1JFIA

Crystal structure of the nc2-tbp-dna ternary complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
66
structure length
63
Chain Sequence
ARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSRTMTTSHLKQCIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords 5'-D(*TP*TP*GP*GP*CP*TP*AP*TP*AP*AP*AP*AP*GP*GP*GP*CP*TP*CP*
publication title Crystal structure of negative cofactor 2 recognizing the TBP-DNA transcription complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 21
structure length 63
sequence length 66
ec nomenclature
pdb deposition date 2001-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00808 CBFD_NFYB_HMF Histone-like transcription factor (CBF/NF-Y) and archaeal histone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1jfiA00
3REKA 5AVBB 3AFAD 3REKC 3AZND 2LY8A 3VH6W 3AZFD 1P3FB 1EQZB 1ULYA 3RELD 5GSUA 4X23A 5GSUC 4X23C 3X1TA 1P3BA 5GT3A 3LZ0D 1P3MA 1P3BC 1P3MC 1AOIB 3C1CA 3AZKB 3W99A 3W99C 3W96A 3AZHA 3WKJC 5AVCA 3O62A 3MNNB 4KGCD 3O62C 1TAFB 4XUJA 4H9QB 5B1LC 4Z5TA 4XUJC 1P3IB 1S32B 4Z5TC 1P3OD 1P34A 3KUYD 3KXBB 1P34C 3X1UD 3MGSA 2CV5B 5AV9B 3MGSC 4HGAB 2HIOA 3X1VB 3LELA 2HIOC 4H9NA 3LELC 2NZDA 5CPKA 1F1EA 5E5AB 3WTPD 5CPKC 4R8PA 5CPIB 1WWSA 4UUZB 3AZLA 3X1SD 4R8PC 4QLCB 3KSYA 3AZLC 1BH9A 3LZ1D 3AV1B 1P3GB 5KDMA 3LJAD 4J8UD 5B2IA 4WU8B 5B2IC 4YM6B 3TU4D 5B32A 4XZQB 3AN2A 5B32C 3REIA 3AN2C 2AROB 3REIC 5DNND 5AV8A 2NQBD 4NE3A 2CV5C 2BYKB 4HGAC 3X1VC 1F66D 5B0YA 3LZ0B 1ID3B 3AYWB 3REKD 4H9PB 5CPIC 2PYOB 4QLCC 1KX5A 3AV1C 1KX5C 4WU9B 5GSUD 4X23D 1M18A 2BYMB 3X1TD 5GT3D 4Z66A 1P3MD 5GXQB 4Z66C 5AY8A 3C1CD 4WNNB 3WAAA 2YFVB 3W99D 4G92C 5CPJC 5BT1C 3KWQA 2AROC 3AZIB 1P3KB 3W96D 3V9RB 3KWQC 3AZGA 3AZHD 5CP6A 3AZGC 5AVCD 5CP6C 5B24A 5B31B 3O62D 3WA9D 4J8VA 5B24C 1H3OB 5B1MA 4J8WB 3WTPB 4XUJD 4J8VC 5B1MC 4Z5TD 4J8XB 5BO0A 2RVQC 3AV2B 5F99A 1P34D 2PYOC 1ZLAB 1N1JB 2HIOD 4WU9C 3LELD 3AZMA 5B0ZB 5G49A 3AZMC 5CPKD 2NZDD 4R8PD 2IO5C 3AZLD 3W97A 4CSRA 5GT0B 1TZYB 4ZUXA 3AZJB 1P3KC 5B2ID 1P3PB 4J8WC 5JRGA 5JRGC 4ZBJC 3B6GC 3NQJA 5B32D 4J8XC 3MVDB 3AN2D 5B32G 3REID 5AV8D 1U35B 3REHB 1M1AA 4JJNA 1M1AC 1KX3B 4JJNC 2CWEA 5B0YD 3A6NB 5FUGA 5B0ZC 4LD9B 4AWLB 5AV6B 1P3AB 2F8NA 3UT9A 1KX5D 5GT0C 3UTAA 4G91B 3UT9C 3VH6A 3UTAC 5JA4B 3MGQB 3AZJC 1M18D 3WA9B 1B67A 3B0CT 3WKJA 4Z66D 1M19A 5AY8D 1M19C 3WAAD 3MGRB 4CAYB 5B33B 3AZEA 5B2JA 5BT1D 5B1LA 3AZEC 1P3LB 5B2JC 4KUDB 5AVBA 3C1BB 3AZGD 1HQ3B 5BNXB 5AVBC 5CP6D 5B24D 1KX3C 1P3FA 4J8VD 3A6NC 5B1MD 1P3FC 1EQZA 1BFMA 4YS3B 5CHLB 1EQZC 3B6FB 5AV5B 5F99D 3W98B 4H9OB 5BNVB 3UTBB 5B40D 1P3AC 1AOIA 1KX4B 3VH5W 1AOIC 3AZKA 3MGQC 3MGPD 3AZKC 1A7WA 5DNMB 2FJ7B 3MNNA 3W97D 1KU5A 4H9SC 3VH5A 1TAFA 3MNNC 4H9QA 4ZUXD 3REJD 5B33C 3AFAB 1P3IA 4KUDC 3AZNB 1P3IC 1S32C 4NE5A 2F8NK 1BH8B 3KXBA 3AZFB 3KXBC 2CV5A 5AV9A 3RELB 5C3IB 5JRGD 5AV9C 3X1VA 3B6FC 2YFWB 3W98C 1JFIB 3UTBC 5E5AC 4H9RB 4Z2MG 5CPIA 4UUZA 1M1AD 3NQUA 4QLCA 4JJND 1P3GA 3AV1A 1P3GC 1B6WA 4WU8A 4WU8C 2FJ7C 2L5AA 4YM6A 4KGCB 2F8ND 1P3BD 4YM6C 3UT9D 2F8NG 3UTAD 4XZQA 1P3OB 3KUYB 5CPJA 4KHAB 4XZQC 2AROA 3X1UB 3AZFC 3WKJD 3RELC 2BYKA 3AZED 5B40B 3LZ0A 5B1LD 1ID3A 3LZ0C 3AYWA 1ID3C 5AVBD 4NE6A 3X1SB 3AYWC 4H9PA 3LZ1B 3MGPB 2PYOA 3LJAB 1P3FD 3MGSD 1EQZD 4WU9A 4J8UB 4DRAA 4Z2MH 3REJB 2BYMA 4KGCC 5BS7A 3TU4B 5GXQA 1AOID 5BS7C 5GXQC 4WNNA 2YFVA 3R45B 5DNNB 2NQBB 3X1UC 3AZIA 1P3KA 3V9RA 3AZIC 1F66B 5B31A 3MNND 4G92B 5B31C 1H3OA 3NQUB 4J8WA 3WTPA 3WTPC 3B6GA 4J8XA 3REKB 1P3ID 3AV2A 3AV2C 3KXBD 1ZLAA 2CV5D 1ZLAC 5AV9D 5GSUB 1N1JA 3X1VD 4X23B 4J8UC 5B0ZA 3X1TB 1P3BB 5GT3B 1P3MB 3C1CB 5CPID 4QLCD 1P3GD 3AV1D 5GT0A 3W99B 1TZYA 1TZYC 5DNNC 3W96B 3AZHB 3AZJA 5AVCB 4WU8D 1P3PA 4EO5B 3O62B 1P3PC 4YM6D 4XUJB 4Z5TB 4XZQD 3MVDA 1P34B 5CPJD 3MVDC 2AROD 1R4VA 3MGSB 1U35A 4E45A 3KWQD 3REHA 1U35C 3VH6T 3REHC 2HIOB 4WV4B 3LELB 1KX3A 3A6NA 4H9NB 2NZDB 5CPKB 4LD9A 3X1TC 1ID3D 5GT3C 4LD9C 2RVQD 4R8PB 3AYWD 3AZLB 3C1CC 1BH9B 3B0BA 5AV6A 1P3AA 5KDMB 2PYOD 4AWLC 5AV6C 4G91C 5JA4A 3W96C 4WU9D 3MGQA 3AZHC 5B2IB 3B0DB 5AVCC 3AZMD 3WA9A 4EO5C 3WA9C 5GXQD 5B32B 3MGRA 4H9SA 4CAYA 5B33A 3REIB 3AN2B 3MGRC 1P3LA 5AV8B 1P3LC 4KUDA 3AZID 1P3KD 3C1BA 1S32A 1HQ3A 5BNXA 3C1BC 1HQ3C 1WWIA 5B0YB 5B31D 5B31G 4J8WD 2NZDC 4YS3A 3B6GD 4J8XD 4YS3C 3B6FA 5AV5A 3AV2D 5AV5C 3W98A 4H9OA 5BNVA 3UTBA 1KX5B 5E5AA 3VH5T 1ZLAD 1KX4A 1KX4C 1M18B 4WZSB 5B0ZD 3B0DC 5DNMA 5DNMC 4Z66B 2FJ7A 5AY8B 3WAAB 5CPJB 5GT0D 1TZYD 3KWQB 5AV8C 3AFAA 3AZGB 3AZJD 3AFAC 5CP6B 3AZNA 1P3PD 3AZNC 1BH8A 5B24B 3AZFA 4J8VB 5B0YC 5B1MB 3RELA 1M19D 5BO0B 5C3IC 5F99B 3MVDD 2YFWA 5B2JD 1JFIA 1U35D 3REHD 4H9RA 1KX3D 3AZMB 3A6ND 5G49B 1M18C 4LD9D 2IO5B 5AY8C 3WAAC 1P3AD 4CSRB 5AV6D 3W97B 4KGCA 4ZUXB 4NFTA 3MGQD 1P3OA 3KUYA 3AZKD 4KHAA 1P3OC 3KUYC 1Q9CA 3X1UA 4DRBA 3WTPE 5JRGB 4ZBJB 2HUEB 3B6GB 1HTAA 2F8NH 3NQJB 3MGRD 5B33D 5F99C 5B40A 1P3LD 5B40C 2JSSA 4KUDD 3C1BD 1S32D 3X1SA 1HQ3D 1M1AB 4JJNB 3LZ1A 3X1SC 3MGPA 3LZ1C 3LJAA 3MGPC 5FUGB 3LJAC 4YS3D 4J8UA 3B6FD 5AV5D 3W98D 3REJA 2F8NB 3UTBD 3UT9B 5E5AD 3REJC 3W97C 3UTAB 3TU4A 4ZUXC 3TU4C 1KX4D 4E44A 3R45A 5DNNA 5DNMD 2NQBA 3WKJB 2NQBC 3B0CW 1M19B 2FJ7D 1F66A 2HUEC 1F66C 3AZEB 5B2JB 4M6BA 5B1LB
chains in the Genus database with same CATH superfamily
3REKA 5AVBB 3AFAD 3REKC 3AZND 2LY8A 3VH6W 3AZFD 1P3FB 1EQZB 1ULYA 3RELD 5GSUA 4X23A 5GSUC 4X23C 3X1TA 1P3BA 5GT3A 3LZ0D 1P3MA 1P3BC 1P3MC 1AOIB 3C1CA 3AZKB 3W99A 3W99C 3W96A 3AZHA 3WKJC 5AVCA 3O62A 3MNNB 2ZY2A 2F2AC 3O62C 4KGCD 1TAFB 4XUJA 4H9QB 5B1LC 4Z5TA 4XUJC 1P3IB 1S32B 3H0MC 4Z5TC 1P3OD 1P34A 3KUYD 3KXBB 1P34C 3X1UD 3MGSA 2CV5B 5AV9B 3MGSC 3EPLA 4HGAB 2HIOA 3X1VB 3LELA 2HIOC 4H9NA 3LELC 2NZDA 5CPKA 1F1EA 5E5AB 3WTPD 5CPKC 4R8PA 5CPIB 1WWSA 4UUZB 3AZLA 3X1SD 4R8PC 4QLCB 3KSYA 3AZLC 1BH9A 3LZ1D 3AV1B 1P3GB 5KDMA 3LJAD 2UWXA 4J8UD 5B2IA 4WU8B 5B2IC 4YM6B 3TU4D 4WJ3C 5B32A 4XZQB 3AN2A 5B32C 3REIA 3AN2C 2AROB 3REIC 5DNND 5AV8A 3EG5B 2NQBD 4NE3A 2CV5C 2BYKB 4HGAC 3X1VC 1F66D 5B0YA 3LZ0B 1ID3B 1PZRA 3AYWB 3REKD 4H9PB 5CPIC 2PYOB 4QLCC 1KX5A 3AV1C 1KX5C 4WU9B 3H0LC 5GSUD 4X23D 1M18A 2BYMB 3X1TD 5GT3D 4Z66A 1P3MD 5GXQB 4Z66C 1T3UA 5AY8A 3C1CD 4WNNB 3WAAA 2YFVB 3W99D 3A1IA 4G92C 2Y2IA 5CPJC 5BT1C 3KWQA 2AROC 3AZIB 1P3KB 3EPJA 3V9RB 3KWQC 3AZGA 3AZHD 3W96D 5CP6A 3AZGC 5AVCD 5CP6C 5B24A 5B31B 3O62D 3WA9D 4J8VA 5B24C 1H3OB 5B1MA 4J8WB 2ZY4A 3WTPB 4XUJD 4J8VC 5B1MC 4Z5TD 4J8XB 2VQRA 5BO0A 2RVQC 3AV2B 5F99A 1P34D 2PYOC 1ZLAB 1N1JB 2HIOD 4WU9C 3LELD 3AZMA 5B0ZB 5G49A 3AZMC 5CPKD 2NZDD 4R8PD 2IO5C 3AZLD 3W97A 4CSRA 5GT0B 1TZYB 4ZUXA 2RIQA 3AZJB 1P3KC 5B2ID 1P3PB 4J8WC 5JRGA 5JRGC 4ZBJC 3B6GC 3NQJA 5B32D 4J8XC 3MVDB 3AN2D 5B32G 3REID 5AV8D 1U35B 3REHB 2Y2GA 1M1AA 4JJNA 1M1AC 1KX3B 4JJNC 2CWEA 5B0YD 3A6NB 5FUGA 5B0ZC 4LD9B 2XD5A 4AWLB 5AV6B 4DQYB 1P3AB 2F8NA 3UT9A 1KX5D 2DF4C 5GT0C 3UTAA 4G91B 3UT9C 2ZM5A 3VH6A 3UTAC 5JA4B 3MGQB 3AZJC 2G5IC 1M18D 3WA9B 1B67A 3B0CT 3WKJA 4Z66D 1M19A 5AY8D 1M19C 3WAAD 3MGRB 4CAYB 5B33B 3AZEA 5B2JA 5BT1D 5B1LA 3AZEC 1P3LB 5B2JC 4KUDB 5AVBA 3C1BB 3AZGD 1HQ3B 5BNXB 5AVBC 5CP6D 5B24D 1KX3C 1P3FA 4J8VD 3A6NC 5B1MD 1P3FC 1EQZA 1BFMA 4YS3B 5CHLB 1EQZC 3B6FB 3FDDA 5AV5B 2DQNC 5F99D 3W98B 4H9OB 5BNVB 3UTBB 5B40D 1P3AC 1AOIA 1KX4B 3VH5W 1AOIC 3AZKA 3MGQC 2Y2HA 3MGPD 3AZKC 1A7WA 5DNMB 2FJ7B 3MNNA 3W97D 1KU5A 4H9SC 3VH5A 1TAFA 3MNNC 4H9QA 4ZUXD 3REJD 5B33C 3AFAB 1P3IA 4KUDC 3AZNB 1P3IC 1S32C 4NE5A 2F8NK 1BH8B 3KXBA 3AZFB 3KXBC 2CV5A 5AV9A 3RELB 5C3IB 5JRGD 5AV9C 3X1VA 3B6FC 2YFWB 3W98C 1JFIB 3UTBC 5E5AC 4H9RB 4Z2MG 5CPIA 4UUZA 1M1AD 3NQUA 4QLCA 4JJND 2Y2KA 1P3GA 3AV1A 1P3GC 2Y2OA 4UPKA 1B6WA 4WU8A 2JE5A 4WU8C 2FJ7C 3A1KA 2L5AA 4YM6A 4KGCB 2F8ND 1P3BD 3H0RC 4YM6C 3UT9D 2F8NG 3UTAD 4XZQA 1P3OB 3KUYB 5CPJA 4KHAB 4XZQC 2AROA 3X1UB 3AZFC 3WKJD 3RELC 2BYKA 2Y2LA 3AZED 5B40B 3LZ0A 5B1LD 2G5HC 1ID3A 3LZ0C 3AYWA 1ID3C 5AVBD 4NE6A 3X1SB 3AYWC 4H9PA 3LZ1B 3MGPB 2PYOA 3LJAB 1P3FD 3MGSD 1EQZD 4WU9A 4J8UB 4DRAA 4Z2MH 3REJB 2BYMA 4KGCC 5BS7A 3TU4B 5GXQA 1AOID 5BS7C 5GXQC 4WNNA 2YFVA 3R45B 5DNNB 2NQBB 3X1UC 3AZIA 1P3KA 3V9RA 3AZIC 1F66B 5B31A 3MNND 4G92B 5B31C 1H3OA 3NQUB 4J8WA 3WTPA 2W8SA 3WTPC 3B6GA 2J8PA 4J8XA 3REKB 1P3ID 3AV2A 3AV2C 3KXBD 1ZLAA 2CV5D 1ZLAC 5AV9D 5GSUB 1N1JA 3X1VD 4X23B 4J8UC 5B0ZA 3X1TB 1P3BB 5GT3B 1P3MB 3C1CB 5CPID 4QLCD 1P3GD 3AV1D 5GT0A 3W99B 1TZYA 1TZYC 5DNNC 3W96B 3AZHB 3AZJA 5AVCB 4WU8D 1P3PA 4EO5B 3O62B 1P3PC 4YM6D 4XUJB 4Z5TB 4XZQD 3MVDA 1P34B 5CPJD 3MVDC 2AROD 1R4VA 3MGSB 1U35A 4E45A 3KWQD 3REHA 1U35C 3VH6T 3REHC 2HIOB 4WV4B 3LELB 1KX3A 3A6NA 4H9NB 2NZDB 5CPKB 4LD9A 3X1TC 1ID3D 5GT3C 4LD9C 2RVQD 4R8PB 3AYWD 3AZLB 3C1CC 1BH9B 3B0BA 5AV6A 1P3AA 5KDMB 2PYOD 4AWLC 5AV6C 4G91C 5JA4A 3W96C 4WU9D 3MGQA 3AZHC 5B2IB 3B0DB 5AVCC 3AZMD 3WA9A 4EO5C 3WA9C 3AL0C 5GXQD 5B32B 3MGRA 4H9SA 4CAYA 5B33A 3REIB 3AN2B 3MGRC 1P3LA 5AV8B 1P3LC 4KUDA 3AZID 1P3KD 3C1BA 1S32A 1HQ3A 5BNXA 2Y2NA 3C1BC 1HQ3C 1WWIA 1W2EA 5B0YB 5B31D 2XD1A 5B31G 4J8WD 2NZDC 4YS3A 3B6GD 4J8XD 4YS3C 3B6FA 5AV5A 3AV2D 5AV5C 3W98A 4H9OA 5BNVA 3UTBA 1KX5B 5E5AA 3VH5T 1ZLAD 1KX4A 1KX4C 2Y2JA 1M18B 4WZSB 5B0ZD 3B0DC 5DNMA 5DNMC 4Z66B 2ZY3A 2FJ7A 5AY8B 3WAAB 5CPJB 3P5JB 5GT0D 2BG1A 1TZYD 2FFFB 3KWQB 5AV8C 3AFAA 3AZGB 3AZJD 2Y2MA 3AFAC 5CP6B 2ZY5A 3AZNA 1P3PD 3AZNC 1BH8A 5B24B 3AZFA 4J8VB 5B0YC 5B1MB 3RELA 1M19D 5BO0B 5C3IC 5F99B 3MVDD 2YFWA 5B2JD 1JFIA 1U35D 3REHD 4H9RA 1KX3D 3AZMB 3A6ND 5G49B 1M18C 4LD9D 2IO5B 5AY8C 3WAAC 1P3AD 4CSRB 5AV6D 3W97B 4KGCA 4ZUXB 4NFTA 3MGQD 1P3OA 3KUYA 3AZKD 3EPKA 4KHAA 1P3OC 3KUYC 1Q9CA 2JCHA 3X1UA 4DRBA 1Z2CB 3WTPE 5JRGB 4ZBJB 2HUEB 3B6GB 1HTAA 2F8NH 3NQJB 3MGRD 5B33D 5F99C 5B40A 1P3LD 5B40C 2JSSA 4KUDD 3KFUG 3IP4C 3C1BD 1S32D 3X1SA 1HQ3D 2Y2PA 4JJNB 1M1AB 3LZ1A 3X1SC 3MGPA 3LZ1C 3LJAA 3MGPC 5FUGB 3LJAC 4YS3D 4J8UA 3B6FD 3F6TA 5AV5D 3W98D 3REJA 2F8NB 3UTBD 3UT9B 5E5AD 3REJC 3W97C 3UTAB 3TU4A 4ZUXC 3TU4C 1KX4D 4E44A 3EPHA 3R45A 5DNNA 5DNMD 2NQBA 2Y2QA 3WKJB 2NQBC 3B0CW 1M19B 2FJ7D 1F66A 2HUEC 1F66C 3AZEB 5B2JB 4M6BA 5B1LB
chains in the Genus database with same CATH topology
3REKA 5AVBB 3AFAD 3REKC 3AZND 2LY8A 3VH6W 3AZFD 1P3FB 1EQZB 1ULYA 3RELD 5GSUA 4X23A 5GSUC 4X23C 3X1TA 1P3BA 5GT3A 3LZ0D 1P3MA 1P3BC 1P3MC 1AOIB 3C1CA 3AZKB 3W99A 3W99C 3W96A 3AZHA 3WKJC 5AVCA 3O62A 3MNNB 2ZY2A 2F2AC 3O62C 4KGCD 1TAFB 4XUJA 4H9QB 5B1LC 4Z5TA 4XUJC 1P3IB 1S32B 3H0MC 4Z5TC 1P3OD 1P34A 3KUYD 3KXBB 1P34C 3X1UD 3MGSA 2CV5B 5AV9B 3MGSC 3EPLA 4HGAB 2HIOA 3X1VB 3LELA 2HIOC 4H9NA 3LELC 2NZDA 5CPKA 1F1EA 5E5AB 3WTPD 5CPKC 4R8PA 5CPIB 1WWSA 4UUZB 3AZLA 3X1SD 4R8PC 4QLCB 3KSYA 3AZLC 1BH9A 3LZ1D 3AV1B 1P3GB 5KDMA 3LJAD 2UWXA 4J8UD 5B2IA 4WU8B 5B2IC 4YM6B 3TU4D 4WJ3C 5B32A 4XZQB 3AN2A 5B32C 3REIA 3AN2C 2AROB 3REIC 5DNND 5AV8A 3EG5B 2NQBD 4NE3A 2CV5C 2BYKB 4HGAC 3X1VC 1F66D 5B0YA 3LZ0B 1ID3B 1PZRA 3AYWB 3REKD 4H9PB 5CPIC 2PYOB 4QLCC 1KX5A 3AV1C 1KX5C 4WU9B 3H0LC 5GSUD 4X23D 1M18A 2BYMB 3X1TD 5GT3D 4Z66A 1P3MD 5GXQB 4Z66C 1T3UA 5AY8A 3C1CD 4WNNB 3WAAA 2YFVB 3W99D 3A1IA 4G92C 2Y2IA 5CPJC 5BT1C 3KWQA 2AROC 3AZIB 1P3KB 3EPJA 3V9RB 3KWQC 3AZGA 3AZHD 3W96D 5CP6A 3AZGC 5AVCD 5CP6C 5B24A 5B31B 3O62D 3WA9D 4J8VA 5B24C 1H3OB 5B1MA 4J8WB 2ZY4A 3WTPB 4XUJD 4J8VC 5B1MC 4Z5TD 4J8XB 2VQRA 5BO0A 2RVQC 3AV2B 5F99A 1P34D 2PYOC 1ZLAB 1N1JB 2HIOD 4WU9C 3LELD 3AZMA 5B0ZB 5G49A 3AZMC 5CPKD 2NZDD 4R8PD 2IO5C 3AZLD 3W97A 4CSRA 5GT0B 1TZYB 4ZUXA 2RIQA 3AZJB 1P3KC 5B2ID 1P3PB 4J8WC 5JRGA 5JRGC 4ZBJC 3B6GC 3NQJA 5B32D 4J8XC 3MVDB 3AN2D 5B32G 3REID 5AV8D 1U35B 3REHB 2Y2GA 1M1AA 4JJNA 1M1AC 1KX3B 4JJNC 2CWEA 5B0YD 3A6NB 5FUGA 5B0ZC 4LD9B 2XD5A 4AWLB 5AV6B 4DQYB 1P3AB 2F8NA 3UT9A 1KX5D 2DF4C 5GT0C 3UTAA 4G91B 3UT9C 2ZM5A 3VH6A 3UTAC 5JA4B 3MGQB 3AZJC 2G5IC 1M18D 3WA9B 1B67A 3B0CT 3WKJA 4Z66D 1M19A 5AY8D 1M19C 3WAAD 3MGRB 4CAYB 5B33B 3AZEA 5B2JA 5BT1D 5B1LA 3AZEC 1P3LB 5B2JC 4KUDB 5AVBA 3C1BB 3AZGD 1HQ3B 5BNXB 5AVBC 5CP6D 5B24D 1KX3C 1P3FA 4J8VD 3A6NC 5B1MD 1P3FC 1EQZA 1BFMA 4YS3B 5CHLB 1EQZC 3B6FB 3FDDA 5AV5B 2DQNC 5F99D 3W98B 4H9OB 5BNVB 3UTBB 5B40D 1P3AC 1AOIA 1KX4B 3VH5W 1AOIC 3AZKA 3MGQC 2Y2HA 3MGPD 3AZKC 1A7WA 5DNMB 2FJ7B 3MNNA 3W97D 1KU5A 4H9SC 3VH5A 1TAFA 3MNNC 4H9QA 4ZUXD 3REJD 5B33C 3AFAB 1P3IA 4KUDC 3AZNB 1P3IC 1S32C 4NE5A 2F8NK 1BH8B 3KXBA 3AZFB 3KXBC 2CV5A 5AV9A 3RELB 5C3IB 5JRGD 5AV9C 3X1VA 3B6FC 2YFWB 3W98C 1JFIB 3UTBC 5E5AC 4H9RB 4Z2MG 5CPIA 4UUZA 1M1AD 3NQUA 4QLCA 4JJND 2Y2KA 1P3GA 3AV1A 1P3GC 2Y2OA 4UPKA 1B6WA 4WU8A 2JE5A 4WU8C 2FJ7C 3A1KA 2L5AA 4YM6A 4KGCB 2F8ND 1P3BD 3H0RC 4YM6C 3UT9D 2F8NG 3UTAD 4XZQA 1P3OB 3KUYB 5CPJA 4KHAB 4XZQC 2AROA 3X1UB 3AZFC 3WKJD 3RELC 2BYKA 2Y2LA 3AZED 5B40B 3LZ0A 5B1LD 2G5HC 1ID3A 3LZ0C 3AYWA 1ID3C 5AVBD 4NE6A 3X1SB 3AYWC 4H9PA 3LZ1B 3MGPB 2PYOA 3LJAB 1P3FD 3MGSD 1EQZD 4WU9A 4J8UB 4DRAA 4Z2MH 3REJB 2BYMA 4KGCC 5BS7A 3TU4B 5GXQA 1AOID 5BS7C 5GXQC 4WNNA 2YFVA 3R45B 5DNNB 2NQBB 3X1UC 3AZIA 1P3KA 3V9RA 3AZIC 1F66B 5B31A 3MNND 4G92B 5B31C 1H3OA 3NQUB 4J8WA 3WTPA 2W8SA 3WTPC 3B6GA 2J8PA 4J8XA 3REKB 1P3ID 3AV2A 3AV2C 3KXBD 1ZLAA 2CV5D 1ZLAC 5AV9D 5GSUB 1N1JA 3X1VD 4X23B 4J8UC 5B0ZA 3X1TB 1P3BB 5GT3B 1P3MB 3C1CB 5CPID 4QLCD 1P3GD 3AV1D 5GT0A 3W99B 1TZYA 1TZYC 5DNNC 3W96B 3AZHB 3AZJA 5AVCB 4WU8D 1P3PA 4EO5B 3O62B 1P3PC 4YM6D 4XUJB 4Z5TB 4XZQD 3MVDA 1P34B 5CPJD 3MVDC 2AROD 1R4VA 3MGSB 1U35A 4E45A 3KWQD 3REHA 1U35C 3VH6T 3REHC 2HIOB 4WV4B 3LELB 1KX3A 3A6NA 4H9NB 2NZDB 5CPKB 4LD9A 3X1TC 1ID3D 5GT3C 4LD9C 2RVQD 4R8PB 3AYWD 3AZLB 3C1CC 1BH9B 3B0BA 5AV6A 1P3AA 5KDMB 2PYOD 4AWLC 5AV6C 4G91C 5JA4A 3W96C 4WU9D 3MGQA 3AZHC 5B2IB 3B0DB 5AVCC 3AZMD 3WA9A 4EO5C 3WA9C 3AL0C 5GXQD 5B32B 3MGRA 4H9SA 4CAYA 5B33A 3REIB 3AN2B 3MGRC 1P3LA 5AV8B 1P3LC 4KUDA 3AZID 1P3KD 3C1BA 1S32A 1HQ3A 5BNXA 2Y2NA 3C1BC 1HQ3C 1WWIA 1W2EA 5B0YB 5B31D 2XD1A 5B31G 4J8WD 2NZDC 4YS3A 3B6GD 4J8XD 4YS3C 3B6FA 5AV5A 3AV2D 5AV5C 3W98A 4H9OA 5BNVA 3UTBA 1KX5B 5E5AA 3VH5T 1ZLAD 1KX4A 1KX4C 2Y2JA 1M18B 4WZSB 5B0ZD 3B0DC 5DNMA 5DNMC 4Z66B 2ZY3A 2FJ7A 5AY8B 3WAAB 5CPJB 3P5JB 5GT0D 2BG1A 1TZYD 2FFFB 3KWQB 5AV8C 3AFAA 3AZGB 3AZJD 2Y2MA 3AFAC 5CP6B 2ZY5A 3AZNA 1P3PD 3AZNC 1BH8A 5B24B 3AZFA 4J8VB 5B0YC 5B1MB 3RELA 1M19D 5BO0B 5C3IC 5F99B 3MVDD 2YFWA 5B2JD 1JFIA 1U35D 3REHD 4H9RA 1KX3D 3AZMB 3A6ND 5G49B 1M18C 4LD9D 2IO5B 5AY8C 3WAAC 1P3AD 4CSRB 5AV6D 3W97B 4KGCA 4ZUXB 4NFTA 3MGQD 1P3OA 3KUYA 3AZKD 3EPKA 4KHAA 1P3OC 3KUYC 1Q9CA 2JCHA 3X1UA 4DRBA 1Z2CB 3WTPE 5JRGB 4ZBJB 2HUEB 3B6GB 1HTAA 2F8NH 3NQJB 3MGRD 5B33D 5F99C 5B40A 1P3LD 5B40C 2JSSA 4KUDD 3KFUG 3IP4C 3C1BD 1S32D 3X1SA 1HQ3D 2Y2PA 4JJNB 1M1AB 3LZ1A 3X1SC 3MGPA 3LZ1C 3LJAA 3MGPC 5FUGB 3LJAC 4YS3D 4J8UA 3B6FD 3F6TA 5AV5D 3W98D 3REJA 2F8NB 3UTBD 3UT9B 5E5AD 3REJC 3W97C 3UTAB 3TU4A 4ZUXC 3TU4C 1KX4D 4E44A 3EPHA 3R45A 5DNNA 5DNMD 2NQBA 2Y2QA 3WKJB 2NQBC 3B0CW 1M19B 2FJ7D 1F66A 2HUEC 1F66C 3AZEB 5B2JB 4M6BA 5B1LB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3REK A;  5AVB B;  3AFA D;  3REK C;  3AZN D;  2LY8 A;  3VH6 W;  3AZF D;  1P3F B;  1EQZ B;  1ULY A;  3REL D;  5GSU A;  4X23 A;  5GSU C;  4X23 C;  3X1T A;  1P3B A;  5GT3 A;  3LZ0 D;  1P3M A;  1P3B C;  1P3M C;  1AOI B;  3C1C A;  3AZK B;  3W99 A;  3W99 C;  3W96 A;  3AZH A;  3WKJ C;  5AVC A;  3O62 A;  3MNN B;  4KGC D;  3O62 C;  1TAF B;  4XUJ A;  4H9Q B;  5B1L C;  4Z5T A;  4XUJ C;  1P3I B;  1S32 B;  4Z5T C;  1P3O D;  1P34 A;  3KUY D;  3KXB B;  1P34 C;  3X1U D;  3MGS A;  2CV5 B;  5AV9 B;  3MGS C;  4HGA B;  2HIO A;  3X1V B;  3LEL A;  2HIO C;  4H9N A;  3LEL C;  2NZD A;  5CPK A;  1F1E A;  5E5A B;  3WTP D;  5CPK C;  4R8P A;  5CPI B;  1WWS A;  4UUZ B;  3AZL A;  3X1S D;  4R8P C;  4QLC B;  3KSY A;  3AZL C;  1BH9 A;  3LZ1 D;  3AV1 B;  1P3G B;  5KDM A;  3LJA D;  4J8U D;  5B2I A;  4WU8 B;  5B2I C;  4YM6 B;  3TU4 D;  5B32 A;  4XZQ B;  3AN2 A;  5B32 C;  3REI A;  3AN2 C;  2ARO B;  3REI C;  5DNN D;  5AV8 A;  2NQB D;  4NE3 A;  2CV5 C;  2BYK B;  4HGA C;  3X1V C;  1F66 D;  5B0Y A;  3LZ0 B;  1ID3 B;  3AYW B;  3REK D;  4H9P B;  5CPI C;  2PYO B;  4QLC C;  1KX5 A;  3AV1 C;  1KX5 C;  4WU9 B;  5GSU D;  4X23 D;  1M18 A;  2BYM B;  3X1T D;  5GT3 D;  4Z66 A;  1P3M D;  5GXQ B;  4Z66 C;  5AY8 A;  3C1C D;  4WNN B;  3WAA A;  2YFV B;  3W99 D;  4G92 C;  5CPJ C;  5BT1 C;  3KWQ A;  2ARO C;  3AZI B;  1P3K B;  3W96 D;  3V9R B;  3KWQ C;  3AZG A;  3AZH D;  5CP6 A;  3AZG C;  5AVC D;  5CP6 C;  5B24 A;  5B31 B;  3O62 D;  3WA9 D;  4J8V A;  5B24 C;  1H3O B;  5B1M A;  4J8W B;  3WTP B;  4XUJ D;  4J8V C;  5B1M C;  4Z5T D;  4J8X B;  5BO0 A;  2RVQ C;  3AV2 B;  5F99 A;  1P34 D;  2PYO C;  1ZLA B;  1N1J B;  2HIO D;  4WU9 C;  3LEL D;  3AZM A;  5B0Z B;  5G49 A;  3AZM C;  5CPK D;  2NZD D;  4R8P D;  2IO5 C;  3AZL D;  3W97 A;  4CSR A;  5GT0 B;  1TZY B;  4ZUX A;  3AZJ B;  1P3K C;  5B2I D;  1P3P B;  4J8W C;  5JRG A;  5JRG C;  4ZBJ C;  3B6G C;  3NQJ A;  5B32 D;  4J8X C;  3MVD B;  3AN2 D;  5B32 G;  3REI D;  5AV8 D;  1U35 B;  3REH B;  1M1A A;  4JJN A;  1M1A C;  1KX3 B;  4JJN C;  2CWE A;  5B0Y D;  3A6N B;  5FUG A;  5B0Z C;  4LD9 B;  4AWL B;  5AV6 B;  1P3A B;  2F8N A;  3UT9 A;  1KX5 D;  5GT0 C;  3UTA A;  4G91 B;  3UT9 C;  3VH6 A;  3UTA C;  5JA4 B;  3MGQ B;  3AZJ C;  1M18 D;  3WA9 B;  1B67 A;  3B0C T;  3WKJ A;  4Z66 D;  1M19 A;  5AY8 D;  1M19 C;  3WAA D;  3MGR B;  4CAY B;  5B33 B;  3AZE A;  5B2J A;  5BT1 D;  5B1L A;  3AZE C;  1P3L B;  5B2J C;  4KUD B;  5AVB A;  3C1B B;  3AZG D;  1HQ3 B;  5BNX B;  5AVB C;  5CP6 D;  5B24 D;  1KX3 C;  1P3F A;  4J8V D;  3A6N C;  5B1M D;  1P3F C;  1EQZ A;  1BFM A;  4YS3 B;  5CHL B;  1EQZ C;  3B6F B;  5AV5 B;  5F99 D;  3W98 B;  4H9O B;  5BNV B;  3UTB B;  5B40 D;  1P3A C;  1AOI A;  1KX4 B;  3VH5 W;  1AOI C;  3AZK A;  3MGQ C;  3MGP D;  3AZK C;  1A7W A;  5DNM B;  2FJ7 B;  3MNN A;  3W97 D;  1KU5 A;  4H9S C;  3VH5 A;  1TAF A;  3MNN C;  4H9Q A;  4ZUX D;  3REJ D;  5B33 C;  3AFA B;  1P3I A;  4KUD C;  3AZN B;  1P3I C;  1S32 C;  4NE5 A;  2F8N K;  1BH8 B;  3KXB A;  3AZF B;  3KXB C;  2CV5 A;  5AV9 A;  3REL B;  5C3I B;  5JRG D;  5AV9 C;  3X1V A;  3B6F C;  2YFW B;  3W98 C;  1JFI B;  3UTB C;  5E5A C;  4H9R B;  4Z2M G;  5CPI A;  4UUZ A;  1M1A D;  3NQU A;  4QLC A;  4JJN D;  1P3G A;  3AV1 A;  1P3G C;  1B6W A;  4WU8 A;  4WU8 C;  2FJ7 C;  2L5A A;  4YM6 A;  4KGC B;  2F8N D;  1P3B D;  4YM6 C;  3UT9 D;  2F8N G;  3UTA D;  4XZQ A;  1P3O B;  3KUY B;  5CPJ A;  4KHA B;  4XZQ C;  2ARO A;  3X1U B;  3AZF C;  3WKJ D;  3REL C;  2BYK A;  3AZE D;  5B40 B;  3LZ0 A;  5B1L D;  1ID3 A;  3LZ0 C;  3AYW A;  1ID3 C;  5AVB D;  4NE6 A;  3X1S B;  3AYW C;  4H9P A;  3LZ1 B;  3MGP B;  2PYO A;  3LJA B;  1P3F D;  3MGS D;  1EQZ D;  4WU9 A;  4J8U B;  4DRA A;  4Z2M H;  3REJ B;  2BYM A;  4KGC C;  5BS7 A;  3TU4 B;  5GXQ A;  1AOI D;  5BS7 C;  5GXQ C;  4WNN A;  2YFV A;  3R45 B;  5DNN B;  2NQB B;  3X1U C;  3AZI A;  1P3K A;  3V9R A;  3AZI C;  1F66 B;  5B31 A;  3MNN D;  4G92 B;  5B31 C;  1H3O A;  3NQU B;  4J8W A;  3WTP A;  3WTP C;  3B6G A;  4J8X A;  3REK B;  1P3I D;  3AV2 A;  3AV2 C;  3KXB D;  1ZLA A;  2CV5 D;  1ZLA C;  5AV9 D;  5GSU B;  1N1J A;  3X1V D;  4X23 B;  4J8U C;  5B0Z A;  3X1T B;  1P3B B;  5GT3 B;  1P3M B;  3C1C B;  5CPI D;  4QLC D;  1P3G D;  3AV1 D;  5GT0 A;  3W99 B;  1TZY A;  1TZY C;  5DNN C;  3W96 B;  3AZH B;  3AZJ A;  5AVC B;  4WU8 D;  1P3P A;  4EO5 B;  3O62 B;  1P3P C;  4YM6 D;  4XUJ B;  4Z5T B;  4XZQ D;  3MVD A;  1P34 B;  5CPJ D;  3MVD C;  2ARO D;  1R4V A;  3MGS B;  1U35 A;  4E45 A;  3KWQ D;  3REH A;  1U35 C;  3VH6 T;  3REH C;  2HIO B;  4WV4 B;  3LEL B;  1KX3 A;  3A6N A;  4H9N B;  2NZD B;  5CPK B;  4LD9 A;  3X1T C;  1ID3 D;  5GT3 C;  4LD9 C;  2RVQ D;  4R8P B;  3AYW D;  3AZL B;  3C1C C;  1BH9 B;  3B0B A;  5AV6 A;  1P3A A;  5KDM B;  2PYO D;  4AWL C;  5AV6 C;  4G91 C;  5JA4 A;  3W96 C;  4WU9 D;  3MGQ A;  3AZH C;  5B2I B;  3B0D B;  5AVC C;  3AZM D;  3WA9 A;  4EO5 C;  3WA9 C;  5GXQ D;  5B32 B;  3MGR A;  4H9S A;  4CAY A;  5B33 A;  3REI B;  3AN2 B;  3MGR C;  1P3L A;  5AV8 B;  1P3L C;  4KUD A;  3AZI D;  1P3K D;  3C1B A;  1S32 A;  1HQ3 A;  5BNX A;  3C1B C;  1HQ3 C;  1WWI A;  5B0Y B;  5B31 D;  5B31 G;  4J8W D;  2NZD C;  4YS3 A;  3B6G D;  4J8X D;  4YS3 C;  3B6F A;  5AV5 A;  3AV2 D;  5AV5 C;  3W98 A;  4H9O A;  5BNV A;  3UTB A;  1KX5 B;  5E5A A;  3VH5 T;  1ZLA D;  1KX4 A;  1KX4 C;  1M18 B;  4WZS B;  5B0Z D;  3B0D C;  5DNM A;  5DNM C;  4Z66 B;  2FJ7 A;  5AY8 B;  3WAA B;  5CPJ B;  5GT0 D;  1TZY D;  3KWQ B;  5AV8 C;  3AFA A;  3AZG B;  3AZJ D;  3AFA C;  5CP6 B;  3AZN A;  1P3P D;  3AZN C;  1BH8 A;  5B24 B;  3AZF A;  4J8V B;  5B0Y C;  5B1M B;  3REL A;  1M19 D;  5BO0 B;  5C3I C;  5F99 B;  3MVD D;  2YFW A;  5B2J D;  1JFI A;  1U35 D;  3REH D;  4H9R A;  1KX3 D;  3AZM B;  3A6N D;  5G49 B;  1M18 C;  4LD9 D;  2IO5 B;  5AY8 C;  3WAA C;  1P3A D;  4CSR B;  5AV6 D;  3W97 B;  4KGC A;  4ZUX B;  4NFT A;  3MGQ D;  1P3O A;  3KUY A;  3AZK D;  4KHA A;  1P3O C;  3KUY C;  1Q9C A;  3X1U A;  4DRB A;  3WTP E;  5JRG B;  4ZBJ B;  2HUE B;  3B6G B;  1HTA A;  2F8N H;  3NQJ B;  3MGR D;  5B33 D;  5F99 C;  5B40 A;  1P3L D;  5B40 C;  2JSS A;  4KUD D;  3C1B D;  1S32 D;  3X1S A;  1HQ3 D;  1M1A B;  4JJN B;  3LZ1 A;  3X1S C;  3MGP A;  3LZ1 C;  3LJA A;  3MGP C;  5FUG B;  3LJA C;  4YS3 D;  4J8U A;  3B6F D;  5AV5 D;  3W98 D;  3REJ A;  2F8N B;  3UTB D;  3UT9 B;  5E5A D;  3REJ C;  3W97 C;  3UTA B;  3TU4 A;  4ZUX C;  3TU4 C;  1KX4 D;  4E44 A;  3R45 A;  5DNN A;  5DNM D;  2NQB A;  3WKJ B;  2NQB C;  3B0C W;  1M19 B;  2FJ7 D;  1F66 A;  2HUE C;  1F66 C;  3AZE B;  5B2J B;  4M6B A;  5B1L B; 
#chains in the Genus database with same CATH topology
 3REK A;  5AVB B;  3AFA D;  3REK C;  3AZN D;  2LY8 A;  3VH6 W;  3AZF D;  1P3F B;  1EQZ B;  1ULY A;  3REL D;  5GSU A;  4X23 A;  5GSU C;  4X23 C;  3X1T A;  1P3B A;  5GT3 A;  3LZ0 D;  1P3M A;  1P3B C;  1P3M C;  1AOI B;  3C1C A;  3AZK B;  3W99 A;  3W99 C;  3W96 A;  3AZH A;  3WKJ C;  5AVC A;  3O62 A;  3MNN B;  2ZY2 A;  2F2A C;  3O62 C;  4KGC D;  1TAF B;  4XUJ A;  4H9Q B;  5B1L C;  4Z5T A;  4XUJ C;  1P3I B;  1S32 B;  3H0M C;  4Z5T C;  1P3O D;  1P34 A;  3KUY D;  3KXB B;  1P34 C;  3X1U D;  3MGS A;  2CV5 B;  5AV9 B;  3MGS C;  3EPL A;  4HGA B;  2HIO A;  3X1V B;  3LEL A;  2HIO C;  4H9N A;  3LEL C;  2NZD A;  5CPK A;  1F1E A;  5E5A B;  3WTP D;  5CPK C;  4R8P A;  5CPI B;  1WWS A;  4UUZ B;  3AZL A;  3X1S D;  4R8P C;  4QLC B;  3KSY A;  3AZL C;  1BH9 A;  3LZ1 D;  3AV1 B;  1P3G B;  5KDM A;  3LJA D;  2UWX A;  4J8U D;  5B2I A;  4WU8 B;  5B2I C;  4YM6 B;  3TU4 D;  4WJ3 C;  5B32 A;  4XZQ B;  3AN2 A;  5B32 C;  3REI A;  3AN2 C;  2ARO B;  3REI C;  5DNN D;  5AV8 A;  3EG5 B;  2NQB D;  4NE3 A;  2CV5 C;  2BYK B;  4HGA C;  3X1V C;  1F66 D;  5B0Y A;  3LZ0 B;  1ID3 B;  1PZR A;  3AYW B;  3REK D;  4H9P B;  5CPI C;  2PYO B;  4QLC C;  1KX5 A;  3AV1 C;  1KX5 C;  4WU9 B;  3H0L C;  5GSU D;  4X23 D;  1M18 A;  2BYM B;  3X1T D;  5GT3 D;  4Z66 A;  1P3M D;  5GXQ B;  4Z66 C;  1T3U A;  5AY8 A;  3C1C D;  4WNN B;  3WAA A;  2YFV B;  3W99 D;  3A1I A;  4G92 C;  2Y2I A;  5CPJ C;  5BT1 C;  3KWQ A;  2ARO C;  3AZI B;  1P3K B;  3EPJ A;  3V9R B;  3KWQ C;  3AZG A;  3AZH D;  3W96 D;  5CP6 A;  3AZG C;  5AVC D;  5CP6 C;  5B24 A;  5B31 B;  3O62 D;  3WA9 D;  4J8V A;  5B24 C;  1H3O B;  5B1M A;  4J8W B;  2ZY4 A;  3WTP B;  4XUJ D;  4J8V C;  5B1M C;  4Z5T D;  4J8X B;  2VQR A;  5BO0 A;  2RVQ C;  3AV2 B;  5F99 A;  1P34 D;  2PYO C;  1ZLA B;  1N1J B;  2HIO D;  4WU9 C;  3LEL D;  3AZM A;  5B0Z B;  5G49 A;  3AZM C;  5CPK D;  2NZD D;  4R8P D;  2IO5 C;  3AZL D;  3W97 A;  4CSR A;  5GT0 B;  1TZY B;  4ZUX A;  2RIQ A;  3AZJ B;  1P3K C;  5B2I D;  1P3P B;  4J8W C;  5JRG A;  5JRG C;  4ZBJ C;  3B6G C;  3NQJ A;  5B32 D;  4J8X C;  3MVD B;  3AN2 D;  5B32 G;  3REI D;  5AV8 D;  1U35 B;  3REH B;  2Y2G A;  1M1A A;  4JJN A;  1M1A C;  1KX3 B;  4JJN C;  2CWE A;  5B0Y D;  3A6N B;  5FUG A;  5B0Z C;  4LD9 B;  2XD5 A;  4AWL B;  5AV6 B;  4DQY B;  1P3A B;  2F8N A;  3UT9 A;  1KX5 D;  2DF4 C;  5GT0 C;  3UTA A;  4G91 B;  3UT9 C;  2ZM5 A;  3VH6 A;  3UTA C;  5JA4 B;  3MGQ B;  3AZJ C;  2G5I C;  1M18 D;  3WA9 B;  1B67 A;  3B0C T;  3WKJ A;  4Z66 D;  1M19 A;  5AY8 D;  1M19 C;  3WAA D;  3MGR B;  4CAY B;  5B33 B;  3AZE A;  5B2J A;  5BT1 D;  5B1L A;  3AZE C;  1P3L B;  5B2J C;  4KUD B;  5AVB A;  3C1B B;  3AZG D;  1HQ3 B;  5BNX B;  5AVB C;  5CP6 D;  5B24 D;  1KX3 C;  1P3F A;  4J8V D;  3A6N C;  5B1M D;  1P3F C;  1EQZ A;  1BFM A;  4YS3 B;  5CHL B;  1EQZ C;  3B6F B;  3FDD A;  5AV5 B;  2DQN C;  5F99 D;  3W98 B;  4H9O B;  5BNV B;  3UTB B;  5B40 D;  1P3A C;  1AOI A;  1KX4 B;  3VH5 W;  1AOI C;  3AZK A;  3MGQ C;  2Y2H A;  3MGP D;  3AZK C;  1A7W A;  5DNM B;  2FJ7 B;  3MNN A;  3W97 D;  1KU5 A;  4H9S C;  3VH5 A;  1TAF A;  3MNN C;  4H9Q A;  4ZUX D;  3REJ D;  5B33 C;  3AFA B;  1P3I A;  4KUD C;  3AZN B;  1P3I C;  1S32 C;  4NE5 A;  2F8N K;  1BH8 B;  3KXB A;  3AZF B;  3KXB C;  2CV5 A;  5AV9 A;  3REL B;  5C3I B;  5JRG D;  5AV9 C;  3X1V A;  3B6F C;  2YFW B;  3W98 C;  1JFI B;  3UTB C;  5E5A C;  4H9R B;  4Z2M G;  5CPI A;  4UUZ A;  1M1A D;  3NQU A;  4QLC A;  4JJN D;  2Y2K A;  1P3G A;  3AV1 A;  1P3G C;  2Y2O A;  4UPK A;  1B6W A;  4WU8 A;  2JE5 A;  4WU8 C;  2FJ7 C;  3A1K A;  2L5A A;  4YM6 A;  4KGC B;  2F8N D;  1P3B D;  3H0R C;  4YM6 C;  3UT9 D;  2F8N G;  3UTA D;  4XZQ A;  1P3O B;  3KUY B;  5CPJ A;  4KHA B;  4XZQ C;  2ARO A;  3X1U B;  3AZF C;  3WKJ D;  3REL C;  2BYK A;  2Y2L A;  3AZE D;  5B40 B;  3LZ0 A;  5B1L D;  2G5H C;  1ID3 A;  3LZ0 C;  3AYW A;  1ID3 C;  5AVB D;  4NE6 A;  3X1S B;  3AYW C;  4H9P A;  3LZ1 B;  3MGP B;  2PYO A;  3LJA B;  1P3F D;  3MGS D;  1EQZ D;  4WU9 A;  4J8U B;  4DRA A;  4Z2M H;  3REJ B;  2BYM A;  4KGC C;  5BS7 A;  3TU4 B;  5GXQ A;  1AOI D;  5BS7 C;  5GXQ C;  4WNN A;  2YFV A;  3R45 B;  5DNN B;  2NQB B;  3X1U C;  3AZI A;  1P3K A;  3V9R A;  3AZI C;  1F66 B;  5B31 A;  3MNN D;  4G92 B;  5B31 C;  1H3O A;  3NQU B;  4J8W A;  3WTP A;  2W8S A;  3WTP C;  3B6G A;  2J8P A;  4J8X A;  3REK B;  1P3I D;  3AV2 A;  3AV2 C;  3KXB D;  1ZLA A;  2CV5 D;  1ZLA C;  5AV9 D;  5GSU B;  1N1J A;  3X1V D;  4X23 B;  4J8U C;  5B0Z A;  3X1T B;  1P3B B;  5GT3 B;  1P3M B;  3C1C B;  5CPI D;  4QLC D;  1P3G D;  3AV1 D;  5GT0 A;  3W99 B;  1TZY A;  1TZY C;  5DNN C;  3W96 B;  3AZH B;  3AZJ A;  5AVC B;  4WU8 D;  1P3P A;  4EO5 B;  3O62 B;  1P3P C;  4YM6 D;  4XUJ B;  4Z5T B;  4XZQ D;  3MVD A;  1P34 B;  5CPJ D;  3MVD C;  2ARO D;  1R4V A;  3MGS B;  1U35 A;  4E45 A;  3KWQ D;  3REH A;  1U35 C;  3VH6 T;  3REH C;  2HIO B;  4WV4 B;  3LEL B;  1KX3 A;  3A6N A;  4H9N B;  2NZD B;  5CPK B;  4LD9 A;  3X1T C;  1ID3 D;  5GT3 C;  4LD9 C;  2RVQ D;  4R8P B;  3AYW D;  3AZL B;  3C1C C;  1BH9 B;  3B0B A;  5AV6 A;  1P3A A;  5KDM B;  2PYO D;  4AWL C;  5AV6 C;  4G91 C;  5JA4 A;  3W96 C;  4WU9 D;  3MGQ A;  3AZH C;  5B2I B;  3B0D B;  5AVC C;  3AZM D;  3WA9 A;  4EO5 C;  3WA9 C;  3AL0 C;  5GXQ D;  5B32 B;  3MGR A;  4H9S A;  4CAY A;  5B33 A;  3REI B;  3AN2 B;  3MGR C;  1P3L A;  5AV8 B;  1P3L C;  4KUD A;  3AZI D;  1P3K D;  3C1B A;  1S32 A;  1HQ3 A;  5BNX A;  2Y2N A;  3C1B C;  1HQ3 C;  1WWI A;  1W2E A;  5B0Y B;  5B31 D;  2XD1 A;  5B31 G;  4J8W D;  2NZD C;  4YS3 A;  3B6G D;  4J8X D;  4YS3 C;  3B6F A;  5AV5 A;  3AV2 D;  5AV5 C;  3W98 A;  4H9O A;  5BNV A;  3UTB A;  1KX5 B;  5E5A A;  3VH5 T;  1ZLA D;  1KX4 A;  1KX4 C;  2Y2J A;  1M18 B;  4WZS B;  5B0Z D;  3B0D C;  5DNM A;  5DNM C;  4Z66 B;  2ZY3 A;  2FJ7 A;  5AY8 B;  3WAA B;  5CPJ B;  3P5J B;  5GT0 D;  2BG1 A;  1TZY D;  2FFF B;  3KWQ B;  5AV8 C;  3AFA A;  3AZG B;  3AZJ D;  2Y2M A;  3AFA C;  5CP6 B;  2ZY5 A;  3AZN A;  1P3P D;  3AZN C;  1BH8 A;  5B24 B;  3AZF A;  4J8V B;  5B0Y C;  5B1M B;  3REL A;  1M19 D;  5BO0 B;  5C3I C;  5F99 B;  3MVD D;  2YFW A;  5B2J D;  1JFI A;  1U35 D;  3REH D;  4H9R A;  1KX3 D;  3AZM B;  3A6N D;  5G49 B;  1M18 C;  4LD9 D;  2IO5 B;  5AY8 C;  3WAA C;  1P3A D;  4CSR B;  5AV6 D;  3W97 B;  4KGC A;  4ZUX B;  4NFT A;  3MGQ D;  1P3O A;  3KUY A;  3AZK D;  3EPK A;  4KHA A;  1P3O C;  3KUY C;  1Q9C A;  2JCH A;  3X1U A;  4DRB A;  1Z2C B;  3WTP E;  5JRG B;  4ZBJ B;  2HUE B;  3B6G B;  1HTA A;  2F8N H;  3NQJ B;  3MGR D;  5B33 D;  5F99 C;  5B40 A;  1P3L D;  5B40 C;  2JSS A;  4KUD D;  3KFU G;  3IP4 C;  3C1B D;  1S32 D;  3X1S A;  1HQ3 D;  2Y2P A;  4JJN B;  1M1A B;  3LZ1 A;  3X1S C;  3MGP A;  3LZ1 C;  3LJA A;  3MGP C;  5FUG B;  3LJA C;  4YS3 D;  4J8U A;  3B6F D;  3F6T A;  5AV5 D;  3W98 D;  3REJ A;  2F8N B;  3UTB D;  3UT9 B;  5E5A D;  3REJ C;  3W97 C;  3UTA B;  3TU4 A;  4ZUX C;  3TU4 C;  1KX4 D;  4E44 A;  3EPH A;  3R45 A;  5DNN A;  5DNM D;  2NQB A;  2Y2Q A;  3WKJ B;  2NQB C;  3B0C W;  1M19 B;  2FJ7 D;  1F66 A;  2HUE C;  1F66 C;  3AZE B;  5B2J B;  4M6B A;  5B1L B; 
#chains in the Genus database with same CATH homology
 3REK A;  5AVB B;  3AFA D;  3REK C;  3AZN D;  2LY8 A;  3VH6 W;  3AZF D;  1P3F B;  1EQZ B;  1ULY A;  3REL D;  5GSU A;  4X23 A;  5GSU C;  4X23 C;  3X1T A;  1P3B A;  5GT3 A;  3LZ0 D;  1P3M A;  1P3B C;  1P3M C;  1AOI B;  3C1C A;  3AZK B;  3W99 A;  3W99 C;  3W96 A;  3AZH A;  3WKJ C;  5AVC A;  3O62 A;  3MNN B;  2ZY2 A;  2F2A C;  3O62 C;  4KGC D;  1TAF B;  4XUJ A;  4H9Q B;  5B1L C;  4Z5T A;  4XUJ C;  1P3I B;  1S32 B;  3H0M C;  4Z5T C;  1P3O D;  1P34 A;  3KUY D;  3KXB B;  1P34 C;  3X1U D;  3MGS A;  2CV5 B;  5AV9 B;  3MGS C;  3EPL A;  4HGA B;  2HIO A;  3X1V B;  3LEL A;  2HIO C;  4H9N A;  3LEL C;  2NZD A;  5CPK A;  1F1E A;  5E5A B;  3WTP D;  5CPK C;  4R8P A;  5CPI B;  1WWS A;  4UUZ B;  3AZL A;  3X1S D;  4R8P C;  4QLC B;  3KSY A;  3AZL C;  1BH9 A;  3LZ1 D;  3AV1 B;  1P3G B;  5KDM A;  3LJA D;  2UWX A;  4J8U D;  5B2I A;  4WU8 B;  5B2I C;  4YM6 B;  3TU4 D;  4WJ3 C;  5B32 A;  4XZQ B;  3AN2 A;  5B32 C;  3REI A;  3AN2 C;  2ARO B;  3REI C;  5DNN D;  5AV8 A;  3EG5 B;  2NQB D;  4NE3 A;  2CV5 C;  2BYK B;  4HGA C;  3X1V C;  1F66 D;  5B0Y A;  3LZ0 B;  1ID3 B;  1PZR A;  3AYW B;  3REK D;  4H9P B;  5CPI C;  2PYO B;  4QLC C;  1KX5 A;  3AV1 C;  1KX5 C;  4WU9 B;  3H0L C;  5GSU D;  4X23 D;  1M18 A;  2BYM B;  3X1T D;  5GT3 D;  4Z66 A;  1P3M D;  5GXQ B;  4Z66 C;  1T3U A;  5AY8 A;  3C1C D;  4WNN B;  3WAA A;  2YFV B;  3W99 D;  3A1I A;  4G92 C;  2Y2I A;  5CPJ C;  5BT1 C;  3KWQ A;  2ARO C;  3AZI B;  1P3K B;  3EPJ A;  3V9R B;  3KWQ C;  3AZG A;  3AZH D;  3W96 D;  5CP6 A;  3AZG C;  5AVC D;  5CP6 C;  5B24 A;  5B31 B;  3O62 D;  3WA9 D;  4J8V A;  5B24 C;  1H3O B;  5B1M A;  4J8W B;  2ZY4 A;  3WTP B;  4XUJ D;  4J8V C;  5B1M C;  4Z5T D;  4J8X B;  2VQR A;  5BO0 A;  2RVQ C;  3AV2 B;  5F99 A;  1P34 D;  2PYO C;  1ZLA B;  1N1J B;  2HIO D;  4WU9 C;  3LEL D;  3AZM A;  5B0Z B;  5G49 A;  3AZM C;  5CPK D;  2NZD D;  4R8P D;  2IO5 C;  3AZL D;  3W97 A;  4CSR A;  5GT0 B;  1TZY B;  4ZUX A;  2RIQ A;  3AZJ B;  1P3K C;  5B2I D;  1P3P B;  4J8W C;  5JRG A;  5JRG C;  4ZBJ C;  3B6G C;  3NQJ A;  5B32 D;  4J8X C;  3MVD B;  3AN2 D;  5B32 G;  3REI D;  5AV8 D;  1U35 B;  3REH B;  2Y2G A;  1M1A A;  4JJN A;  1M1A C;  1KX3 B;  4JJN C;  2CWE A;  5B0Y D;  3A6N B;  5FUG A;  5B0Z C;  4LD9 B;  2XD5 A;  4AWL B;  5AV6 B;  4DQY B;  1P3A B;  2F8N A;  3UT9 A;  1KX5 D;  2DF4 C;  5GT0 C;  3UTA A;  4G91 B;  3UT9 C;  2ZM5 A;  3VH6 A;  3UTA C;  5JA4 B;  3MGQ B;  3AZJ C;  2G5I C;  1M18 D;  3WA9 B;  1B67 A;  3B0C T;  3WKJ A;  4Z66 D;  1M19 A;  5AY8 D;  1M19 C;  3WAA D;  3MGR B;  4CAY B;  5B33 B;  3AZE A;  5B2J A;  5BT1 D;  5B1L A;  3AZE C;  1P3L B;  5B2J C;  4KUD B;  5AVB A;  3C1B B;  3AZG D;  1HQ3 B;  5BNX B;  5AVB C;  5CP6 D;  5B24 D;  1KX3 C;  1P3F A;  4J8V D;  3A6N C;  5B1M D;  1P3F C;  1EQZ A;  1BFM A;  4YS3 B;  5CHL B;  1EQZ C;  3B6F B;  3FDD A;  5AV5 B;  2DQN C;  5F99 D;  3W98 B;  4H9O B;  5BNV B;  3UTB B;  5B40 D;  1P3A C;  1AOI A;  1KX4 B;  3VH5 W;  1AOI C;  3AZK A;  3MGQ C;  2Y2H A;  3MGP D;  3AZK C;  1A7W A;  5DNM B;  2FJ7 B;  3MNN A;  3W97 D;  1KU5 A;  4H9S C;  3VH5 A;  1TAF A;  3MNN C;  4H9Q A;  4ZUX D;  3REJ D;  5B33 C;  3AFA B;  1P3I A;  4KUD C;  3AZN B;  1P3I C;  1S32 C;  4NE5 A;  2F8N K;  1BH8 B;  3KXB A;  3AZF B;  3KXB C;  2CV5 A;  5AV9 A;  3REL B;  5C3I B;  5JRG D;  5AV9 C;  3X1V A;  3B6F C;  2YFW B;  3W98 C;  1JFI B;  3UTB C;  5E5A C;  4H9R B;  4Z2M G;  5CPI A;  4UUZ A;  1M1A D;  3NQU A;  4QLC A;  4JJN D;  2Y2K A;  1P3G A;  3AV1 A;  1P3G C;  2Y2O A;  4UPK A;  1B6W A;  4WU8 A;  2JE5 A;  4WU8 C;  2FJ7 C;  3A1K A;  2L5A A;  4YM6 A;  4KGC B;  2F8N D;  1P3B D;  3H0R C;  4YM6 C;  3UT9 D;  2F8N G;  3UTA D;  4XZQ A;  1P3O B;  3KUY B;  5CPJ A;  4KHA B;  4XZQ C;  2ARO A;  3X1U B;  3AZF C;  3WKJ D;  3REL C;  2BYK A;  2Y2L A;  3AZE D;  5B40 B;  3LZ0 A;  5B1L D;  2G5H C;  1ID3 A;  3LZ0 C;  3AYW A;  1ID3 C;  5AVB D;  4NE6 A;  3X1S B;  3AYW C;  4H9P A;  3LZ1 B;  3MGP B;  2PYO A;  3LJA B;  1P3F D;  3MGS D;  1EQZ D;  4WU9 A;  4J8U B;  4DRA A;  4Z2M H;  3REJ B;  2BYM A;  4KGC C;  5BS7 A;  3TU4 B;  5GXQ A;  1AOI D;  5BS7 C;  5GXQ C;  4WNN A;  2YFV A;  3R45 B;  5DNN B;  2NQB B;  3X1U C;  3AZI A;  1P3K A;  3V9R A;  3AZI C;  1F66 B;  5B31 A;  3MNN D;  4G92 B;  5B31 C;  1H3O A;  3NQU B;  4J8W A;  3WTP A;  2W8S A;  3WTP C;  3B6G A;  2J8P A;  4J8X A;  3REK B;  1P3I D;  3AV2 A;  3AV2 C;  3KXB D;  1ZLA A;  2CV5 D;  1ZLA C;  5AV9 D;  5GSU B;  1N1J A;  3X1V D;  4X23 B;  4J8U C;  5B0Z A;  3X1T B;  1P3B B;  5GT3 B;  1P3M B;  3C1C B;  5CPI D;  4QLC D;  1P3G D;  3AV1 D;  5GT0 A;  3W99 B;  1TZY A;  1TZY C;  5DNN C;  3W96 B;  3AZH B;  3AZJ A;  5AVC B;  4WU8 D;  1P3P A;  4EO5 B;  3O62 B;  1P3P C;  4YM6 D;  4XUJ B;  4Z5T B;  4XZQ D;  3MVD A;  1P34 B;  5CPJ D;  3MVD C;  2ARO D;  1R4V A;  3MGS B;  1U35 A;  4E45 A;  3KWQ D;  3REH A;  1U35 C;  3VH6 T;  3REH C;  2HIO B;  4WV4 B;  3LEL B;  1KX3 A;  3A6N A;  4H9N B;  2NZD B;  5CPK B;  4LD9 A;  3X1T C;  1ID3 D;  5GT3 C;  4LD9 C;  2RVQ D;  4R8P B;  3AYW D;  3AZL B;  3C1C C;  1BH9 B;  3B0B A;  5AV6 A;  1P3A A;  5KDM B;  2PYO D;  4AWL C;  5AV6 C;  4G91 C;  5JA4 A;  3W96 C;  4WU9 D;  3MGQ A;  3AZH C;  5B2I B;  3B0D B;  5AVC C;  3AZM D;  3WA9 A;  4EO5 C;  3WA9 C;  3AL0 C;  5GXQ D;  5B32 B;  3MGR A;  4H9S A;  4CAY A;  5B33 A;  3REI B;  3AN2 B;  3MGR C;  1P3L A;  5AV8 B;  1P3L C;  4KUD A;  3AZI D;  1P3K D;  3C1B A;  1S32 A;  1HQ3 A;  5BNX A;  2Y2N A;  3C1B C;  1HQ3 C;  1WWI A;  1W2E A;  5B0Y B;  5B31 D;  2XD1 A;  5B31 G;  4J8W D;  2NZD C;  4YS3 A;  3B6G D;  4J8X D;  4YS3 C;  3B6F A;  5AV5 A;  3AV2 D;  5AV5 C;  3W98 A;  4H9O A;  5BNV A;  3UTB A;  1KX5 B;  5E5A A;  3VH5 T;  1ZLA D;  1KX4 A;  1KX4 C;  2Y2J A;  1M18 B;  4WZS B;  5B0Z D;  3B0D C;  5DNM A;  5DNM C;  4Z66 B;  2ZY3 A;  2FJ7 A;  5AY8 B;  3WAA B;  5CPJ B;  3P5J B;  5GT0 D;  2BG1 A;  1TZY D;  2FFF B;  3KWQ B;  5AV8 C;  3AFA A;  3AZG B;  3AZJ D;  2Y2M A;  3AFA C;  5CP6 B;  2ZY5 A;  3AZN A;  1P3P D;  3AZN C;  1BH8 A;  5B24 B;  3AZF A;  4J8V B;  5B0Y C;  5B1M B;  3REL A;  1M19 D;  5BO0 B;  5C3I C;  5F99 B;  3MVD D;  2YFW A;  5B2J D;  1JFI A;  1U35 D;  3REH D;  4H9R A;  1KX3 D;  3AZM B;  3A6N D;  5G49 B;  1M18 C;  4LD9 D;  2IO5 B;  5AY8 C;  3WAA C;  1P3A D;  4CSR B;  5AV6 D;  3W97 B;  4KGC A;  4ZUX B;  4NFT A;  3MGQ D;  1P3O A;  3KUY A;  3AZK D;  3EPK A;  4KHA A;  1P3O C;  3KUY C;  1Q9C A;  2JCH A;  3X1U A;  4DRB A;  1Z2C B;  3WTP E;  5JRG B;  4ZBJ B;  2HUE B;  3B6G B;  1HTA A;  2F8N H;  3NQJ B;  3MGR D;  5B33 D;  5F99 C;  5B40 A;  1P3L D;  5B40 C;  2JSS A;  4KUD D;  3KFU G;  3IP4 C;  3C1B D;  1S32 D;  3X1S A;  1HQ3 D;  2Y2P A;  4JJN B;  1M1A B;  3LZ1 A;  3X1S C;  3MGP A;  3LZ1 C;  3LJA A;  3MGP C;  5FUG B;  3LJA C;  4YS3 D;  4J8U A;  3B6F D;  3F6T A;  5AV5 D;  3W98 D;  3REJ A;  2F8N B;  3UTB D;  3UT9 B;  5E5A D;  3REJ C;  3W97 C;  3UTA B;  3TU4 A;  4ZUX C;  3TU4 C;  1KX4 D;  4E44 A;  3EPH A;  3R45 A;  5DNN A;  5DNM D;  2NQB A;  2Y2Q A;  3WKJ B;  2NQB C;  3B0C W;  1M19 B;  2FJ7 D;  1F66 A;  2HUE C;  1F66 C;  3AZE B;  5B2J B;  4M6B A;  5B1L B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...