1JFIA

Crystal structure of the nc2-tbp-dna ternary complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
66
structure length
63
Chain Sequence
ARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSRTMTTSHLKQCIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*TP*TP*GP*GP*CP*TP*AP*TP*AP*AP*AP*AP*GP*GP*GP*CP*TP*CP*
publication title Crystal structure of negative cofactor 2 recognizing the TBP-DNA transcription complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 21
structure length 63
sequence length 66
ec nomenclature
pdb deposition date 2001-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00808 CBFD_NFYB_HMF Histone-like transcription factor (CBF/NF-Y) and archaeal histone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1jfiA00
3AFAA 5CPIC 2AROB 3B0BA 1KX5B 3AZJC 5CPIB 5B40C 3AZJB 4HGAC 4M6BA 1N1JA 3W97A 4HGAB 5B2IC 4LD9D 1P3GA 4YS3C 5B2IB 3AZIB 3AZKC 3X1TA 3W96C 1BH8A 1KX4A 3WA9D 3AZKB 3W96B 3REHD 3LJAA 4KGCC 3KXBD 4KGCB 3MGQC 3MGQB 3AYWC 3MGPB 1B67A 1P3FD 3B0CT 5JRGC 5KDMA 1P3MA 2YFVB 3NQJA 5JRGB 5AV5B 5B31G 3REKA 5B32G 5AVBD 1F1EA 3TU4A 2YFWB 1P3LC 4H9RA 3UTBA 3C1BA 3WTPD 1P3LB 3B0CW 3AV1A 3X1SC 4WU9A 3O62A 4LD9B 5FUGB 3X1SB 4J8XC 3KUYA 3REHB 4J8XB 4H9OB 3X1UA 3AN2D 1U35D 2PYOA 5B1MD 5GXQC 5GXQB 5C3IB 2RVQD 5AV8D 3REJC 1TAFB 5AVBC 4DRAA 1P3OD 1M18C 2F8NB 5AVBB 4J8VA 3UTAC 1P3AD 4G91C 4Z2MH 4WNNB 4XZQC 3UTAB 3W98D 3AFAD 3NQUA 4G91B 3C1CA 5BNVA 4JJNC 3AZHA 3LZ0A 4JJNB 3X1VD 1P3PC 3MGRD 4UUZB 5B40A 1P3PB 2BYMB 3MNNC 5B2IA 3MNNB 4YS3A 3AZMD 1U35C 5B1LD 3R45B 3W96A 4Z5TA 5JA4A 5B0ZA 1U35B 5BS7C 1P3BA 1HQ3C 3WKJD 1HQ3B 1EQZD 4J8UD 4R8PD 3AYWA 5G49A 4KHAA 5AV9D 3W98C 5JRGA 3W98B 5AVCC 3B6GA 4ZBJB 5AVCB 4Z66C 4XUJC 1P3LA 4Z66B 3MGRC 4XUJB 3MGRB 4WZSB 1S32C 4WU9D 5E5AC 5BO0A 1ID3C 1S32B 3KSYA 3X1SA 5B1LC 4AWLC 1P34C 2HIOC 3AZMB 5B1LB 3KWQC 2HIOB 4ZUXC 3KWQB 4J8XA 4ZUXB 3WKJB 1EQZC 1H3OB 5B33C 4KUDD 1EQZB 4J8UB 4R8PB 5B33B 3WAAD 5GXQA 1M1AC 5CPKA 3A6NA 3AV2D 1TAFA 5CP6A 3REJA 2HUEB 4CAYB 1M19A 1AOIA 3V9RA 1M18A 3REID 4WNNA 5GT0A 2F8NG 4XZQA 1BFMA 5DNNC 5DNNB 4X23D 3MGSA 2AROC 5GT3D 5F99A 5B0ZD 5B24D 5BT1C 3R45A 1P3BD 4KUDC 3MVDC 3AZIC 5AV6C 4KUDB 3MVDB 5CPJD 2NZDD 3AZEC 5AV6B 4H9PB 5B0YA 5AY8C 1P3IA 3AZEB 4H9QB 5AY8B 5GSUA 3RELD 4J8WC 3UT9C 3AZFD 2FJ7D 4J8WB 1TZYC 3LELA 3UT9B 3MGPC 3REIC 1TZYB 3AZLC 5DNMD 3REIB 3B0DB 3AZLB 5B31A 5B32A 5AV5C 4WU8A 1ZLAD 1KX3C 4Z66A 4CSRB 4X23B 3AZGA 4XUJA 1KX3B 2CV5D 2LY8A 1S32A 1P3KD 1ID3A 5E5AA 2NQBA 1P34A 2HIOA 4LD9C 5CPJC 3KWQA 3B6FD 3WA9C 5CPJB 4NE5A 3REHC 3WA9B 3AZND 2BYKB 4YM6D 3RELB 3KXBC 4WV4B 5CPKD 3AZFB 3KXBB 1F66D 5CP6D 1M1AA 1P3FC 5C3IC 5DNMB 5BNXA 3LZ1D 1P3FB 1AOID 5B2JD 3W99A 1ZLAC 1ZLAB 4QLCA 1P3KC 3WTPC 5DNNA 4H9NA 1P3KB 3WTPB 1WWIA 2AROA 1KX5A 3VH6A 5CPIA 3AZJA 3W97D 3AZNC 4YM6C 1P3GD 3X1TD 1KX4D 3AZNB 3AZIA 4YM6B 3AZKA 3AN2C 1F66C 5AY8A 3LJAD 5B1MC 3AN2B 2F8NH 1JFIB 1F66B 5B1MB 4KGCA 2RVQC 4J8WA 5AV8C 3LZ1B 5B2JB 3MGQA 5AV8B 3MGPA 1P3OC 5B32D 1P3MD 1P3OB 1P3AC 3REKD 2YFVA 3AFAC 5AV5A 3AZGD 1P3AB 4NE6A 3AFAB 4ZBJC 3TU4D 3UTBD 3C1BD 2YFWA 3X1VC 3X1VB 3AV1D 1P3GC 1KX4C 3O62D 1P3GB 3X1TB 1KX4B 4LD9A 1BH8B 5FUGA 3AZMC 3KUYD 3LJAC 1B6WA 3REHA 3LJAB 2JSSA 3WKJC 4H9OA 3X1UD 2PYOD 4J8UC 4R8PC 3W99D 1P3FA 5KDMB 1A7WA 5AV9C 3REKC 1P3MB 3NQJB 5AV9B 3REKB 2HUEC 4J8VD 2F8NA 5AVBA 4H9RB 3C1BB 3C1CD 3UTAA 3WTPA 3AV1C 3AZHD 1KX5D 3LZ0D 4WU9C 3AV1B 4WU9B 3AZJD 4JJNA 1BH9B 5B40D 4UUZA 3KUYB 1P3PA 2BYMA 5B2ID 4YS3D 3MNNA 3AZKD 3W96D 4Z5TD 1U35A 3AN2A 3WAAC 5B1MA 5BS7A 3WAAB 3AV2C 1HQ3A 3AV2B 5AV8A 3AYWD 4J8VC 3VH6T 1P3OA 4E44A 4J8VB 5JRGD 3B0DC 3NQUB 3C1CB 3AZHC 3W98A 3LZ0C 3B6GD 5BNVB 3AZHB 3LZ0B 5AVCA 4X23C 1P3LD 3X1VA 5GT3C 5B40B 3MGRA 3VH6W 5GT3B 3X1SD 5B0ZC 4Z5TC 5B24C 4YS3B 1P3BC 5B0ZB 5JA4B 4Z5TB 3AZMA 5B24B 5B1LA 1P3BB 4J8XD 2NZDC 2NZDB 4ZUXA 3WKJA 1H3OA 3RELC 1EQZA 4J8UA 4R8PA 5B33A 3AZFC 2FJ7C 3AYWB 5G49B 5GXQD 4E45A 3A6ND 2FJ7B 4KHAB 3REJD 5DNMC 5AV9A 3B6GC 2F8ND 1M19D 4CAYA 1R4VA 1M18D 3B6GB 4NE3A 3UTAD 5GT0D 4XZQD 1Q9CA 2CV5C 5BO0B 4JJND 3MGSD 2CV5B 1BH9A 1P3PD 5F99D 3MNND 3B6FC 2L5AA 3B6FB 4EO5C 4H9SC 4KUDA 3MVDA 4EO5B 5B0YD 5CPKC 3A6NC 1HQ3D 4H9PA 5AV6A 1P3ID 3WAAA 3AZEA 5CPKB 4H9QA 5GSUD 3A6NB 5CP6C 3AV2A 5CP6B 3REJB 1M19C 2IO5C 3LZ1C 3LELD 1AOIC 3VH5T 2IO5B 5B2JC 3UT9A 1M19B 5GT0C 1AOIB 3V9RB 4DRBA 1M18B 1TZYA 5GT0B 3REIA 5B31D 4XZQB 3AZLA 5AVCD 3MGSC 4WU8D 4Z66D 3MGSB 4X23A 4XUJD 4CSRA 5F99C 1KX3A 5F99B 5GT3A 1S32D 3VH5W 5E5AD 1ID3D 3W97C 2NQBD 1P34D 1N1JB 2HIOD 5B24A 3X1TC 1HTAA 3W97B 3KWQD 5CHLB 5B0YC 1ULYA 1P3IC 4ZUXD 2NZDA 5B0YB 5CPJA 4G92C 1P3IB 5GSUC 3WA9A 4G92B 5GSUB 2BYKA 5B33D 3RELA 3LELC 3AZFA 2FJ7A 3KXBA 3LELB 1M1AD 5B31C 5B32C 5DNMA 5B31B 1P3MC 4WU8C 5B32B 2F8NK 4WU8B 3AZGC 3AZGB 1ZLAA 3TU4C 4QLCD 1KU5A 3C1BC 3UTBC 5DNND 3TU4B 3UTBB 2CV5A 1ID3B 5E5AB 2NQBC 1WWSA 1P3KA 2NQBB 3WTPE 2AROD 4AWLB 1P34B 3O62C 5CPID 3O62B 3VH5A 3B6FA 3KUYC 4Z2MG 5BT1D 3MVDD 3AZID 3AZNA 5AV6D 4YM6A 3X1UC 4H9SA 3AZED 5AY8D 2CWEA 3X1UB 2PYOC 1M1AB 2PYOB 1JFIA 1F66A 4KGCD 4J8WD 3W99C 5BNXB 3UT9D 4NFTA 1TZYD 3LZ1A 3MGQD 3W99B 5B2JA 3MGPD 3AZLD 4QLCC 4QLCB 5AV5D 3C1CC 4H9NB 1P3AA 1KX3D 1KX5C
chains in the Genus database with same CATH superfamily
3AFAA 5CPIC 3EPHA 2AROB 2VQRA 3B0BA 3AZJC 1KX5B 5CPIB 5B40C 3AZJB 4HGAC 4M6BA 2Y2HA 1N1JA 3W97A 4HGAB 5B2IC 4LD9D 1P3GA 4YS3C 5B2IB 3AZIB 3AZKC 3X1TA 3W96C 1BH8A 1KX4A 3WA9D 3H0RC 3AZKB 3W96B 3REHD 3LJAA 4KGCC 3KXBD 4KGCB 3MGQC 2DF4C 2Y2JA 3MGQB 3AYWC 3MGPB 2XD5A 1B67A 1P3FD 3B0CT 1Z2CB 5JRGC 4UPKA 5KDMA 1P3MA 2YFVB 2Y2LA 3NQJA 5JRGB 5AV5B 3P5JB 5B31G 3REKA 5B32G 5AVBD 1F1EA 1W2EA 3TU4A 2YFWB 1P3LC 4H9RA 3UTBA 3C1BA 3WTPD 1P3LB 2BG1A 3B0CW 3AV1A 3X1SC 4WU9A 3O62A 4LD9B 5FUGB 3X1SB 4J8XC 3KUYA 3REHB 4J8XB 4H9OB 3X1UA 3AN2D 1U35D 2PYOA 5B1MD 5GXQC 5GXQB 5C3IB 2RVQD 5AV8D 3REJC 1TAFB 3FDDA 5AVBC 4DRAA 1P3OD 1M18C 2F8NB 5AVBB 4J8VA 3UTAC 1P3AD 4G91C 4Z2MH 4WNNB 4XZQC 3UTAB 3W98D 3AFAD 3NQUA 4G91B 3C1CA 5BNVA 4JJNC 3AZHA 3LZ0A 4JJNB 3X1VD 1P3PC 3MGRD 3EPJA 4UUZB 5B40A 3KFUG 1P3PB 2BYMB 3MNNC 5B2IA 3MNNB 4YS3A 3AZMD 1U35C 5B1LD 3R45B 3W96A 4Z5TA 5JA4A 5B0ZA 1U35B 5BS7C 1P3BA 1HQ3C 3WKJD 1HQ3B 1EQZD 4J8UD 4R8PD 2RIQA 4WJ3C 3AYWA 5G49A 4KHAA 5AV9D 3W98C 5JRGA 3W98B 5AVCC 3B6GA 4ZBJB 5AVCB 4Z66C 4XUJC 1P3LA 4Z66B 3MGRC 4XUJB 3MGRB 4WZSB 1S32C 4WU9D 5E5AC 5BO0A 2Y2OA 1ID3C 1S32B 3KSYA 3X1SA 5B1LC 4AWLC 1P34C 2HIOC 3AZMB 5B1LB 3KWQC 2HIOB 4ZUXC 3KWQB 4J8XA 4ZUXB 3WKJB 1EQZC 1H3OB 5B33C 4KUDD 1EQZB 4J8UB 4R8PB 5B33B 2ZM5A 3WAAD 2ZY4A 5GXQA 2Y2IA 1M1AC 5CPKA 3A6NA 3AV2D 1TAFA 5CP6A 3REJA 2HUEB 4CAYB 2G5IC 1M19A 1AOIA 3V9RA 1M18A 3REID 4WNNA 5GT0A 2Y2KA 2F8NG 4XZQA 1BFMA 5DNNC 5DNNB 4X23D 3MGSA 1PZRA 2ZY2A 2AROC 5GT3D 5F99A 2ZY5A 5B0ZD 5B24D 2ZY3A 3R45A 5BT1C 1P3BD 4KUDC 3MVDC 3AZIC 5AV6C 4KUDB 2FFFB 5CPJD 3MVDB 2UWXA 3AZEC 2NZDD 5AV6B 4H9PB 5B0YA 5AY8C 1P3IA 3AZEB 4H9QB 5AY8B 5GSUA 3RELD 4J8WC 3UT9C 3AZFD 2FJ7D 4J8WB 1TZYC 3LELA 3UT9B 3MGPC 3REIC 2F2AC 1TZYB 3AZLC 5DNMD 3REIB 3B0DB 3AZLB 5B31A 5B32A 5AV5C 4WU8A 1ZLAD 1KX3C 4Z66A 4CSRB 4X23B 3AZGA 4XUJA 1KX3B 2CV5D 2LY8A 1S32A 1P3KD 1ID3A 5E5AA 3IP4C 2NQBA 1P34A 2HIOA 4LD9C 5CPJC 3KWQA 3B6FD 3WA9C 5CPJB 3EPKA 4NE5A 3REHC 3WA9B 3AZND 2BYKB 4YM6D 3RELB 3KXBC 4WV4B 5CPKD 3AZFB 3KXBB 1F66D 5CP6D 1M1AA 1P3FC 5C3IC 5DNMB 5BNXA 3LZ1D 1P3FB 1AOID 5B2JD 3W99A 1ZLAC 1ZLAB 4QLCA 1P3KC 3WTPC 5DNNA 4H9NA 1P3KB 3WTPB 1WWIA 2AROA 1KX5A 3VH6A 5CPIA 3AZJA 3W97D 3AZNC 4YM6C 1P3GD 3X1TD 1KX4D 3AZNB 3AZIA 4YM6B 3AZKA 2DQNC 3AN2C 1F66C 5AY8A 3LJAD 5B1MC 3AN2B 2F8NH 1JFIB 1F66B 5B1MB 4KGCA 2RVQC 4J8WA 3A1KA 5AV8C 3LZ1B 5B2JB 3MGQA 5AV8B 3MGPA 1P3OC 5B32D 1P3MD 1P3OB 1P3AC 3REKD 2YFVA 3AFAC 5AV5A 3AZGD 1P3AB 4NE6A 3AFAB 4ZBJC 3TU4D 3UTBD 3C1BD 2YFWA 3X1VC 3X1VB 3AV1D 1P3GC 1KX4C 3O62D 1P3GB 3X1TB 1KX4B 4LD9A 1BH8B 5FUGA 3AZMC 3KUYD 3LJAC 3H0LC 1B6WA 3REHA 3LJAB 3AL0C 2JSSA 3WKJC 4H9OA 3X1UD 2PYOD 4J8UC 4R8PC 3W99D 1P3FA 3EG5B 5KDMB 1A7WA 5AV9C 3REKC 1P3MB 3NQJB 5AV9B 3REKB 2HUEC 4J8VD 2F8NA 5AVBA 4H9RB 3C1BB 3C1CD 3UTAA 3WTPA 3AV1C 3AZHD 1KX5D 3LZ0D 4WU9C 3AV1B 4WU9B 3AZJD 4JJNA 1BH9B 5B40D 4UUZA 3KUYB 1P3PA 2BYMA 5B2ID 4YS3D 3MNNA 3AZKD 3W96D 4Z5TD 3A1IA 1U35A 3AN2A 4DQYB 2XD1A 3WAAC 5B1MA 5BS7A 3WAAB 2JE5A 3AV2C 1HQ3A 3AV2B 5AV8A 3AYWD 3EPLA 4J8VC 3VH6T 1P3OA 4E44A 4J8VB 5JRGD 3B0DC 3NQUB 3C1CB 3AZHC 3W98A 3LZ0C 3B6GD 5BNVB 3AZHB 3LZ0B 5AVCA 4X23C 1P3LD 3X1VA 5GT3C 5B40B 3MGRA 3VH6W 5GT3B 3X1SD 5B0ZC 4Z5TC 5B24C 4YS3B 1P3BC 5B0ZB 5JA4B 4Z5TB 3AZMA 5B24B 5B1LA 1P3BB 4J8XD 2NZDC 2NZDB 4ZUXA 3WKJA 1H3OA 3RELC 1EQZA 4J8UA 4R8PA 5B33A 3AZFC 2FJ7C 3AYWB 5G49B 5GXQD 4E45A 3A6ND 2FJ7B 4KHAB 3REJD 5DNMC 5AV9A 3B6GC 2F8ND 1M19D 2Y2MA 4CAYA 1R4VA 1M18D 3B6GB 4NE3A 3UTAD 5GT0D 4XZQD 2Y2NA 1Q9CA 2JCHA 2CV5C 5BO0B 4JJND 3MGSD 2CV5B 1BH9A 1T3UA 1P3PD 5F99D 3MNND 3B6FC 2L5AA 3B6FB 4EO5C 4H9SC 4KUDA 3MVDA 4EO5B 5B0YD 5CPKC 3A6NC 1HQ3D 4H9PA 5AV6A 1P3ID 3WAAA 3AZEA 5CPKB 4H9QA 5GSUD 3A6NB 5CP6C 3AV2A 5CP6B 3REJB 1M19C 2IO5C 3LZ1C 3LELD 1AOIC 3VH5T 2IO5B 5B2JC 3UT9A 1M19B 5GT0C 1AOIB 3V9RB 4DRBA 1M18B 1TZYA 5GT0B 3REIA 5B31D 4XZQB 3AZLA 5AVCD 2W8SA 3MGSC 4WU8D 4Z66D 3MGSB 4X23A 4XUJD 4CSRA 5F99C 1KX3A 5F99B 5GT3A 1S32D 3VH5W 5E5AD 1ID3D 3W97C 2NQBD 1P34D 1N1JB 2HIOD 5B24A 3X1TC 1HTAA 3W97B 3KWQD 5CHLB 5B0YC 1ULYA 1P3IC 4ZUXD 2NZDA 5B0YB 5CPJA 4G92C 1P3IB 5GSUC 3WA9A 4G92B 2G5HC 5GSUB 2BYKA 5B33D 3RELA 3LELC 3AZFA 2FJ7A 3KXBA 3LELB 1M1AD 3H0MC 5B31C 5B32C 5DNMA 5B31B 1P3MC 4WU8C 5B32B 2F8NK 4WU8B 3AZGC 3AZGB 1ZLAA 3TU4C 4QLCD 1KU5A 3C1BC 3UTBC 3F6TA 5DNND 3TU4B 3UTBB 2CV5A 1ID3B 5E5AB 2NQBC 1WWSA 1P3KA 2NQBB 3WTPE 2AROD 4AWLB 1P34B 3O62C 5CPID 3O62B 3VH5A 3B6FA 3KUYC 4Z2MG 5BT1D 2Y2QA 3MVDD 3AZID 3AZNA 5AV6D 4YM6A 3X1UC 4H9SA 3AZED 5AY8D 2CWEA 3X1UB 2PYOC 1M1AB 2PYOB 1JFIA 1F66A 4KGCD 4J8WD 3W99C 5BNXB 3UT9D 4NFTA 2J8PA 2Y2GA 1TZYD 3LZ1A 3MGQD 3W99B 5B2JA 3MGPD 3AZLD 4QLCC 4QLCB 5AV5D 3C1CC 4H9NB 1P3AA 2Y2PA 1KX3D 1KX5C
chains in the Genus database with same CATH topology
3AFAA 5CPIC 3EPHA 2AROB 2VQRA 3B0BA 3AZJC 1KX5B 5CPIB 5B40C 3AZJB 4HGAC 4M6BA 2Y2HA 1N1JA 3W97A 4HGAB 5B2IC 4LD9D 1P3GA 4YS3C 5B2IB 3AZIB 3AZKC 3X1TA 3W96C 1BH8A 1KX4A 3WA9D 3H0RC 3AZKB 3W96B 3REHD 3LJAA 4KGCC 3KXBD 4KGCB 3MGQC 2DF4C 2Y2JA 3MGQB 3AYWC 3MGPB 2XD5A 1B67A 1P3FD 3B0CT 1Z2CB 5JRGC 4UPKA 5KDMA 1P3MA 2YFVB 2Y2LA 3NQJA 5JRGB 5AV5B 3P5JB 5B31G 3REKA 5B32G 5AVBD 1F1EA 1W2EA 3TU4A 2YFWB 1P3LC 4H9RA 3UTBA 3C1BA 3WTPD 1P3LB 2BG1A 3B0CW 3AV1A 3X1SC 4WU9A 3O62A 4LD9B 5FUGB 3X1SB 4J8XC 3KUYA 3REHB 4J8XB 4H9OB 3X1UA 3AN2D 1U35D 2PYOA 5B1MD 5GXQC 5GXQB 5C3IB 2RVQD 5AV8D 3REJC 1TAFB 3FDDA 5AVBC 4DRAA 1P3OD 1M18C 2F8NB 5AVBB 4J8VA 3UTAC 1P3AD 4G91C 4Z2MH 4WNNB 4XZQC 3UTAB 3W98D 3AFAD 3NQUA 4G91B 3C1CA 5BNVA 4JJNC 3AZHA 3LZ0A 4JJNB 3X1VD 1P3PC 3MGRD 3EPJA 4UUZB 5B40A 3KFUG 1P3PB 2BYMB 3MNNC 5B2IA 3MNNB 4YS3A 3AZMD 1U35C 5B1LD 3R45B 3W96A 4Z5TA 5JA4A 5B0ZA 1U35B 5BS7C 1P3BA 1HQ3C 3WKJD 1HQ3B 1EQZD 4J8UD 4R8PD 2RIQA 4WJ3C 3AYWA 5G49A 4KHAA 5AV9D 3W98C 5JRGA 3W98B 5AVCC 3B6GA 4ZBJB 5AVCB 4Z66C 4XUJC 1P3LA 4Z66B 3MGRC 4XUJB 3MGRB 4WZSB 1S32C 4WU9D 5E5AC 5BO0A 2Y2OA 1ID3C 1S32B 3KSYA 3X1SA 5B1LC 4AWLC 1P34C 2HIOC 3AZMB 5B1LB 3KWQC 2HIOB 4ZUXC 3KWQB 4J8XA 4ZUXB 3WKJB 1EQZC 1H3OB 5B33C 4KUDD 1EQZB 4J8UB 4R8PB 5B33B 2ZM5A 3WAAD 2ZY4A 5GXQA 2Y2IA 1M1AC 5CPKA 3A6NA 3AV2D 1TAFA 5CP6A 3REJA 2HUEB 4CAYB 2G5IC 1M19A 1AOIA 3V9RA 1M18A 3REID 4WNNA 5GT0A 2Y2KA 2F8NG 4XZQA 1BFMA 5DNNC 5DNNB 4X23D 3MGSA 1PZRA 2ZY2A 2AROC 5GT3D 5F99A 2ZY5A 5B0ZD 5B24D 2ZY3A 3R45A 5BT1C 1P3BD 4KUDC 3MVDC 3AZIC 5AV6C 4KUDB 2FFFB 5CPJD 3MVDB 2UWXA 3AZEC 2NZDD 5AV6B 4H9PB 5B0YA 5AY8C 1P3IA 3AZEB 4H9QB 5AY8B 5GSUA 3RELD 4J8WC 3UT9C 3AZFD 2FJ7D 4J8WB 1TZYC 3LELA 3UT9B 3MGPC 3REIC 2F2AC 1TZYB 3AZLC 5DNMD 3REIB 3B0DB 3AZLB 5B31A 5B32A 5AV5C 4WU8A 1ZLAD 1KX3C 4Z66A 4CSRB 4X23B 3AZGA 4XUJA 1KX3B 2CV5D 2LY8A 1S32A 1P3KD 1ID3A 5E5AA 3IP4C 2NQBA 1P34A 2HIOA 4LD9C 5CPJC 3KWQA 3B6FD 3WA9C 5CPJB 3EPKA 4NE5A 3REHC 3WA9B 3AZND 2BYKB 4YM6D 3RELB 3KXBC 4WV4B 5CPKD 3AZFB 3KXBB 1F66D 5CP6D 1M1AA 1P3FC 5C3IC 5DNMB 5BNXA 3LZ1D 1P3FB 1AOID 5B2JD 3W99A 1ZLAC 1ZLAB 4QLCA 1P3KC 3WTPC 5DNNA 4H9NA 1P3KB 3WTPB 1WWIA 2AROA 1KX5A 3VH6A 5CPIA 3AZJA 3W97D 3AZNC 4YM6C 1P3GD 3X1TD 1KX4D 3AZNB 3AZIA 4YM6B 3AZKA 2DQNC 3AN2C 1F66C 5AY8A 3LJAD 5B1MC 3AN2B 2F8NH 1JFIB 1F66B 5B1MB 4KGCA 2RVQC 4J8WA 3A1KA 5AV8C 3LZ1B 5B2JB 3MGQA 5AV8B 3MGPA 1P3OC 5B32D 1P3MD 1P3OB 1P3AC 3REKD 2YFVA 3AFAC 5AV5A 3AZGD 1P3AB 4NE6A 3AFAB 4ZBJC 3TU4D 3UTBD 3C1BD 2YFWA 3X1VC 3X1VB 3AV1D 1P3GC 1KX4C 3O62D 1P3GB 3X1TB 1KX4B 4LD9A 1BH8B 5FUGA 3AZMC 3KUYD 3LJAC 3H0LC 1B6WA 3REHA 3LJAB 3AL0C 2JSSA 3WKJC 4H9OA 3X1UD 2PYOD 4J8UC 4R8PC 3W99D 1P3FA 3EG5B 5KDMB 1A7WA 5AV9C 3REKC 1P3MB 3NQJB 5AV9B 3REKB 2HUEC 4J8VD 2F8NA 5AVBA 4H9RB 3C1BB 3C1CD 3UTAA 3WTPA 3AV1C 3AZHD 1KX5D 3LZ0D 4WU9C 3AV1B 4WU9B 3AZJD 4JJNA 1BH9B 5B40D 4UUZA 3KUYB 1P3PA 2BYMA 5B2ID 4YS3D 3MNNA 3AZKD 3W96D 4Z5TD 3A1IA 1U35A 3AN2A 4DQYB 2XD1A 3WAAC 5B1MA 5BS7A 3WAAB 2JE5A 3AV2C 1HQ3A 3AV2B 5AV8A 3AYWD 3EPLA 4J8VC 3VH6T 1P3OA 4E44A 4J8VB 5JRGD 3B0DC 3NQUB 3C1CB 3AZHC 3W98A 3LZ0C 3B6GD 5BNVB 3AZHB 3LZ0B 5AVCA 4X23C 1P3LD 3X1VA 5GT3C 5B40B 3MGRA 3VH6W 5GT3B 3X1SD 5B0ZC 4Z5TC 5B24C 4YS3B 1P3BC 5B0ZB 5JA4B 4Z5TB 3AZMA 5B24B 5B1LA 1P3BB 4J8XD 2NZDC 2NZDB 4ZUXA 3WKJA 1H3OA 3RELC 1EQZA 4J8UA 4R8PA 5B33A 3AZFC 2FJ7C 3AYWB 5G49B 5GXQD 4E45A 3A6ND 2FJ7B 4KHAB 3REJD 5DNMC 5AV9A 3B6GC 2F8ND 1M19D 2Y2MA 4CAYA 1R4VA 1M18D 3B6GB 4NE3A 3UTAD 5GT0D 4XZQD 2Y2NA 1Q9CA 2JCHA 2CV5C 5BO0B 4JJND 3MGSD 2CV5B 1BH9A 1T3UA 1P3PD 5F99D 3MNND 3B6FC 2L5AA 3B6FB 4EO5C 4H9SC 4KUDA 3MVDA 4EO5B 5B0YD 5CPKC 3A6NC 1HQ3D 4H9PA 5AV6A 1P3ID 3WAAA 3AZEA 5CPKB 4H9QA 5GSUD 3A6NB 5CP6C 3AV2A 5CP6B 3REJB 1M19C 2IO5C 3LZ1C 3LELD 1AOIC 3VH5T 2IO5B 5B2JC 3UT9A 1M19B 5GT0C 1AOIB 3V9RB 4DRBA 1M18B 1TZYA 5GT0B 3REIA 5B31D 4XZQB 3AZLA 5AVCD 2W8SA 3MGSC 4WU8D 4Z66D 3MGSB 4X23A 4XUJD 4CSRA 5F99C 1KX3A 5F99B 5GT3A 1S32D 3VH5W 5E5AD 1ID3D 3W97C 2NQBD 1P34D 1N1JB 2HIOD 5B24A 3X1TC 1HTAA 3W97B 3KWQD 5CHLB 5B0YC 1ULYA 1P3IC 4ZUXD 2NZDA 5B0YB 5CPJA 4G92C 1P3IB 5GSUC 3WA9A 4G92B 2G5HC 5GSUB 2BYKA 5B33D 3RELA 3LELC 3AZFA 2FJ7A 3KXBA 3LELB 1M1AD 3H0MC 5B31C 5B32C 5DNMA 5B31B 1P3MC 4WU8C 5B32B 2F8NK 4WU8B 3AZGC 3AZGB 1ZLAA 3TU4C 4QLCD 1KU5A 3C1BC 3UTBC 3F6TA 5DNND 3TU4B 3UTBB 2CV5A 1ID3B 5E5AB 2NQBC 1WWSA 1P3KA 2NQBB 3WTPE 2AROD 4AWLB 1P34B 3O62C 5CPID 3O62B 3VH5A 3B6FA 3KUYC 4Z2MG 5BT1D 2Y2QA 3MVDD 3AZID 3AZNA 5AV6D 4YM6A 3X1UC 4H9SA 3AZED 5AY8D 2CWEA 3X1UB 2PYOC 1M1AB 2PYOB 1JFIA 1F66A 4KGCD 4J8WD 3W99C 5BNXB 3UT9D 4NFTA 2J8PA 2Y2GA 1TZYD 3LZ1A 3MGQD 3W99B 5B2JA 3MGPD 3AZLD 4QLCC 4QLCB 5AV5D 3C1CC 4H9NB 1P3AA 2Y2PA 1KX3D 1KX5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AFA A;  5CPI C;  2ARO B;  3B0B A;  1KX5 B;  3AZJ C;  5CPI B;  5B40 C;  3AZJ B;  4HGA C;  4M6B A;  1N1J A;  3W97 A;  4HGA B;  5B2I C;  4LD9 D;  1P3G A;  4YS3 C;  5B2I B;  3AZI B;  3AZK C;  3X1T A;  3W96 C;  1BH8 A;  1KX4 A;  3WA9 D;  3AZK B;  3W96 B;  3REH D;  3LJA A;  4KGC C;  3KXB D;  4KGC B;  3MGQ C;  3MGQ B;  3AYW C;  3MGP B;  1B67 A;  1P3F D;  3B0C T;  5JRG C;  5KDM A;  1P3M A;  2YFV B;  3NQJ A;  5JRG B;  5AV5 B;  5B31 G;  3REK A;  5B32 G;  5AVB D;  1F1E A;  3TU4 A;  2YFW B;  1P3L C;  4H9R A;  3UTB A;  3C1B A;  3WTP D;  1P3L B;  3B0C W;  3AV1 A;  3X1S C;  4WU9 A;  3O62 A;  4LD9 B;  5FUG B;  3X1S B;  4J8X C;  3KUY A;  3REH B;  4J8X B;  4H9O B;  3X1U A;  3AN2 D;  1U35 D;  2PYO A;  5B1M D;  5GXQ C;  5GXQ B;  5C3I B;  2RVQ D;  5AV8 D;  3REJ C;  1TAF B;  5AVB C;  4DRA A;  1P3O D;  1M18 C;  2F8N B;  5AVB B;  4J8V A;  3UTA C;  1P3A D;  4G91 C;  4Z2M H;  4WNN B;  4XZQ C;  3UTA B;  3W98 D;  3AFA D;  3NQU A;  4G91 B;  3C1C A;  5BNV A;  4JJN C;  3AZH A;  3LZ0 A;  4JJN B;  3X1V D;  1P3P C;  3MGR D;  4UUZ B;  5B40 A;  1P3P B;  2BYM B;  3MNN C;  5B2I A;  3MNN B;  4YS3 A;  3AZM D;  1U35 C;  5B1L D;  3R45 B;  3W96 A;  4Z5T A;  5JA4 A;  5B0Z A;  1U35 B;  5BS7 C;  1P3B A;  1HQ3 C;  3WKJ D;  1HQ3 B;  1EQZ D;  4J8U D;  4R8P D;  3AYW A;  5G49 A;  4KHA A;  5AV9 D;  3W98 C;  5JRG A;  3W98 B;  5AVC C;  3B6G A;  4ZBJ B;  5AVC B;  4Z66 C;  4XUJ C;  1P3L A;  4Z66 B;  3MGR C;  4XUJ B;  3MGR B;  4WZS B;  1S32 C;  4WU9 D;  5E5A C;  5BO0 A;  1ID3 C;  1S32 B;  3KSY A;  3X1S A;  5B1L C;  4AWL C;  1P34 C;  2HIO C;  3AZM B;  5B1L B;  3KWQ C;  2HIO B;  4ZUX C;  3KWQ B;  4J8X A;  4ZUX B;  3WKJ B;  1EQZ C;  1H3O B;  5B33 C;  4KUD D;  1EQZ B;  4J8U B;  4R8P B;  5B33 B;  3WAA D;  5GXQ A;  1M1A C;  5CPK A;  3A6N A;  3AV2 D;  1TAF A;  5CP6 A;  3REJ A;  2HUE B;  4CAY B;  1M19 A;  1AOI A;  3V9R A;  1M18 A;  3REI D;  4WNN A;  5GT0 A;  2F8N G;  4XZQ A;  1BFM A;  5DNN C;  5DNN B;  4X23 D;  3MGS A;  2ARO C;  5GT3 D;  5F99 A;  5B0Z D;  5B24 D;  5BT1 C;  3R45 A;  1P3B D;  4KUD C;  3MVD C;  3AZI C;  5AV6 C;  4KUD B;  3MVD B;  5CPJ D;  2NZD D;  3AZE C;  5AV6 B;  4H9P B;  5B0Y A;  5AY8 C;  1P3I A;  3AZE B;  4H9Q B;  5AY8 B;  5GSU A;  3REL D;  4J8W C;  3UT9 C;  3AZF D;  2FJ7 D;  4J8W B;  1TZY C;  3LEL A;  3UT9 B;  3MGP C;  3REI C;  1TZY B;  3AZL C;  5DNM D;  3REI B;  3B0D B;  3AZL B;  5B31 A;  5B32 A;  5AV5 C;  4WU8 A;  1ZLA D;  1KX3 C;  4Z66 A;  4CSR B;  4X23 B;  3AZG A;  4XUJ A;  1KX3 B;  2CV5 D;  2LY8 A;  1S32 A;  1P3K D;  1ID3 A;  5E5A A;  2NQB A;  1P34 A;  2HIO A;  4LD9 C;  5CPJ C;  3KWQ A;  3B6F D;  3WA9 C;  5CPJ B;  4NE5 A;  3REH C;  3WA9 B;  3AZN D;  2BYK B;  4YM6 D;  3REL B;  3KXB C;  4WV4 B;  5CPK D;  3AZF B;  3KXB B;  1F66 D;  5CP6 D;  1M1A A;  1P3F C;  5C3I C;  5DNM B;  5BNX A;  3LZ1 D;  1P3F B;  1AOI D;  5B2J D;  3W99 A;  1ZLA C;  1ZLA B;  4QLC A;  1P3K C;  3WTP C;  5DNN A;  4H9N A;  1P3K B;  3WTP B;  1WWI A;  2ARO A;  1KX5 A;  3VH6 A;  5CPI A;  3AZJ A;  3W97 D;  3AZN C;  4YM6 C;  1P3G D;  3X1T D;  1KX4 D;  3AZN B;  3AZI A;  4YM6 B;  3AZK A;  3AN2 C;  1F66 C;  5AY8 A;  3LJA D;  5B1M C;  3AN2 B;  2F8N H;  1JFI B;  1F66 B;  5B1M B;  4KGC A;  2RVQ C;  4J8W A;  5AV8 C;  3LZ1 B;  5B2J B;  3MGQ A;  5AV8 B;  3MGP A;  1P3O C;  5B32 D;  1P3M D;  1P3O B;  1P3A C;  3REK D;  2YFV A;  3AFA C;  5AV5 A;  3AZG D;  1P3A B;  4NE6 A;  3AFA B;  4ZBJ C;  3TU4 D;  3UTB D;  3C1B D;  2YFW A;  3X1V C;  3X1V B;  3AV1 D;  1P3G C;  1KX4 C;  3O62 D;  1P3G B;  3X1T B;  1KX4 B;  4LD9 A;  1BH8 B;  5FUG A;  3AZM C;  3KUY D;  3LJA C;  1B6W A;  3REH A;  3LJA B;  2JSS A;  3WKJ C;  4H9O A;  3X1U D;  2PYO D;  4J8U C;  4R8P C;  3W99 D;  1P3F A;  5KDM B;  1A7W A;  5AV9 C;  3REK C;  1P3M B;  3NQJ B;  5AV9 B;  3REK B;  2HUE C;  4J8V D;  2F8N A;  5AVB A;  4H9R B;  3C1B B;  3C1C D;  3UTA A;  3WTP A;  3AV1 C;  3AZH D;  1KX5 D;  3LZ0 D;  4WU9 C;  3AV1 B;  4WU9 B;  3AZJ D;  4JJN A;  1BH9 B;  5B40 D;  4UUZ A;  3KUY B;  1P3P A;  2BYM A;  5B2I D;  4YS3 D;  3MNN A;  3AZK D;  3W96 D;  4Z5T D;  1U35 A;  3AN2 A;  3WAA C;  5B1M A;  5BS7 A;  3WAA B;  3AV2 C;  1HQ3 A;  3AV2 B;  5AV8 A;  3AYW D;  4J8V C;  3VH6 T;  1P3O A;  4E44 A;  4J8V B;  5JRG D;  3B0D C;  3NQU B;  3C1C B;  3AZH C;  3W98 A;  3LZ0 C;  3B6G D;  5BNV B;  3AZH B;  3LZ0 B;  5AVC A;  4X23 C;  1P3L D;  3X1V A;  5GT3 C;  5B40 B;  3MGR A;  3VH6 W;  5GT3 B;  3X1S D;  5B0Z C;  4Z5T C;  5B24 C;  4YS3 B;  1P3B C;  5B0Z B;  5JA4 B;  4Z5T B;  3AZM A;  5B24 B;  5B1L A;  1P3B B;  4J8X D;  2NZD C;  2NZD B;  4ZUX A;  3WKJ A;  1H3O A;  3REL C;  1EQZ A;  4J8U A;  4R8P A;  5B33 A;  3AZF C;  2FJ7 C;  3AYW B;  5G49 B;  5GXQ D;  4E45 A;  3A6N D;  2FJ7 B;  4KHA B;  3REJ D;  5DNM C;  5AV9 A;  3B6G C;  2F8N D;  1M19 D;  4CAY A;  1R4V A;  1M18 D;  3B6G B;  4NE3 A;  3UTA D;  5GT0 D;  4XZQ D;  1Q9C A;  2CV5 C;  5BO0 B;  4JJN D;  3MGS D;  2CV5 B;  1BH9 A;  1P3P D;  5F99 D;  3MNN D;  3B6F C;  2L5A A;  3B6F B;  4EO5 C;  4H9S C;  4KUD A;  3MVD A;  4EO5 B;  5B0Y D;  5CPK C;  3A6N C;  1HQ3 D;  4H9P A;  5AV6 A;  1P3I D;  3WAA A;  3AZE A;  5CPK B;  4H9Q A;  5GSU D;  3A6N B;  5CP6 C;  3AV2 A;  5CP6 B;  3REJ B;  1M19 C;  2IO5 C;  3LZ1 C;  3LEL D;  1AOI C;  3VH5 T;  2IO5 B;  5B2J C;  3UT9 A;  1M19 B;  5GT0 C;  1AOI B;  3V9R B;  4DRB A;  1M18 B;  1TZY A;  5GT0 B;  3REI A;  5B31 D;  4XZQ B;  3AZL A;  5AVC D;  3MGS C;  4WU8 D;  4Z66 D;  3MGS B;  4X23 A;  4XUJ D;  4CSR A;  5F99 C;  1KX3 A;  5F99 B;  5GT3 A;  1S32 D;  3VH5 W;  5E5A D;  1ID3 D;  3W97 C;  2NQB D;  1P34 D;  1N1J B;  2HIO D;  5B24 A;  3X1T C;  1HTA A;  3W97 B;  3KWQ D;  5CHL B;  5B0Y C;  1ULY A;  1P3I C;  4ZUX D;  2NZD A;  5B0Y B;  5CPJ A;  4G92 C;  1P3I B;  5GSU C;  3WA9 A;  4G92 B;  5GSU B;  2BYK A;  5B33 D;  3REL A;  3LEL C;  3AZF A;  2FJ7 A;  3KXB A;  3LEL B;  1M1A D;  5B31 C;  5B32 C;  5DNM A;  5B31 B;  1P3M C;  4WU8 C;  5B32 B;  2F8N K;  4WU8 B;  3AZG C;  3AZG B;  1ZLA A;  3TU4 C;  4QLC D;  1KU5 A;  3C1B C;  3UTB C;  5DNN D;  3TU4 B;  3UTB B;  2CV5 A;  1ID3 B;  5E5A B;  2NQB C;  1WWS A;  1P3K A;  2NQB B;  3WTP E;  2ARO D;  4AWL B;  1P34 B;  3O62 C;  5CPI D;  3O62 B;  3VH5 A;  3B6F A;  3KUY C;  4Z2M G;  5BT1 D;  3MVD D;  3AZI D;  3AZN A;  5AV6 D;  4YM6 A;  3X1U C;  4H9S A;  3AZE D;  5AY8 D;  2CWE A;  3X1U B;  2PYO C;  1M1A B;  2PYO B;  1JFI A;  1F66 A;  4KGC D;  4J8W D;  3W99 C;  5BNX B;  3UT9 D;  4NFT A;  1TZY D;  3LZ1 A;  3MGQ D;  3W99 B;  5B2J A;  3MGP D;  3AZL D;  4QLC C;  4QLC B;  5AV5 D;  3C1C C;  4H9N B;  1P3A A;  1KX3 D;  1KX5 C; 
#chains in the Genus database with same CATH topology
 3AFA A;  5CPI C;  3EPH A;  2ARO B;  2VQR A;  3B0B A;  3AZJ C;  1KX5 B;  5CPI B;  5B40 C;  3AZJ B;  4HGA C;  4M6B A;  2Y2H A;  1N1J A;  3W97 A;  4HGA B;  5B2I C;  4LD9 D;  1P3G A;  4YS3 C;  5B2I B;  3AZI B;  3AZK C;  3X1T A;  3W96 C;  1BH8 A;  1KX4 A;  3WA9 D;  3H0R C;  3AZK B;  3W96 B;  3REH D;  3LJA A;  4KGC C;  3KXB D;  4KGC B;  3MGQ C;  2DF4 C;  2Y2J A;  3MGQ B;  3AYW C;  3MGP B;  2XD5 A;  1B67 A;  1P3F D;  3B0C T;  1Z2C B;  5JRG C;  4UPK A;  5KDM A;  1P3M A;  2YFV B;  2Y2L A;  3NQJ A;  5JRG B;  5AV5 B;  3P5J B;  5B31 G;  3REK A;  5B32 G;  5AVB D;  1F1E A;  1W2E A;  3TU4 A;  2YFW B;  1P3L C;  4H9R A;  3UTB A;  3C1B A;  3WTP D;  1P3L B;  2BG1 A;  3B0C W;  3AV1 A;  3X1S C;  4WU9 A;  3O62 A;  4LD9 B;  5FUG B;  3X1S B;  4J8X C;  3KUY A;  3REH B;  4J8X B;  4H9O B;  3X1U A;  3AN2 D;  1U35 D;  2PYO A;  5B1M D;  5GXQ C;  5GXQ B;  5C3I B;  2RVQ D;  5AV8 D;  3REJ C;  1TAF B;  3FDD A;  5AVB C;  4DRA A;  1P3O D;  1M18 C;  2F8N B;  5AVB B;  4J8V A;  3UTA C;  1P3A D;  4G91 C;  4Z2M H;  4WNN B;  4XZQ C;  3UTA B;  3W98 D;  3AFA D;  3NQU A;  4G91 B;  3C1C A;  5BNV A;  4JJN C;  3AZH A;  3LZ0 A;  4JJN B;  3X1V D;  1P3P C;  3MGR D;  3EPJ A;  4UUZ B;  5B40 A;  3KFU G;  1P3P B;  2BYM B;  3MNN C;  5B2I A;  3MNN B;  4YS3 A;  3AZM D;  1U35 C;  5B1L D;  3R45 B;  3W96 A;  4Z5T A;  5JA4 A;  5B0Z A;  1U35 B;  5BS7 C;  1P3B A;  1HQ3 C;  3WKJ D;  1HQ3 B;  1EQZ D;  4J8U D;  4R8P D;  2RIQ A;  4WJ3 C;  3AYW A;  5G49 A;  4KHA A;  5AV9 D;  3W98 C;  5JRG A;  3W98 B;  5AVC C;  3B6G A;  4ZBJ B;  5AVC B;  4Z66 C;  4XUJ C;  1P3L A;  4Z66 B;  3MGR C;  4XUJ B;  3MGR B;  4WZS B;  1S32 C;  4WU9 D;  5E5A C;  5BO0 A;  2Y2O A;  1ID3 C;  1S32 B;  3KSY A;  3X1S A;  5B1L C;  4AWL C;  1P34 C;  2HIO C;  3AZM B;  5B1L B;  3KWQ C;  2HIO B;  4ZUX C;  3KWQ B;  4J8X A;  4ZUX B;  3WKJ B;  1EQZ C;  1H3O B;  5B33 C;  4KUD D;  1EQZ B;  4J8U B;  4R8P B;  5B33 B;  2ZM5 A;  3WAA D;  2ZY4 A;  5GXQ A;  2Y2I A;  1M1A C;  5CPK A;  3A6N A;  3AV2 D;  1TAF A;  5CP6 A;  3REJ A;  2HUE B;  4CAY B;  2G5I C;  1M19 A;  1AOI A;  3V9R A;  1M18 A;  3REI D;  4WNN A;  5GT0 A;  2Y2K A;  2F8N G;  4XZQ A;  1BFM A;  5DNN C;  5DNN B;  4X23 D;  3MGS A;  1PZR A;  2ZY2 A;  2ARO C;  5GT3 D;  5F99 A;  2ZY5 A;  5B0Z D;  5B24 D;  2ZY3 A;  3R45 A;  5BT1 C;  1P3B D;  4KUD C;  3MVD C;  3AZI C;  5AV6 C;  4KUD B;  2FFF B;  5CPJ D;  3MVD B;  2UWX A;  3AZE C;  2NZD D;  5AV6 B;  4H9P B;  5B0Y A;  5AY8 C;  1P3I A;  3AZE B;  4H9Q B;  5AY8 B;  5GSU A;  3REL D;  4J8W C;  3UT9 C;  3AZF D;  2FJ7 D;  4J8W B;  1TZY C;  3LEL A;  3UT9 B;  3MGP C;  3REI C;  2F2A C;  1TZY B;  3AZL C;  5DNM D;  3REI B;  3B0D B;  3AZL B;  5B31 A;  5B32 A;  5AV5 C;  4WU8 A;  1ZLA D;  1KX3 C;  4Z66 A;  4CSR B;  4X23 B;  3AZG A;  4XUJ A;  1KX3 B;  2CV5 D;  2LY8 A;  1S32 A;  1P3K D;  1ID3 A;  5E5A A;  3IP4 C;  2NQB A;  1P34 A;  2HIO A;  4LD9 C;  5CPJ C;  3KWQ A;  3B6F D;  3WA9 C;  5CPJ B;  3EPK A;  4NE5 A;  3REH C;  3WA9 B;  3AZN D;  2BYK B;  4YM6 D;  3REL B;  3KXB C;  4WV4 B;  5CPK D;  3AZF B;  3KXB B;  1F66 D;  5CP6 D;  1M1A A;  1P3F C;  5C3I C;  5DNM B;  5BNX A;  3LZ1 D;  1P3F B;  1AOI D;  5B2J D;  3W99 A;  1ZLA C;  1ZLA B;  4QLC A;  1P3K C;  3WTP C;  5DNN A;  4H9N A;  1P3K B;  3WTP B;  1WWI A;  2ARO A;  1KX5 A;  3VH6 A;  5CPI A;  3AZJ A;  3W97 D;  3AZN C;  4YM6 C;  1P3G D;  3X1T D;  1KX4 D;  3AZN B;  3AZI A;  4YM6 B;  3AZK A;  2DQN C;  3AN2 C;  1F66 C;  5AY8 A;  3LJA D;  5B1M C;  3AN2 B;  2F8N H;  1JFI B;  1F66 B;  5B1M B;  4KGC A;  2RVQ C;  4J8W A;  3A1K A;  5AV8 C;  3LZ1 B;  5B2J B;  3MGQ A;  5AV8 B;  3MGP A;  1P3O C;  5B32 D;  1P3M D;  1P3O B;  1P3A C;  3REK D;  2YFV A;  3AFA C;  5AV5 A;  3AZG D;  1P3A B;  4NE6 A;  3AFA B;  4ZBJ C;  3TU4 D;  3UTB D;  3C1B D;  2YFW A;  3X1V C;  3X1V B;  3AV1 D;  1P3G C;  1KX4 C;  3O62 D;  1P3G B;  3X1T B;  1KX4 B;  4LD9 A;  1BH8 B;  5FUG A;  3AZM C;  3KUY D;  3LJA C;  3H0L C;  1B6W A;  3REH A;  3LJA B;  3AL0 C;  2JSS A;  3WKJ C;  4H9O A;  3X1U D;  2PYO D;  4J8U C;  4R8P C;  3W99 D;  1P3F A;  3EG5 B;  5KDM B;  1A7W A;  5AV9 C;  3REK C;  1P3M B;  3NQJ B;  5AV9 B;  3REK B;  2HUE C;  4J8V D;  2F8N A;  5AVB A;  4H9R B;  3C1B B;  3C1C D;  3UTA A;  3WTP A;  3AV1 C;  3AZH D;  1KX5 D;  3LZ0 D;  4WU9 C;  3AV1 B;  4WU9 B;  3AZJ D;  4JJN A;  1BH9 B;  5B40 D;  4UUZ A;  3KUY B;  1P3P A;  2BYM A;  5B2I D;  4YS3 D;  3MNN A;  3AZK D;  3W96 D;  4Z5T D;  3A1I A;  1U35 A;  3AN2 A;  4DQY B;  2XD1 A;  3WAA C;  5B1M A;  5BS7 A;  3WAA B;  2JE5 A;  3AV2 C;  1HQ3 A;  3AV2 B;  5AV8 A;  3AYW D;  3EPL A;  4J8V C;  3VH6 T;  1P3O A;  4E44 A;  4J8V B;  5JRG D;  3B0D C;  3NQU B;  3C1C B;  3AZH C;  3W98 A;  3LZ0 C;  3B6G D;  5BNV B;  3AZH B;  3LZ0 B;  5AVC A;  4X23 C;  1P3L D;  3X1V A;  5GT3 C;  5B40 B;  3MGR A;  3VH6 W;  5GT3 B;  3X1S D;  5B0Z C;  4Z5T C;  5B24 C;  4YS3 B;  1P3B C;  5B0Z B;  5JA4 B;  4Z5T B;  3AZM A;  5B24 B;  5B1L A;  1P3B B;  4J8X D;  2NZD C;  2NZD B;  4ZUX A;  3WKJ A;  1H3O A;  3REL C;  1EQZ A;  4J8U A;  4R8P A;  5B33 A;  3AZF C;  2FJ7 C;  3AYW B;  5G49 B;  5GXQ D;  4E45 A;  3A6N D;  2FJ7 B;  4KHA B;  3REJ D;  5DNM C;  5AV9 A;  3B6G C;  2F8N D;  1M19 D;  2Y2M A;  4CAY A;  1R4V A;  1M18 D;  3B6G B;  4NE3 A;  3UTA D;  5GT0 D;  4XZQ D;  2Y2N A;  1Q9C A;  2JCH A;  2CV5 C;  5BO0 B;  4JJN D;  3MGS D;  2CV5 B;  1BH9 A;  1T3U A;  1P3P D;  5F99 D;  3MNN D;  3B6F C;  2L5A A;  3B6F B;  4EO5 C;  4H9S C;  4KUD A;  3MVD A;  4EO5 B;  5B0Y D;  5CPK C;  3A6N C;  1HQ3 D;  4H9P A;  5AV6 A;  1P3I D;  3WAA A;  3AZE A;  5CPK B;  4H9Q A;  5GSU D;  3A6N B;  5CP6 C;  3AV2 A;  5CP6 B;  3REJ B;  1M19 C;  2IO5 C;  3LZ1 C;  3LEL D;  1AOI C;  3VH5 T;  2IO5 B;  5B2J C;  3UT9 A;  1M19 B;  5GT0 C;  1AOI B;  3V9R B;  4DRB A;  1M18 B;  1TZY A;  5GT0 B;  3REI A;  5B31 D;  4XZQ B;  3AZL A;  5AVC D;  2W8S A;  3MGS C;  4WU8 D;  4Z66 D;  3MGS B;  4X23 A;  4XUJ D;  4CSR A;  5F99 C;  1KX3 A;  5F99 B;  5GT3 A;  1S32 D;  3VH5 W;  5E5A D;  1ID3 D;  3W97 C;  2NQB D;  1P34 D;  1N1J B;  2HIO D;  5B24 A;  3X1T C;  1HTA A;  3W97 B;  3KWQ D;  5CHL B;  5B0Y C;  1ULY A;  1P3I C;  4ZUX D;  2NZD A;  5B0Y B;  5CPJ A;  4G92 C;  1P3I B;  5GSU C;  3WA9 A;  4G92 B;  2G5H C;  5GSU B;  2BYK A;  5B33 D;  3REL A;  3LEL C;  3AZF A;  2FJ7 A;  3KXB A;  3LEL B;  1M1A D;  3H0M C;  5B31 C;  5B32 C;  5DNM A;  5B31 B;  1P3M C;  4WU8 C;  5B32 B;  2F8N K;  4WU8 B;  3AZG C;  3AZG B;  1ZLA A;  3TU4 C;  4QLC D;  1KU5 A;  3C1B C;  3UTB C;  3F6T A;  5DNN D;  3TU4 B;  3UTB B;  2CV5 A;  1ID3 B;  5E5A B;  2NQB C;  1WWS A;  1P3K A;  2NQB B;  3WTP E;  2ARO D;  4AWL B;  1P34 B;  3O62 C;  5CPI D;  3O62 B;  3VH5 A;  3B6F A;  3KUY C;  4Z2M G;  5BT1 D;  2Y2Q A;  3MVD D;  3AZI D;  3AZN A;  5AV6 D;  4YM6 A;  3X1U C;  4H9S A;  3AZE D;  5AY8 D;  2CWE A;  3X1U B;  2PYO C;  1M1A B;  2PYO B;  1JFI A;  1F66 A;  4KGC D;  4J8W D;  3W99 C;  5BNX B;  3UT9 D;  4NFT A;  2J8P A;  2Y2G A;  1TZY D;  3LZ1 A;  3MGQ D;  3W99 B;  5B2J A;  3MGP D;  3AZL D;  4QLC C;  4QLC B;  5AV5 D;  3C1C C;  4H9N B;  1P3A A;  2Y2P A;  1KX3 D;  1KX5 C; 
#chains in the Genus database with same CATH homology
 3AFA A;  5CPI C;  3EPH A;  2ARO B;  2VQR A;  3B0B A;  3AZJ C;  1KX5 B;  5CPI B;  5B40 C;  3AZJ B;  4HGA C;  4M6B A;  2Y2H A;  1N1J A;  3W97 A;  4HGA B;  5B2I C;  4LD9 D;  1P3G A;  4YS3 C;  5B2I B;  3AZI B;  3AZK C;  3X1T A;  3W96 C;  1BH8 A;  1KX4 A;  3WA9 D;  3H0R C;  3AZK B;  3W96 B;  3REH D;  3LJA A;  4KGC C;  3KXB D;  4KGC B;  3MGQ C;  2DF4 C;  2Y2J A;  3MGQ B;  3AYW C;  3MGP B;  2XD5 A;  1B67 A;  1P3F D;  3B0C T;  1Z2C B;  5JRG C;  4UPK A;  5KDM A;  1P3M A;  2YFV B;  2Y2L A;  3NQJ A;  5JRG B;  5AV5 B;  3P5J B;  5B31 G;  3REK A;  5B32 G;  5AVB D;  1F1E A;  1W2E A;  3TU4 A;  2YFW B;  1P3L C;  4H9R A;  3UTB A;  3C1B A;  3WTP D;  1P3L B;  2BG1 A;  3B0C W;  3AV1 A;  3X1S C;  4WU9 A;  3O62 A;  4LD9 B;  5FUG B;  3X1S B;  4J8X C;  3KUY A;  3REH B;  4J8X B;  4H9O B;  3X1U A;  3AN2 D;  1U35 D;  2PYO A;  5B1M D;  5GXQ C;  5GXQ B;  5C3I B;  2RVQ D;  5AV8 D;  3REJ C;  1TAF B;  3FDD A;  5AVB C;  4DRA A;  1P3O D;  1M18 C;  2F8N B;  5AVB B;  4J8V A;  3UTA C;  1P3A D;  4G91 C;  4Z2M H;  4WNN B;  4XZQ C;  3UTA B;  3W98 D;  3AFA D;  3NQU A;  4G91 B;  3C1C A;  5BNV A;  4JJN C;  3AZH A;  3LZ0 A;  4JJN B;  3X1V D;  1P3P C;  3MGR D;  3EPJ A;  4UUZ B;  5B40 A;  3KFU G;  1P3P B;  2BYM B;  3MNN C;  5B2I A;  3MNN B;  4YS3 A;  3AZM D;  1U35 C;  5B1L D;  3R45 B;  3W96 A;  4Z5T A;  5JA4 A;  5B0Z A;  1U35 B;  5BS7 C;  1P3B A;  1HQ3 C;  3WKJ D;  1HQ3 B;  1EQZ D;  4J8U D;  4R8P D;  2RIQ A;  4WJ3 C;  3AYW A;  5G49 A;  4KHA A;  5AV9 D;  3W98 C;  5JRG A;  3W98 B;  5AVC C;  3B6G A;  4ZBJ B;  5AVC B;  4Z66 C;  4XUJ C;  1P3L A;  4Z66 B;  3MGR C;  4XUJ B;  3MGR B;  4WZS B;  1S32 C;  4WU9 D;  5E5A C;  5BO0 A;  2Y2O A;  1ID3 C;  1S32 B;  3KSY A;  3X1S A;  5B1L C;  4AWL C;  1P34 C;  2HIO C;  3AZM B;  5B1L B;  3KWQ C;  2HIO B;  4ZUX C;  3KWQ B;  4J8X A;  4ZUX B;  3WKJ B;  1EQZ C;  1H3O B;  5B33 C;  4KUD D;  1EQZ B;  4J8U B;  4R8P B;  5B33 B;  2ZM5 A;  3WAA D;  2ZY4 A;  5GXQ A;  2Y2I A;  1M1A C;  5CPK A;  3A6N A;  3AV2 D;  1TAF A;  5CP6 A;  3REJ A;  2HUE B;  4CAY B;  2G5I C;  1M19 A;  1AOI A;  3V9R A;  1M18 A;  3REI D;  4WNN A;  5GT0 A;  2Y2K A;  2F8N G;  4XZQ A;  1BFM A;  5DNN C;  5DNN B;  4X23 D;  3MGS A;  1PZR A;  2ZY2 A;  2ARO C;  5GT3 D;  5F99 A;  2ZY5 A;  5B0Z D;  5B24 D;  2ZY3 A;  3R45 A;  5BT1 C;  1P3B D;  4KUD C;  3MVD C;  3AZI C;  5AV6 C;  4KUD B;  2FFF B;  5CPJ D;  3MVD B;  2UWX A;  3AZE C;  2NZD D;  5AV6 B;  4H9P B;  5B0Y A;  5AY8 C;  1P3I A;  3AZE B;  4H9Q B;  5AY8 B;  5GSU A;  3REL D;  4J8W C;  3UT9 C;  3AZF D;  2FJ7 D;  4J8W B;  1TZY C;  3LEL A;  3UT9 B;  3MGP C;  3REI C;  2F2A C;  1TZY B;  3AZL C;  5DNM D;  3REI B;  3B0D B;  3AZL B;  5B31 A;  5B32 A;  5AV5 C;  4WU8 A;  1ZLA D;  1KX3 C;  4Z66 A;  4CSR B;  4X23 B;  3AZG A;  4XUJ A;  1KX3 B;  2CV5 D;  2LY8 A;  1S32 A;  1P3K D;  1ID3 A;  5E5A A;  3IP4 C;  2NQB A;  1P34 A;  2HIO A;  4LD9 C;  5CPJ C;  3KWQ A;  3B6F D;  3WA9 C;  5CPJ B;  3EPK A;  4NE5 A;  3REH C;  3WA9 B;  3AZN D;  2BYK B;  4YM6 D;  3REL B;  3KXB C;  4WV4 B;  5CPK D;  3AZF B;  3KXB B;  1F66 D;  5CP6 D;  1M1A A;  1P3F C;  5C3I C;  5DNM B;  5BNX A;  3LZ1 D;  1P3F B;  1AOI D;  5B2J D;  3W99 A;  1ZLA C;  1ZLA B;  4QLC A;  1P3K C;  3WTP C;  5DNN A;  4H9N A;  1P3K B;  3WTP B;  1WWI A;  2ARO A;  1KX5 A;  3VH6 A;  5CPI A;  3AZJ A;  3W97 D;  3AZN C;  4YM6 C;  1P3G D;  3X1T D;  1KX4 D;  3AZN B;  3AZI A;  4YM6 B;  3AZK A;  2DQN C;  3AN2 C;  1F66 C;  5AY8 A;  3LJA D;  5B1M C;  3AN2 B;  2F8N H;  1JFI B;  1F66 B;  5B1M B;  4KGC A;  2RVQ C;  4J8W A;  3A1K A;  5AV8 C;  3LZ1 B;  5B2J B;  3MGQ A;  5AV8 B;  3MGP A;  1P3O C;  5B32 D;  1P3M D;  1P3O B;  1P3A C;  3REK D;  2YFV A;  3AFA C;  5AV5 A;  3AZG D;  1P3A B;  4NE6 A;  3AFA B;  4ZBJ C;  3TU4 D;  3UTB D;  3C1B D;  2YFW A;  3X1V C;  3X1V B;  3AV1 D;  1P3G C;  1KX4 C;  3O62 D;  1P3G B;  3X1T B;  1KX4 B;  4LD9 A;  1BH8 B;  5FUG A;  3AZM C;  3KUY D;  3LJA C;  3H0L C;  1B6W A;  3REH A;  3LJA B;  3AL0 C;  2JSS A;  3WKJ C;  4H9O A;  3X1U D;  2PYO D;  4J8U C;  4R8P C;  3W99 D;  1P3F A;  3EG5 B;  5KDM B;  1A7W A;  5AV9 C;  3REK C;  1P3M B;  3NQJ B;  5AV9 B;  3REK B;  2HUE C;  4J8V D;  2F8N A;  5AVB A;  4H9R B;  3C1B B;  3C1C D;  3UTA A;  3WTP A;  3AV1 C;  3AZH D;  1KX5 D;  3LZ0 D;  4WU9 C;  3AV1 B;  4WU9 B;  3AZJ D;  4JJN A;  1BH9 B;  5B40 D;  4UUZ A;  3KUY B;  1P3P A;  2BYM A;  5B2I D;  4YS3 D;  3MNN A;  3AZK D;  3W96 D;  4Z5T D;  3A1I A;  1U35 A;  3AN2 A;  4DQY B;  2XD1 A;  3WAA C;  5B1M A;  5BS7 A;  3WAA B;  2JE5 A;  3AV2 C;  1HQ3 A;  3AV2 B;  5AV8 A;  3AYW D;  3EPL A;  4J8V C;  3VH6 T;  1P3O A;  4E44 A;  4J8V B;  5JRG D;  3B0D C;  3NQU B;  3C1C B;  3AZH C;  3W98 A;  3LZ0 C;  3B6G D;  5BNV B;  3AZH B;  3LZ0 B;  5AVC A;  4X23 C;  1P3L D;  3X1V A;  5GT3 C;  5B40 B;  3MGR A;  3VH6 W;  5GT3 B;  3X1S D;  5B0Z C;  4Z5T C;  5B24 C;  4YS3 B;  1P3B C;  5B0Z B;  5JA4 B;  4Z5T B;  3AZM A;  5B24 B;  5B1L A;  1P3B B;  4J8X D;  2NZD C;  2NZD B;  4ZUX A;  3WKJ A;  1H3O A;  3REL C;  1EQZ A;  4J8U A;  4R8P A;  5B33 A;  3AZF C;  2FJ7 C;  3AYW B;  5G49 B;  5GXQ D;  4E45 A;  3A6N D;  2FJ7 B;  4KHA B;  3REJ D;  5DNM C;  5AV9 A;  3B6G C;  2F8N D;  1M19 D;  2Y2M A;  4CAY A;  1R4V A;  1M18 D;  3B6G B;  4NE3 A;  3UTA D;  5GT0 D;  4XZQ D;  2Y2N A;  1Q9C A;  2JCH A;  2CV5 C;  5BO0 B;  4JJN D;  3MGS D;  2CV5 B;  1BH9 A;  1T3U A;  1P3P D;  5F99 D;  3MNN D;  3B6F C;  2L5A A;  3B6F B;  4EO5 C;  4H9S C;  4KUD A;  3MVD A;  4EO5 B;  5B0Y D;  5CPK C;  3A6N C;  1HQ3 D;  4H9P A;  5AV6 A;  1P3I D;  3WAA A;  3AZE A;  5CPK B;  4H9Q A;  5GSU D;  3A6N B;  5CP6 C;  3AV2 A;  5CP6 B;  3REJ B;  1M19 C;  2IO5 C;  3LZ1 C;  3LEL D;  1AOI C;  3VH5 T;  2IO5 B;  5B2J C;  3UT9 A;  1M19 B;  5GT0 C;  1AOI B;  3V9R B;  4DRB A;  1M18 B;  1TZY A;  5GT0 B;  3REI A;  5B31 D;  4XZQ B;  3AZL A;  5AVC D;  2W8S A;  3MGS C;  4WU8 D;  4Z66 D;  3MGS B;  4X23 A;  4XUJ D;  4CSR A;  5F99 C;  1KX3 A;  5F99 B;  5GT3 A;  1S32 D;  3VH5 W;  5E5A D;  1ID3 D;  3W97 C;  2NQB D;  1P34 D;  1N1J B;  2HIO D;  5B24 A;  3X1T C;  1HTA A;  3W97 B;  3KWQ D;  5CHL B;  5B0Y C;  1ULY A;  1P3I C;  4ZUX D;  2NZD A;  5B0Y B;  5CPJ A;  4G92 C;  1P3I B;  5GSU C;  3WA9 A;  4G92 B;  2G5H C;  5GSU B;  2BYK A;  5B33 D;  3REL A;  3LEL C;  3AZF A;  2FJ7 A;  3KXB A;  3LEL B;  1M1A D;  3H0M C;  5B31 C;  5B32 C;  5DNM A;  5B31 B;  1P3M C;  4WU8 C;  5B32 B;  2F8N K;  4WU8 B;  3AZG C;  3AZG B;  1ZLA A;  3TU4 C;  4QLC D;  1KU5 A;  3C1B C;  3UTB C;  3F6T A;  5DNN D;  3TU4 B;  3UTB B;  2CV5 A;  1ID3 B;  5E5A B;  2NQB C;  1WWS A;  1P3K A;  2NQB B;  3WTP E;  2ARO D;  4AWL B;  1P34 B;  3O62 C;  5CPI D;  3O62 B;  3VH5 A;  3B6F A;  3KUY C;  4Z2M G;  5BT1 D;  2Y2Q A;  3MVD D;  3AZI D;  3AZN A;  5AV6 D;  4YM6 A;  3X1U C;  4H9S A;  3AZE D;  5AY8 D;  2CWE A;  3X1U B;  2PYO C;  1M1A B;  2PYO B;  1JFI A;  1F66 A;  4KGC D;  4J8W D;  3W99 C;  5BNX B;  3UT9 D;  4NFT A;  2J8P A;  2Y2G A;  1TZY D;  3LZ1 A;  3MGQ D;  3W99 B;  5B2J A;  3MGP D;  3AZL D;  4QLC C;  4QLC B;  5AV5 D;  3C1C C;  4H9N B;  1P3A A;  2Y2P A;  1KX3 D;  1KX5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...