5B0Z A;  5JRG A;  2VQR A;  2XD1 A;  3KXB B;  1P3L B;  1EQZ C;  5BNX B;  1Z2C B;  2BYK B;  5AV6 A;  1F66 A;  1P3G D;  5B1L A;  4CAY B;  2LY8 A;  5FUG B;  5BO0 B;  3AV1 A;  5F99 B;  4CSR B;  3C1C A;  1EQZ D;  3WA9 A;  1WWS A;  4DRB A;  3WKJ D;  1BH8 A;  1P34 A;  5CPJ B;  1P3I B;  4UPK A;  3AZG C;  4H9O A;  3AZI C;  3REK A;  5B0Z C;  3AZF A;  4H9N B;  3AFA D;  2PYO B;  5AVB A;  1HQ3 D;  1M19 A;  4H9S A;  3AZG D;  3MGR A;  2NQB A;  3AZI D;  4QLC B;  3LZ1 A;  5B31 B;  5AV6 C;  5B0Z D;  3W98 A;  2F8N G;  2YFV A;  4J8V C;  5AV6 D;  5B32 B;  3A6N A;  4XUJ C;  2DQN C;  2YFW B;  5B1L D;  3AZJ A;  1S32 B;  1P3B A;  3AN2 C;  1U35 A;  4J8V D;  3AZN B;  3MGS A;  3LEL B;  4YS3 C;  3MGP A;  4XUJ D;  3B6G C;  3REK C;  3AZF C;  3B0C T;  1P3F C;  5AVB C;  4EO5 C;  5GSU B;  5B0Y C;  1M19 C;  4J8W A;  4YS3 D;  3REK D;  1P3M A;  3AZF D;  3WAA B;  1P3F D;  1P3P B;  5B40 B;  5AVB D;  5B0Y D;  1M19 D;  4JJN B;  3AYW A;  1AOI B;  3H0R C;  3AZE B;  1M1A B;  5CPK A;  3W98 D;  1P3K C;  1P3B C;  1TZY B;  3EG5 B;  4KHA A;  3REJ B;  4H9Q A;  5GT3 A;  2G5H C;  3A6N D;  3MGP C;  3V9R A;  3X1V B;  1F1E A;  1P3B D;  3EPH A;  3MVD C;  1M18 A;  3LJA A;  2CV5 A;  1T3U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...