1P3KD

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
92
structure length
92
Chain Sequence
KESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 35
structure length 92
sequence length 92
chains with identical sequence H
ec nomenclature
pdb deposition date 2003-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3kD00
5JRGD 3RELB 4Z66A 3WAAD 1P34C 5F99C 1M18C 3UT9C 3REIB 5AY8D 1P3FD 5B31D 3W96D 3AZLA 4LD9B 4ZBJB 3C1CC 1U35D 3AZKD 3AZIC 3MGQA 3A6NA 4E44A 3KSYA 3REHA 4R8PD 2BYKA 4KUDD 4J8WA 1M19D 1P3ID 5AVCA 1KX4B 4WU9A 3TU4C 5DNNA 4X23A 2BYKB 5AV6A 4EO5B 3LJAB 5JRGA 5B0ZB 3WKJB 1P3PD 3WAAA 3REIC 5DNMA 4H9OA 4J8UB 2HIOD 5BS7C 1HTAA 5B33A 4LD9C 3X1SB 4HGAB 5DNNB 5BT1C 5AY8A 1P3FA 5B31A 3W96A 3B6FB 3B6GD 1BH8B 3W98B 5B33B 5AVBB 4M6BA 1BH9A 3VH6T 1U35A 3AZKA 4CSRB 5GXQD 3REJD 1P3KB 3MGQC 3W99B 5CPID 3AV2B 3W97B 1F1EA 1TZYD 4KUDA 4AWLC 3UTBB 5GT0D 3REKB 3X1VA 1P3IA 3LJAC 1WWIA 5B0ZC 1P3BD 3WKJC 4J8WC 4J8UC 2FJ7B 3AYWB 1M1AD 3WTPD 3X1SC 4WU9C 5DNNC 3AZGD 1P3PA 2NQBD 5AV6C 4Z2MG 5JRGC 3C1BB 2HIOA 3WAAC 3B6FC 5DNMC 3W98C 3LELA 5B33C 5CPJB 5AVBC 1KX5B 1P3FC 4JJND 3W99C 5CP6A 1P3KC 3LELB 4KHAA 1H3OB 3AV2C 5GXQA 5KDMA 3VH6W 3UTBC 3REKC 5BO0A 5CPIA 3WA9B 4WNNB 4DRAA 5CP6B 1TZYA 3AN2A 2FJ7C 3AYWC 3AZJA 1P3MD 2NZDD 1P3BA 2AROD 4KUDC 3V9RA 5CPKA 3R45A 3X1VC 1HQ3B 5B2IA 3MNNB 5GT3B 3X1TB 2BYMA 3X1UD 1M1AA 4H9QB 1P34B 4YM6D 3AZGA 3AZND 1JFIA 2NQBA 3MVDA 3AZJB 1KX3D 1KX5C 1M18B 2RVQD 1AOIB 3MGRD 1S32D 4WV4B 3AZHD 5AV5D 3LELC 4H9PB 4JJNA 4Z5TB 1ID3D 3O62B 1EQZD 3UTAB 3LZ1A 3WA9C 3AZED 4KGCB 3NQJA 5CP6C 1ZLAD 5FUGA 4J8VA 3LZ1B 3KUYA 1HQ3C 5GT3C 5B2JD 2NZDA 1P3MA 1TZYC 4J8XD 2AROA 3AZMD 5B24A 3AN2C 5GSUA 4WU8D 3TU4B 3VH5A 3AZJC 3KWQD 5AV8D 5E5AD 3X1UA 3KUYB 5CPKC 1P3GB 5B2IC 1KX4D 1F66D 5BNVB 3AZNA 2CV5D 1AOIC 3MGSD 1M1AC 4Z66B 5G49A 1KX3A 3MGPD 3AV1A 5B24B 5GSUB 3MVDC 4Z5TC 3O62C 3AFAD 3MGRA 1S32A 4CAYA 3UTAC 5B0YD 5AV5A 4KGCC 1WWSA 1TAFA 1P3AD 3AZLB 3AV1B 1ID3A 1EQZA 5B40D 5B31G 3LZ1C 5AV9D 3MGQB 1ZLAA 3A6NB 5B1MD 3REHB 4AWLB 5B2JA 4J8VC 3KUYC 4QLCD 3AZFD 4J8WB 1P3GC 3AZMA 4WU8A 5AVCB 4Z66C 3KWQA 4UUZA 5AV8A 5B24C 5GSUC 4WU9B 5E5AA 5JA4A 1F66A 4X23B 2CV5A 5AV6B 3MGSA 5JRGB 3WAAB 3MGPA 5DNMB 4H9OB 3KXBD 3AZLC 3AV1C 3AFAA 5JA4B 3C1BD 5B0YA 5AY8B 1P3FB 1S32C 5B31B 1P3AA 2L5AA 3W96B 5AV5C 5B40A 3A6NC 1BH9B 4R8PA 1U35B 1EQZC 3AZKB 3REHC 3B0CT 5AV9A 1M19A 4XUJD 5B1MA 3B0BA 5AVCC 1ZLAC 4R8PB 1P3LD 5B32D 4KUDB 2YFVA 2PYOD 4QLCA 4X23C 3AZFA 1M19B 2F8NH 5B2JC 3X1VB 1P3IB 4XZQD 3LZ0D 4WU8C 1BFMA 3KWQC 4YS3D 4H9SA 5E5AC 1P3PB 4ZUXD 1R4VA 1A7WA 5B1LD 5AY8C 3KXBA 3B6GA 5B31C 3W96C 2HIOB 2F8ND 5F99D 4H9NA 1M18D 3UT9D 3AFAC 1U35C 3REJA 3AZKC 1P3OD 3B6GB 3WTPE 4KHAB 3C1CD 5GXQB 4R8PC 5GT0A 3REJB 3AZID 5KDMB 5AV9C 4XUJA 1M19C 5BO0B 5CPIB 3B0CW 1P3IC 5CHLB 1P3LA 3WTPA 1TZYB 3AN2B 5GT0B 1P3BB 1P3PC 4XZQA 3LZ0A 3V9RB 5CPKB 3R45B 3RELD 5B2IB 2IO5B 2BYMB 2HIOC 4YS3A 1M1AB 3WTPB 3TU4D 2YFWA 1JFIB 3AZGB 3NQUA 2NQBB 1N1JA 5B1LA 3MVDB 3REID 2F8NA 3B6GC 5F99A 3UT9A 4LD9D 5BT1D 1P3OA 5C3IB 5GXQC 4JJNB 4NE5A 3REJC 5CPIC 2HUEB 4G91C 3C1CA 3NQJB 4H9RA 5GT0C 5FUGB 1P3BC 4J8VB 2IO5C 4YM6A 2NZDB 3WTPC 1P3MB 2AROB 3AZGC 2NQBC 3LJAD 5B0ZD 3RELA 3WKJD 4J8WD 4XZQC 3X1UB 3VH6A 4J8UD 3AZHA 4YM6B 3AZNB 4YS3C 3X1SD 5G49B 1KX3B 5DNND 5AV6D 5C3IC 4JJNC 5BS7A 3B6FD 5DNMD 3MGRB 3AZEA 1S32B 4CAYB 4LD9A 3W98D 5B33D 3AZHB 5AV5B 2HUEC 5AVBD 1TAFB 1ID3B 1P3OC 1EQZB 4NFTA 2JSSA 3W99D 4WZSB 3AZEB 1P3KD 4J8XA 3AV2D 3W97D 1ZLAB 2NZDC 1P3MC 3UTBD 2AROC 3REKD 3REIA 1KX4A 5B2JB 3X1UC 4J8XB 2FJ7D 3AZMB 4YM6C 4WU8B 3AZNC 3AYWD 3LJAA 4G92B 5B0ZA 3KWQB 1KX3C 4UUZB 3WKJA 5AV8B 3X1VD 5E5AB 1F66B 4J8UA 3RELC 2RVQC 2CV5B 3MGRC 3MGSB 3X1SA 1B67A 5CPJD 3MGPB 3AZHC 1KX5D 1ID3C 3B6FA 3AFAB 3VH5T 1BH8A 3W98A 5B0YB 5AVBA 3AZEC 4ZBJC 1P3AB 3LELD 4CSRA 5B40B 4Z2MH 1P3KA 3W99A 2CWEA 3WA9D 5AV9B 3AV2A 3W97A 5CP6D 3B0DB 4J8XC 3UTBA 3AZMC 5B1MB 3REKA 4G92C 5AV8C 1HQ3D 2YFVB 3MNND 5GT3D 3X1TD 4QLCB 3AZFB 1KX4C 1F66C 2FJ7A 3AYWA 2CV5C 3MGSC 3AN2D 1P34D 3MGPC 2LY8A 5B32G 3AZJD 4EO5C 3C1BA 1KU5A 5CPKD 5B2ID 5B0YC 5CPJA 1AOID 4E45A 3KXBB 1KX5A 1P3AC 4HGAC 2F8NK 1Q9CA 3MVDD 4H9NB 5B40C 4Z5TD 3O62D 3UTAD 2F8NG 1H3OA 4KGCD 3VH5W 3B0DC 4G91B 5B1MC 5B32A 3WA9A 2PYOA 4WNNA 3LZ1D 4QLCC 3AZFC 4XUJB 3W97C 1P3LB 5B32B 1HQ3A 3MNNA 2PYOB 5GT3A 3X1TA 4H9SC 4ZUXA 4J8VD 3KUYD 1P3GD 4H9QA 1P34A 4XZQB 3LZ0B 4Z66D 3KXBC 1M18A 4NE6A 5B24D 5GSUD 4YS3B 2YFWB 3C1BC 3NQUB 1AOIA 4ZUXB 1N1JB 5B1LB 2F8NB 1ULYA 5CPJC 4H9PA 5F99B 4Z5TA 3UT9B 3AZLD 3O62A 3AV1D 5BNXA 3UTAA 3AZIA 1P3OB 4KGCA 3MGQD 4XUJC 4NE3A 3A6ND 3C1CB 5BNXB 3REHD 1P3LC 3AZIB 5B32C 4H9RB 2PYOC 3LZ0C 5AVCD 3TU4A 4WU9D 1B6WA 4X23D 3MNNC 4DRBA 1P3GA 3X1TC 5BNVA 4ZUXC 5B1LC
chains in the Genus database with same CATH superfamily
5JRGD 3RELB 4Z66A 3WAAD 1P34C 5F99C 1M18C 3UT9C 3REIB 5AY8D 1P3FD 5B31D 3W96D 3F6TA 3AZLA 4LD9B 4ZBJB 3C1CC 2ZY3A 1U35D 3AZKD 3AZIC 3MGQA 3A6NA 4E44A 3KSYA 3REHA 4R8PD 3H0MC 2BYKA 4KUDD 4J8WA 1M19D 1P3ID 5AVCA 1KX4B 4WU9A 3TU4C 5DNNA 4X23A 2BYKB 5AV6A 4EO5B 3LJAB 5JRGA 5B0ZB 3WKJB 1P3PD 3WAAA 3REIC 5DNMA 4H9OA 4J8UB 2HIOD 5BS7C 1HTAA 5B33A 4LD9C 3X1SB 4HGAB 5DNNB 5BT1C 5AY8A 1P3FA 5B31A 3W96A 3B6FB 3B6GD 2F2AC 1BH8B 3W98B 5B33B 5AVBB 4M6BA 1BH9A 3VH6T 1U35A 3AZKA 4CSRB 2ZY5A 5GXQD 3REJD 1P3KB 3MGQC 3W99B 5CPID 3A1IA 3AV2B 3W97B 1F1EA 1TZYD 4KUDA 4AWLC 3UTBB 5GT0D 3REKB 3X1VA 1P3IA 3LJAC 1WWIA 5B0ZC 1P3BD 3WKJC 4J8WC 4J8UC 2FJ7B 3AYWB 1M1AD 3WTPD 3X1SC 4WU9C 5DNNC 2Y2MA 3AZGD 1P3PA 2NQBD 5AV6C 4Z2MG 2UWXA 5JRGC 3C1BB 2HIOA 2G5IC 3WAAC 3B6FC 5DNMC 3W98C 3LELA 5B33C 5CPJB 5AVBC 1KX5B 1P3FC 4JJND 3W99C 5CP6A 1P3KC 3LELB 4KHAA 1H3OB 1T3UA 3AV2C 5GXQA 5KDMA 3VH6W 3UTBC 3REKC 5BO0A 1W2EA 5CPIA 3WA9B 4WNNB 4DRAA 5CP6B 1TZYA 2ZY4A 3AN2A 2FJ7C 3AYWC 3AZJA 1P3MD 2NZDD 1P3BA 2AROD 4KUDC 2JE5A 3V9RA 5CPKA 3R45A 3X1VC 1HQ3B 5B2IA 3MNNB 5GT3B 3X1TB 2BYMA 2DF4C 3X1UD 1M1AA 2JCHA 4H9QB 1P34B 4YM6D 3AZGA 3AZND 1JFIA 2NQBA 3MVDA 3AZJB 1KX3D 1KX5C 1M18B 2RVQD 1AOIB 3MGRD 1S32D 4WV4B 3AZHD 5AV5D 3LELC 4H9PB 4JJNA 4Z5TB 1ID3D 3O62B 1EQZD 3UTAB 3LZ1A 3WA9C 3AZED 4KGCB 3NQJA 5CP6C 4DQYB 1ZLAD 4UPKA 5FUGA 4J8VA 3LZ1B 3KUYA 3A1KA 1HQ3C 3IP4C 5GT3C 5B2JD 2J8PA 2NZDA 1P3MA 1TZYC 4J8XD 2AROA 3AZMD 5B24A 3AN2C 5GSUA 4WU8D 3TU4B 3VH5A 3AZJC 3KWQD 5AV8D 5E5AD 3X1UA 3KUYB 5CPKC 1P3GB 5B2IC 1KX4D 1F66D 3EG5B 5BNVB 3AZNA 2CV5D 1AOIC 2XD1A 3MGSD 1M1AC 4Z66B 5G49A 1KX3A 3MGPD 3AV1A 5B24B 5GSUB 3MVDC 4Z5TC 3O62C 3AFAD 3MGRA 2ZM5A 4CAYA 1S32A 3UTAC 5B0YD 3EPHA 5AV5A 4KGCC 1WWSA 1TAFA 1P3AD 3AZLB 3AV1B 1ID3A 1EQZA 5B40D 2RIQA 5B31G 3LZ1C 5AV9D 3MGQB 1ZLAA 3A6NB 5B1MD 3REHB 4AWLB 5B2JA 4J8VC 3KUYC 4QLCD 3AZFD 4J8WB 1P3GC 3AZMA 4WU8A 5AVCB 4Z66C 3KWQA 4UUZA 5AV8A 5B24C 5GSUC 4WU9B 5E5AA 5JA4A 1F66A 4X23B 2CV5A 5AV6B 3MGSA 5JRGB 3WAAB 3MGPA 5DNMB 4H9OB 3KXBD 4WJ3C 3AZLC 3AV1C 3AFAA 5JA4B 3C1BD 5B0YA 5AY8B 1P3FB 1S32C 5B31B 1P3AA 2L5AA 3W96B 5AV5C 5B40A 3A6NC 1BH9B 4R8PA 1U35B 1EQZC 3AZKB 3REHC 3B0CT 5AV9A 1M19A 4XUJD 5B1MA 3B0BA 5AVCC 1ZLAC 4R8PB 1P3LD 5B32D 4KUDB 2YFVA 2PYOD 4QLCA 4X23C 3AZFA 1M19B 2F8NH 5B2JC 3X1VB 1P3IB 4XZQD 3LZ0D 4WU8C 1BFMA 3KWQC 4YS3D 4H9SA 5E5AC 1P3PB 4ZUXD 1R4VA 1A7WA 5B1LD 5AY8C 3KXBA 3B6GA 5B31C 3W96C 2HIOB 2F8ND 5F99D 4H9NA 1M18D 3UT9D 2ZY2A 3AFAC 3H0RC 1U35C 3REJA 3AZKC 1P3OD 3B6GB 3WTPE 2Y2IA 2Y2JA 4KHAB 3C1CD 5GXQB 4R8PC 5GT0A 3REJB 3AZID 2Y2PA 5KDMB 5AV9C 4XUJA 1M19C 5BO0B 5CPIB 3B0CW 1P3IC 5CHLB 2VQRA 1P3LA 3WTPA 1TZYB 3AN2B 5GT0B 1P3BB 1P3PC 4XZQA 3LZ0A 3V9RB 5CPKB 3R45B 3RELD 5B2IB 2IO5B 2BYMB 2HIOC 4YS3A 1M1AB 3WTPB 3TU4D 2YFWA 1JFIB 3AZGB 3NQUA 2NQBB 1N1JA 5B1LA 3MVDB 3REID 2F8NA 3B6GC 5F99A 2DQNC 2Y2LA 3UT9A 4LD9D 5BT1D 1P3OA 5C3IB 5GXQC 4JJNB 4NE5A 3REJC 2Y2NA 5CPIC 2HUEB 4G91C 3C1CA 3NQJB 4H9RA 5GT0C 5FUGB 1P3BC 4J8VB 2IO5C 4YM6A 2NZDB 3WTPC 1P3MB 2AROB 3AZGC 2NQBC 3LJAD 5B0ZD 3RELA 3WKJD 4J8WD 4XZQC 3X1UB 3VH6A 4J8UD 3AZHA 4YM6B 3AZNB 4YS3C 3X1SD 5G49B 1KX3B 5DNND 5AV6D 5C3IC 4JJNC 5BS7A 3B6FD 5DNMD 3MGRB 3EPLA 3AZEA 4CAYB 1S32B 3W98D 4LD9A 5B33D 3AZHB 5AV5B 2HUEC 5AVBD 1TAFB 1ID3B 1P3OC 1EQZB 4NFTA 2JSSA 3W99D 4WZSB 3AZEB 1P3KD 4J8XA 3AV2D 3W97D 1Z2CB 1ZLAB 2NZDC 1P3MC 3UTBD 2AROC 3REKD 3REIA 1KX4A 5B2JB 3X1UC 4J8XB 2FJ7D 3AZMB 4YM6C 4WU8B 3AZNC 3AYWD 3LJAA 4G92B 5B0ZA 3KWQB 1KX3C 4UUZB 3WKJA 5AV8B 3X1VD 5E5AB 1F66B 4J8UA 3RELC 2RVQC 2CV5B 3MGRC 3MGSB 3X1SA 1B67A 5CPJD 3MGPB 3AZHC 1KX5D 2Y2HA 1ID3C 3B6FA 3AFAB 3KFUG 3VH5T 1BH8A 3W98A 5B0YB 5AVBA 2BG1A 3AZEC 4ZBJC 1P3AB 3LELD 4CSRA 5B40B 4Z2MH 1P3KA 3W99A 2CWEA 2FFFB 3WA9D 5AV9B 3AV2A 3W97A 5CP6D 3B0DB 4J8XC 3UTBA 2W8SA 3AZMC 5B1MB 3REKA 4G92C 5AV8C 1HQ3D 2YFVB 3MNND 5GT3D 3X1TD 4QLCB 3AZFB 1KX4C 2Y2KA 1F66C 3AYWA 2CV5C 2FJ7A 3MGSC 3AN2D 1P34D 3MGPC 2LY8A 5B32G 3AZJD 4EO5C 3C1BA 1KU5A 5CPKD 5B2ID 5B0YC 5CPJA 1AOID 4E45A 3KXBB 1KX5A 1P3AC 4HGAC 2F8NK 1Q9CA 3MVDD 4H9NB 5B40C 4Z5TD 3O62D 3UTAD 3FDDA 2F8NG 1H3OA 4KGCD 3VH5W 2G5HC 3B0DC 4G91B 5B1MC 5B32A 3WA9A 2PYOA 4WNNA 3LZ1D 4QLCC 3AZFC 4XUJB 3W97C 3AL0C 1P3LB 5B32B 1HQ3A 3MNNA 2PYOB 5GT3A 3X1TA 4H9SC 4ZUXA 4J8VD 3KUYD 3P5JB 1P3GD 4H9QA 3H0LC 4XZQB 1P34A 1PZRA 3LZ0B 4Z66D 3KXBC 1M18A 4NE6A 2Y2OA 5GSUD 5B24D 4YS3B 2YFWB 3C1BC 3NQUB 1AOIA 4ZUXB 1N1JB 5B1LB 3EPJA 2F8NB 1ULYA 2Y2GA 5CPJC 4H9PA 5F99B 4Z5TA 3UT9B 3AZLD 3O62A 3AV1D 5BNXA 3UTAA 3AZIA 1P3OB 4KGCA 3MGQD 2XD5A 4XUJC 4NE3A 3A6ND 3C1CB 5BNXB 3REHD 1P3LC 3AZIB 5B32C 4H9RB 2PYOC 3LZ0C 5AVCD 3TU4A 2Y2QA 3EPKA 4WU9D 1B6WA 4X23D 3MNNC 4DRBA 1P3GA 3X1TC 5BNVA 4ZUXC 5B1LC
chains in the Genus database with same CATH topology
5JRGD 3RELB 4Z66A 3WAAD 1P34C 5F99C 1M18C 3UT9C 3REIB 5AY8D 1P3FD 5B31D 3W96D 3F6TA 3AZLA 4LD9B 4ZBJB 3C1CC 2ZY3A 1U35D 3AZKD 3AZIC 3MGQA 3A6NA 4E44A 3KSYA 3REHA 4R8PD 3H0MC 2BYKA 4KUDD 4J8WA 1M19D 1P3ID 5AVCA 1KX4B 4WU9A 3TU4C 5DNNA 4X23A 2BYKB 5AV6A 4EO5B 3LJAB 5JRGA 5B0ZB 3WKJB 1P3PD 3WAAA 3REIC 5DNMA 4H9OA 4J8UB 2HIOD 5BS7C 1HTAA 5B33A 4LD9C 3X1SB 4HGAB 5DNNB 5BT1C 5AY8A 1P3FA 5B31A 3W96A 3B6FB 3B6GD 2F2AC 1BH8B 3W98B 5B33B 5AVBB 4M6BA 1BH9A 3VH6T 1U35A 3AZKA 4CSRB 2ZY5A 5GXQD 3REJD 1P3KB 3MGQC 3W99B 5CPID 3A1IA 3AV2B 3W97B 1F1EA 1TZYD 4KUDA 4AWLC 3UTBB 5GT0D 3REKB 3X1VA 1P3IA 3LJAC 1WWIA 5B0ZC 1P3BD 3WKJC 4J8WC 4J8UC 2FJ7B 3AYWB 1M1AD 3WTPD 3X1SC 4WU9C 5DNNC 2Y2MA 3AZGD 1P3PA 2NQBD 5AV6C 4Z2MG 2UWXA 5JRGC 3C1BB 2HIOA 2G5IC 3WAAC 3B6FC 5DNMC 3W98C 3LELA 5B33C 5CPJB 5AVBC 1KX5B 1P3FC 4JJND 3W99C 5CP6A 1P3KC 3LELB 4KHAA 1H3OB 1T3UA 3AV2C 5GXQA 5KDMA 3VH6W 3UTBC 3REKC 5BO0A 1W2EA 5CPIA 3WA9B 4WNNB 4DRAA 5CP6B 1TZYA 2ZY4A 3AN2A 2FJ7C 3AYWC 3AZJA 1P3MD 2NZDD 1P3BA 2AROD 4KUDC 2JE5A 3V9RA 5CPKA 3R45A 3X1VC 1HQ3B 5B2IA 3MNNB 5GT3B 3X1TB 2BYMA 2DF4C 3X1UD 1M1AA 2JCHA 4H9QB 1P34B 4YM6D 3AZGA 3AZND 1JFIA 2NQBA 3MVDA 3AZJB 1KX3D 1KX5C 1M18B 2RVQD 1AOIB 3MGRD 1S32D 4WV4B 3AZHD 5AV5D 3LELC 4H9PB 4JJNA 4Z5TB 1ID3D 3O62B 1EQZD 3UTAB 3LZ1A 3WA9C 3AZED 4KGCB 3NQJA 5CP6C 4DQYB 1ZLAD 4UPKA 5FUGA 4J8VA 3LZ1B 3KUYA 3A1KA 1HQ3C 3IP4C 5GT3C 5B2JD 2J8PA 2NZDA 1P3MA 1TZYC 4J8XD 2AROA 3AZMD 5B24A 3AN2C 5GSUA 4WU8D 3TU4B 3VH5A 3AZJC 3KWQD 5AV8D 5E5AD 3X1UA 3KUYB 5CPKC 1P3GB 5B2IC 1KX4D 1F66D 3EG5B 5BNVB 3AZNA 2CV5D 1AOIC 2XD1A 3MGSD 1M1AC 4Z66B 5G49A 1KX3A 3MGPD 3AV1A 5B24B 5GSUB 3MVDC 4Z5TC 3O62C 3AFAD 3MGRA 2ZM5A 4CAYA 1S32A 3UTAC 5B0YD 3EPHA 5AV5A 4KGCC 1WWSA 1TAFA 1P3AD 3AZLB 3AV1B 1ID3A 1EQZA 5B40D 2RIQA 5B31G 3LZ1C 5AV9D 3MGQB 1ZLAA 3A6NB 5B1MD 3REHB 4AWLB 5B2JA 4J8VC 3KUYC 4QLCD 3AZFD 4J8WB 1P3GC 3AZMA 4WU8A 5AVCB 4Z66C 3KWQA 4UUZA 5AV8A 5B24C 5GSUC 4WU9B 5E5AA 5JA4A 1F66A 4X23B 2CV5A 5AV6B 3MGSA 5JRGB 3WAAB 3MGPA 5DNMB 4H9OB 3KXBD 4WJ3C 3AZLC 3AV1C 3AFAA 5JA4B 3C1BD 5B0YA 5AY8B 1P3FB 1S32C 5B31B 1P3AA 2L5AA 3W96B 5AV5C 5B40A 3A6NC 1BH9B 4R8PA 1U35B 1EQZC 3AZKB 3REHC 3B0CT 5AV9A 1M19A 4XUJD 5B1MA 3B0BA 5AVCC 1ZLAC 4R8PB 1P3LD 5B32D 4KUDB 2YFVA 2PYOD 4QLCA 4X23C 3AZFA 1M19B 2F8NH 5B2JC 3X1VB 1P3IB 4XZQD 3LZ0D 4WU8C 1BFMA 3KWQC 4YS3D 4H9SA 5E5AC 1P3PB 4ZUXD 1R4VA 1A7WA 5B1LD 5AY8C 3KXBA 3B6GA 5B31C 3W96C 2HIOB 2F8ND 5F99D 4H9NA 1M18D 3UT9D 2ZY2A 3AFAC 3H0RC 1U35C 3REJA 3AZKC 1P3OD 3B6GB 3WTPE 2Y2IA 2Y2JA 4KHAB 3C1CD 5GXQB 4R8PC 5GT0A 3REJB 3AZID 2Y2PA 5KDMB 5AV9C 4XUJA 1M19C 5BO0B 5CPIB 3B0CW 1P3IC 5CHLB 2VQRA 1P3LA 3WTPA 1TZYB 3AN2B 5GT0B 1P3BB 1P3PC 4XZQA 3LZ0A 3V9RB 5CPKB 3R45B 3RELD 5B2IB 2IO5B 2BYMB 2HIOC 4YS3A 1M1AB 3WTPB 3TU4D 2YFWA 1JFIB 3AZGB 3NQUA 2NQBB 1N1JA 5B1LA 3MVDB 3REID 2F8NA 3B6GC 5F99A 2DQNC 2Y2LA 3UT9A 4LD9D 5BT1D 1P3OA 5C3IB 5GXQC 4JJNB 4NE5A 3REJC 2Y2NA 5CPIC 2HUEB 4G91C 3C1CA 3NQJB 4H9RA 5GT0C 5FUGB 1P3BC 4J8VB 2IO5C 4YM6A 2NZDB 3WTPC 1P3MB 2AROB 3AZGC 2NQBC 3LJAD 5B0ZD 3RELA 3WKJD 4J8WD 4XZQC 3X1UB 3VH6A 4J8UD 3AZHA 4YM6B 3AZNB 4YS3C 3X1SD 5G49B 1KX3B 5DNND 5AV6D 5C3IC 4JJNC 5BS7A 3B6FD 5DNMD 3MGRB 3EPLA 3AZEA 4CAYB 1S32B 3W98D 4LD9A 5B33D 3AZHB 5AV5B 2HUEC 5AVBD 1TAFB 1ID3B 1P3OC 1EQZB 4NFTA 2JSSA 3W99D 4WZSB 3AZEB 1P3KD 4J8XA 3AV2D 3W97D 1Z2CB 1ZLAB 2NZDC 1P3MC 3UTBD 2AROC 3REKD 3REIA 1KX4A 5B2JB 3X1UC 4J8XB 2FJ7D 3AZMB 4YM6C 4WU8B 3AZNC 3AYWD 3LJAA 4G92B 5B0ZA 3KWQB 1KX3C 4UUZB 3WKJA 5AV8B 3X1VD 5E5AB 1F66B 4J8UA 3RELC 2RVQC 2CV5B 3MGRC 3MGSB 3X1SA 1B67A 5CPJD 3MGPB 3AZHC 1KX5D 2Y2HA 1ID3C 3B6FA 3AFAB 3KFUG 3VH5T 1BH8A 3W98A 5B0YB 5AVBA 2BG1A 3AZEC 4ZBJC 1P3AB 3LELD 4CSRA 5B40B 4Z2MH 1P3KA 3W99A 2CWEA 2FFFB 3WA9D 5AV9B 3AV2A 3W97A 5CP6D 3B0DB 4J8XC 3UTBA 2W8SA 3AZMC 5B1MB 3REKA 4G92C 5AV8C 1HQ3D 2YFVB 3MNND 5GT3D 3X1TD 4QLCB 3AZFB 1KX4C 2Y2KA 1F66C 3AYWA 2CV5C 2FJ7A 3MGSC 3AN2D 1P34D 3MGPC 2LY8A 5B32G 3AZJD 4EO5C 3C1BA 1KU5A 5CPKD 5B2ID 5B0YC 5CPJA 1AOID 4E45A 3KXBB 1KX5A 1P3AC 4HGAC 2F8NK 1Q9CA 3MVDD 4H9NB 5B40C 4Z5TD 3O62D 3UTAD 3FDDA 2F8NG 1H3OA 4KGCD 3VH5W 2G5HC 3B0DC 4G91B 5B1MC 5B32A 3WA9A 2PYOA 4WNNA 3LZ1D 4QLCC 3AZFC 4XUJB 3W97C 3AL0C 1P3LB 5B32B 1HQ3A 3MNNA 2PYOB 5GT3A 3X1TA 4H9SC 4ZUXA 4J8VD 3KUYD 3P5JB 1P3GD 4H9QA 3H0LC 4XZQB 1P34A 1PZRA 3LZ0B 4Z66D 3KXBC 1M18A 4NE6A 2Y2OA 5GSUD 5B24D 4YS3B 2YFWB 3C1BC 3NQUB 1AOIA 4ZUXB 1N1JB 5B1LB 3EPJA 2F8NB 1ULYA 2Y2GA 5CPJC 4H9PA 5F99B 4Z5TA 3UT9B 3AZLD 3O62A 3AV1D 5BNXA 3UTAA 3AZIA 1P3OB 4KGCA 3MGQD 2XD5A 4XUJC 4NE3A 3A6ND 3C1CB 5BNXB 3REHD 1P3LC 3AZIB 5B32C 4H9RB 2PYOC 3LZ0C 5AVCD 3TU4A 2Y2QA 3EPKA 4WU9D 1B6WA 4X23D 3MNNC 4DRBA 1P3GA 3X1TC 5BNVA 4ZUXC 5B1LC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JRG D;  3REL B;  4Z66 A;  3WAA D;  1P34 C;  5F99 C;  1M18 C;  3UT9 C;  3REI B;  5AY8 D;  1P3F D;  5B31 D;  3W96 D;  3AZL A;  4LD9 B;  4ZBJ B;  3C1C C;  1U35 D;  3AZK D;  3AZI C;  3MGQ A;  3A6N A;  4E44 A;  3KSY A;  3REH A;  4R8P D;  2BYK A;  4KUD D;  4J8W A;  1M19 D;  1P3I D;  5AVC A;  1KX4 B;  4WU9 A;  3TU4 C;  5DNN A;  4X23 A;  2BYK B;  5AV6 A;  4EO5 B;  3LJA B;  5JRG A;  5B0Z B;  3WKJ B;  1P3P D;  3WAA A;  3REI C;  5DNM A;  4H9O A;  4J8U B;  2HIO D;  5BS7 C;  1HTA A;  5B33 A;  4LD9 C;  3X1S B;  4HGA B;  5DNN B;  5BT1 C;  5AY8 A;  1P3F A;  5B31 A;  3W96 A;  3B6F B;  3B6G D;  1BH8 B;  3W98 B;  5B33 B;  5AVB B;  4M6B A;  1BH9 A;  3VH6 T;  1U35 A;  3AZK A;  4CSR B;  5GXQ D;  3REJ D;  1P3K B;  3MGQ C;  3W99 B;  5CPI D;  3AV2 B;  3W97 B;  1F1E A;  1TZY D;  4KUD A;  4AWL C;  3UTB B;  5GT0 D;  3REK B;  3X1V A;  1P3I A;  3LJA C;  1WWI A;  5B0Z C;  1P3B D;  3WKJ C;  4J8W C;  4J8U C;  2FJ7 B;  3AYW B;  1M1A D;  3WTP D;  3X1S C;  4WU9 C;  5DNN C;  3AZG D;  1P3P A;  2NQB D;  5AV6 C;  4Z2M G;  5JRG C;  3C1B B;  2HIO A;  3WAA C;  3B6F C;  5DNM C;  3W98 C;  3LEL A;  5B33 C;  5CPJ B;  5AVB C;  1KX5 B;  1P3F C;  4JJN D;  3W99 C;  5CP6 A;  1P3K C;  3LEL B;  4KHA A;  1H3O B;  3AV2 C;  5GXQ A;  5KDM A;  3VH6 W;  3UTB C;  3REK C;  5BO0 A;  5CPI A;  3WA9 B;  4WNN B;  4DRA A;  5CP6 B;  1TZY A;  3AN2 A;  2FJ7 C;  3AYW C;  3AZJ A;  1P3M D;  2NZD D;  1P3B A;  2ARO D;  4KUD C;  3V9R A;  5CPK A;  3R45 A;  3X1V C;  1HQ3 B;  5B2I A;  3MNN B;  5GT3 B;  3X1T B;  2BYM A;  3X1U D;  1M1A A;  4H9Q B;  1P34 B;  4YM6 D;  3AZG A;  3AZN D;  1JFI A;  2NQB A;  3MVD A;  3AZJ B;  1KX3 D;  1KX5 C;  1M18 B;  2RVQ D;  1AOI B;  3MGR D;  1S32 D;  4WV4 B;  3AZH D;  5AV5 D;  3LEL C;  4H9P B;  4JJN A;  4Z5T B;  1ID3 D;  3O62 B;  1EQZ D;  3UTA B;  3LZ1 A;  3WA9 C;  3AZE D;  4KGC B;  3NQJ A;  5CP6 C;  1ZLA D;  5FUG A;  4J8V A;  3LZ1 B;  3KUY A;  1HQ3 C;  5GT3 C;  5B2J D;  2NZD A;  1P3M A;  1TZY C;  4J8X D;  2ARO A;  3AZM D;  5B24 A;  3AN2 C;  5GSU A;  4WU8 D;  3TU4 B;  3VH5 A;  3AZJ C;  3KWQ D;  5AV8 D;  5E5A D;  3X1U A;  3KUY B;  5CPK C;  1P3G B;  5B2I C;  1KX4 D;  1F66 D;  5BNV B;  3AZN A;  2CV5 D;  1AOI C;  3MGS D;  1M1A C;  4Z66 B;  5G49 A;  1KX3 A;  3MGP D;  3AV1 A;  5B24 B;  5GSU B;  3MVD C;  4Z5T C;  3O62 C;  3AFA D;  3MGR A;  1S32 A;  4CAY A;  3UTA C;  5B0Y D;  5AV5 A;  4KGC C;  1WWS A;  1TAF A;  1P3A D;  3AZL B;  3AV1 B;  1ID3 A;  1EQZ A;  5B40 D;  5B31 G;  3LZ1 C;  5AV9 D;  3MGQ B;  1ZLA A;  3A6N B;  5B1M D;  3REH B;  4AWL B;  5B2J A;  4J8V C;  3KUY C;  4QLC D;  3AZF D;  4J8W B;  1P3G C;  3AZM A;  4WU8 A;  5AVC B;  4Z66 C;  3KWQ A;  4UUZ A;  5AV8 A;  5B24 C;  5GSU C;  4WU9 B;  5E5A A;  5JA4 A;  1F66 A;  4X23 B;  2CV5 A;  5AV6 B;  3MGS A;  5JRG B;  3WAA B;  3MGP A;  5DNM B;  4H9O B;  3KXB D;  3AZL C;  3AV1 C;  3AFA A;  5JA4 B;  3C1B D;  5B0Y A;  5AY8 B;  1P3F B;  1S32 C;  5B31 B;  1P3A A;  2L5A A;  3W96 B;  5AV5 C;  5B40 A;  3A6N C;  1BH9 B;  4R8P A;  1U35 B;  1EQZ C;  3AZK B;  3REH C;  3B0C T;  5AV9 A;  1M19 A;  4XUJ D;  5B1M A;  3B0B A;  5AVC C;  1ZLA C;  4R8P B;  1P3L D;  5B32 D;  4KUD B;  2YFV A;  2PYO D;  4QLC A;  4X23 C;  3AZF A;  1M19 B;  2F8N H;  5B2J C;  3X1V B;  1P3I B;  4XZQ D;  3LZ0 D;  4WU8 C;  1BFM A;  3KWQ C;  4YS3 D;  4H9S A;  5E5A C;  1P3P B;  4ZUX D;  1R4V A;  1A7W A;  5B1L D;  5AY8 C;  3KXB A;  3B6G A;  5B31 C;  3W96 C;  2HIO B;  2F8N D;  5F99 D;  4H9N A;  1M18 D;  3UT9 D;  3AFA C;  1U35 C;  3REJ A;  3AZK C;  1P3O D;  3B6G B;  3WTP E;  4KHA B;  3C1C D;  5GXQ B;  4R8P C;  5GT0 A;  3REJ B;  3AZI D;  5KDM B;  5AV9 C;  4XUJ A;  1M19 C;  5BO0 B;  5CPI B;  3B0C W;  1P3I C;  5CHL B;  1P3L A;  3WTP A;  1TZY B;  3AN2 B;  5GT0 B;  1P3B B;  1P3P C;  4XZQ A;  3LZ0 A;  3V9R B;  5CPK B;  3R45 B;  3REL D;  5B2I B;  2IO5 B;  2BYM B;  2HIO C;  4YS3 A;  1M1A B;  3WTP B;  3TU4 D;  2YFW A;  1JFI B;  3AZG B;  3NQU A;  2NQB B;  1N1J A;  5B1L A;  3MVD B;  3REI D;  2F8N A;  3B6G C;  5F99 A;  3UT9 A;  4LD9 D;  5BT1 D;  1P3O A;  5C3I B;  5GXQ C;  4JJN B;  4NE5 A;  3REJ C;  5CPI C;  2HUE B;  4G91 C;  3C1C A;  3NQJ B;  4H9R A;  5GT0 C;  5FUG B;  1P3B C;  4J8V B;  2IO5 C;  4YM6 A;  2NZD B;  3WTP C;  1P3M B;  2ARO B;  3AZG C;  2NQB C;  3LJA D;  5B0Z D;  3REL A;  3WKJ D;  4J8W D;  4XZQ C;  3X1U B;  3VH6 A;  4J8U D;  3AZH A;  4YM6 B;  3AZN B;  4YS3 C;  3X1S D;  5G49 B;  1KX3 B;  5DNN D;  5AV6 D;  5C3I C;  4JJN C;  5BS7 A;  3B6F D;  5DNM D;  3MGR B;  3AZE A;  1S32 B;  4CAY B;  4LD9 A;  3W98 D;  5B33 D;  3AZH B;  5AV5 B;  2HUE C;  5AVB D;  1TAF B;  1ID3 B;  1P3O C;  1EQZ B;  4NFT A;  2JSS A;  3W99 D;  4WZS B;  3AZE B;  1P3K D;  4J8X A;  3AV2 D;  3W97 D;  1ZLA B;  2NZD C;  1P3M C;  3UTB D;  2ARO C;  3REK D;  3REI A;  1KX4 A;  5B2J B;  3X1U C;  4J8X B;  2FJ7 D;  3AZM B;  4YM6 C;  4WU8 B;  3AZN C;  3AYW D;  3LJA A;  4G92 B;  5B0Z A;  3KWQ B;  1KX3 C;  4UUZ B;  3WKJ A;  5AV8 B;  3X1V D;  5E5A B;  1F66 B;  4J8U A;  3REL C;  2RVQ C;  2CV5 B;  3MGR C;  3MGS B;  3X1S A;  1B67 A;  5CPJ D;  3MGP B;  3AZH C;  1KX5 D;  1ID3 C;  3B6F A;  3AFA B;  3VH5 T;  1BH8 A;  3W98 A;  5B0Y B;  5AVB A;  3AZE C;  4ZBJ C;  1P3A B;  3LEL D;  4CSR A;  5B40 B;  4Z2M H;  1P3K A;  3W99 A;  2CWE A;  3WA9 D;  5AV9 B;  3AV2 A;  3W97 A;  5CP6 D;  3B0D B;  4J8X C;  3UTB A;  3AZM C;  5B1M B;  3REK A;  4G92 C;  5AV8 C;  1HQ3 D;  2YFV B;  3MNN D;  5GT3 D;  3X1T D;  4QLC B;  3AZF B;  1KX4 C;  1F66 C;  2FJ7 A;  3AYW A;  2CV5 C;  3MGS C;  3AN2 D;  1P34 D;  3MGP C;  2LY8 A;  5B32 G;  3AZJ D;  4EO5 C;  3C1B A;  1KU5 A;  5CPK D;  5B2I D;  5B0Y C;  5CPJ A;  1AOI D;  4E45 A;  3KXB B;  1KX5 A;  1P3A C;  4HGA C;  2F8N K;  1Q9C A;  3MVD D;  4H9N B;  5B40 C;  4Z5T D;  3O62 D;  3UTA D;  2F8N G;  1H3O A;  4KGC D;  3VH5 W;  3B0D C;  4G91 B;  5B1M C;  5B32 A;  3WA9 A;  2PYO A;  4WNN A;  3LZ1 D;  4QLC C;  3AZF C;  4XUJ B;  3W97 C;  1P3L B;  5B32 B;  1HQ3 A;  3MNN A;  2PYO B;  5GT3 A;  3X1T A;  4H9S C;  4ZUX A;  4J8V D;  3KUY D;  1P3G D;  4H9Q A;  1P34 A;  4XZQ B;  3LZ0 B;  4Z66 D;  3KXB C;  1M18 A;  4NE6 A;  5B24 D;  5GSU D;  4YS3 B;  2YFW B;  3C1B C;  3NQU B;  1AOI A;  4ZUX B;  1N1J B;  5B1L B;  2F8N B;  1ULY A;  5CPJ C;  4H9P A;  5F99 B;  4Z5T A;  3UT9 B;  3AZL D;  3O62 A;  3AV1 D;  5BNX A;  3UTA A;  3AZI A;  1P3O B;  4KGC A;  3MGQ D;  4XUJ C;  4NE3 A;  3A6N D;  3C1C B;  5BNX B;  3REH D;  1P3L C;  3AZI B;  5B32 C;  4H9R B;  2PYO C;  3LZ0 C;  5AVC D;  3TU4 A;  4WU9 D;  1B6W A;  4X23 D;  3MNN C;  4DRB A;  1P3G A;  3X1T C;  5BNV A;  4ZUX C;  5B1L C; 
#chains in the Genus database with same CATH topology
 5JRG D;  3REL B;  4Z66 A;  3WAA D;  1P34 C;  5F99 C;  1M18 C;  3UT9 C;  3REI B;  5AY8 D;  1P3F D;  5B31 D;  3W96 D;  3F6T A;  3AZL A;  4LD9 B;  4ZBJ B;  3C1C C;  2ZY3 A;  1U35 D;  3AZK D;  3AZI C;  3MGQ A;  3A6N A;  4E44 A;  3KSY A;  3REH A;  4R8P D;  3H0M C;  2BYK A;  4KUD D;  4J8W A;  1M19 D;  1P3I D;  5AVC A;  1KX4 B;  4WU9 A;  3TU4 C;  5DNN A;  4X23 A;  2BYK B;  5AV6 A;  4EO5 B;  3LJA B;  5JRG A;  5B0Z B;  3WKJ B;  1P3P D;  3WAA A;  3REI C;  5DNM A;  4H9O A;  4J8U B;  2HIO D;  5BS7 C;  1HTA A;  5B33 A;  4LD9 C;  3X1S B;  4HGA B;  5DNN B;  5BT1 C;  5AY8 A;  1P3F A;  5B31 A;  3W96 A;  3B6F B;  3B6G D;  2F2A C;  1BH8 B;  3W98 B;  5B33 B;  5AVB B;  4M6B A;  1BH9 A;  3VH6 T;  1U35 A;  3AZK A;  4CSR B;  2ZY5 A;  5GXQ D;  3REJ D;  1P3K B;  3MGQ C;  3W99 B;  5CPI D;  3A1I A;  3AV2 B;  3W97 B;  1F1E A;  1TZY D;  4KUD A;  4AWL C;  3UTB B;  5GT0 D;  3REK B;  3X1V A;  1P3I A;  3LJA C;  1WWI A;  5B0Z C;  1P3B D;  3WKJ C;  4J8W C;  4J8U C;  2FJ7 B;  3AYW B;  1M1A D;  3WTP D;  3X1S C;  4WU9 C;  5DNN C;  2Y2M A;  3AZG D;  1P3P A;  2NQB D;  5AV6 C;  4Z2M G;  2UWX A;  5JRG C;  3C1B B;  2HIO A;  2G5I C;  3WAA C;  3B6F C;  5DNM C;  3W98 C;  3LEL A;  5B33 C;  5CPJ B;  5AVB C;  1KX5 B;  1P3F C;  4JJN D;  3W99 C;  5CP6 A;  1P3K C;  3LEL B;  4KHA A;  1H3O B;  1T3U A;  3AV2 C;  5GXQ A;  5KDM A;  3VH6 W;  3UTB C;  3REK C;  5BO0 A;  1W2E A;  5CPI A;  3WA9 B;  4WNN B;  4DRA A;  5CP6 B;  1TZY A;  2ZY4 A;  3AN2 A;  2FJ7 C;  3AYW C;  3AZJ A;  1P3M D;  2NZD D;  1P3B A;  2ARO D;  4KUD C;  2JE5 A;  3V9R A;  5CPK A;  3R45 A;  3X1V C;  1HQ3 B;  5B2I A;  3MNN B;  5GT3 B;  3X1T B;  2BYM A;  2DF4 C;  3X1U D;  1M1A A;  2JCH A;  4H9Q B;  1P34 B;  4YM6 D;  3AZG A;  3AZN D;  1JFI A;  2NQB A;  3MVD A;  3AZJ B;  1KX3 D;  1KX5 C;  1M18 B;  2RVQ D;  1AOI B;  3MGR D;  1S32 D;  4WV4 B;  3AZH D;  5AV5 D;  3LEL C;  4H9P B;  4JJN A;  4Z5T B;  1ID3 D;  3O62 B;  1EQZ D;  3UTA B;  3LZ1 A;  3WA9 C;  3AZE D;  4KGC B;  3NQJ A;  5CP6 C;  4DQY B;  1ZLA D;  4UPK A;  5FUG A;  4J8V A;  3LZ1 B;  3KUY A;  3A1K A;  1HQ3 C;  3IP4 C;  5GT3 C;  5B2J D;  2J8P A;  2NZD A;  1P3M A;  1TZY C;  4J8X D;  2ARO A;  3AZM D;  5B24 A;  3AN2 C;  5GSU A;  4WU8 D;  3TU4 B;  3VH5 A;  3AZJ C;  3KWQ D;  5AV8 D;  5E5A D;  3X1U A;  3KUY B;  5CPK C;  1P3G B;  5B2I C;  1KX4 D;  1F66 D;  3EG5 B;  5BNV B;  3AZN A;  2CV5 D;  1AOI C;  2XD1 A;  3MGS D;  1M1A C;  4Z66 B;  5G49 A;  1KX3 A;  3MGP D;  3AV1 A;  5B24 B;  5GSU B;  3MVD C;  4Z5T C;  3O62 C;  3AFA D;  3MGR A;  2ZM5 A;  4CAY A;  1S32 A;  3UTA C;  5B0Y D;  3EPH A;  5AV5 A;  4KGC C;  1WWS A;  1TAF A;  1P3A D;  3AZL B;  3AV1 B;  1ID3 A;  1EQZ A;  5B40 D;  2RIQ A;  5B31 G;  3LZ1 C;  5AV9 D;  3MGQ B;  1ZLA A;  3A6N B;  5B1M D;  3REH B;  4AWL B;  5B2J A;  4J8V C;  3KUY C;  4QLC D;  3AZF D;  4J8W B;  1P3G C;  3AZM A;  4WU8 A;  5AVC B;  4Z66 C;  3KWQ A;  4UUZ A;  5AV8 A;  5B24 C;  5GSU C;  4WU9 B;  5E5A A;  5JA4 A;  1F66 A;  4X23 B;  2CV5 A;  5AV6 B;  3MGS A;  5JRG B;  3WAA B;  3MGP A;  5DNM B;  4H9O B;  3KXB D;  4WJ3 C;  3AZL C;  3AV1 C;  3AFA A;  5JA4 B;  3C1B D;  5B0Y A;  5AY8 B;  1P3F B;  1S32 C;  5B31 B;  1P3A A;  2L5A A;  3W96 B;  5AV5 C;  5B40 A;  3A6N C;  1BH9 B;  4R8P A;  1U35 B;  1EQZ C;  3AZK B;  3REH C;  3B0C T;  5AV9 A;  1M19 A;  4XUJ D;  5B1M A;  3B0B A;  5AVC C;  1ZLA C;  4R8P B;  1P3L D;  5B32 D;  4KUD B;  2YFV A;  2PYO D;  4QLC A;  4X23 C;  3AZF A;  1M19 B;  2F8N H;  5B2J C;  3X1V B;  1P3I B;  4XZQ D;  3LZ0 D;  4WU8 C;  1BFM A;  3KWQ C;  4YS3 D;  4H9S A;  5E5A C;  1P3P B;  4ZUX D;  1R4V A;  1A7W A;  5B1L D;  5AY8 C;  3KXB A;  3B6G A;  5B31 C;  3W96 C;  2HIO B;  2F8N D;  5F99 D;  4H9N A;  1M18 D;  3UT9 D;  2ZY2 A;  3AFA C;  3H0R C;  1U35 C;  3REJ A;  3AZK C;  1P3O D;  3B6G B;  3WTP E;  2Y2I A;  2Y2J A;  4KHA B;  3C1C D;  5GXQ B;  4R8P C;  5GT0 A;  3REJ B;  3AZI D;  2Y2P A;  5KDM B;  5AV9 C;  4XUJ A;  1M19 C;  5BO0 B;  5CPI B;  3B0C W;  1P3I C;  5CHL B;  2VQR A;  1P3L A;  3WTP A;  1TZY B;  3AN2 B;  5GT0 B;  1P3B B;  1P3P C;  4XZQ A;  3LZ0 A;  3V9R B;  5CPK B;  3R45 B;  3REL D;  5B2I B;  2IO5 B;  2BYM B;  2HIO C;  4YS3 A;  1M1A B;  3WTP B;  3TU4 D;  2YFW A;  1JFI B;  3AZG B;  3NQU A;  2NQB B;  1N1J A;  5B1L A;  3MVD B;  3REI D;  2F8N A;  3B6G C;  5F99 A;  2DQN C;  2Y2L A;  3UT9 A;  4LD9 D;  5BT1 D;  1P3O A;  5C3I B;  5GXQ C;  4JJN B;  4NE5 A;  3REJ C;  2Y2N A;  5CPI C;  2HUE B;  4G91 C;  3C1C A;  3NQJ B;  4H9R A;  5GT0 C;  5FUG B;  1P3B C;  4J8V B;  2IO5 C;  4YM6 A;  2NZD B;  3WTP C;  1P3M B;  2ARO B;  3AZG C;  2NQB C;  3LJA D;  5B0Z D;  3REL A;  3WKJ D;  4J8W D;  4XZQ C;  3X1U B;  3VH6 A;  4J8U D;  3AZH A;  4YM6 B;  3AZN B;  4YS3 C;  3X1S D;  5G49 B;  1KX3 B;  5DNN D;  5AV6 D;  5C3I C;  4JJN C;  5BS7 A;  3B6F D;  5DNM D;  3MGR B;  3EPL A;  3AZE A;  4CAY B;  1S32 B;  3W98 D;  4LD9 A;  5B33 D;  3AZH B;  5AV5 B;  2HUE C;  5AVB D;  1TAF B;  1ID3 B;  1P3O C;  1EQZ B;  4NFT A;  2JSS A;  3W99 D;  4WZS B;  3AZE B;  1P3K D;  4J8X A;  3AV2 D;  3W97 D;  1Z2C B;  1ZLA B;  2NZD C;  1P3M C;  3UTB D;  2ARO C;  3REK D;  3REI A;  1KX4 A;  5B2J B;  3X1U C;  4J8X B;  2FJ7 D;  3AZM B;  4YM6 C;  4WU8 B;  3AZN C;  3AYW D;  3LJA A;  4G92 B;  5B0Z A;  3KWQ B;  1KX3 C;  4UUZ B;  3WKJ A;  5AV8 B;  3X1V D;  5E5A B;  1F66 B;  4J8U A;  3REL C;  2RVQ C;  2CV5 B;  3MGR C;  3MGS B;  3X1S A;  1B67 A;  5CPJ D;  3MGP B;  3AZH C;  1KX5 D;  2Y2H A;  1ID3 C;  3B6F A;  3AFA B;  3KFU G;  3VH5 T;  1BH8 A;  3W98 A;  5B0Y B;  5AVB A;  2BG1 A;  3AZE C;  4ZBJ C;  1P3A B;  3LEL D;  4CSR A;  5B40 B;  4Z2M H;  1P3K A;  3W99 A;  2CWE A;  2FFF B;  3WA9 D;  5AV9 B;  3AV2 A;  3W97 A;  5CP6 D;  3B0D B;  4J8X C;  3UTB A;  2W8S A;  3AZM C;  5B1M B;  3REK A;  4G92 C;  5AV8 C;  1HQ3 D;  2YFV B;  3MNN D;  5GT3 D;  3X1T D;  4QLC B;  3AZF B;  1KX4 C;  2Y2K A;  1F66 C;  3AYW A;  2CV5 C;  2FJ7 A;  3MGS C;  3AN2 D;  1P34 D;  3MGP C;  2LY8 A;  5B32 G;  3AZJ D;  4EO5 C;  3C1B A;  1KU5 A;  5CPK D;  5B2I D;  5B0Y C;  5CPJ A;  1AOI D;  4E45 A;  3KXB B;  1KX5 A;  1P3A C;  4HGA C;  2F8N K;  1Q9C A;  3MVD D;  4H9N B;  5B40 C;  4Z5T D;  3O62 D;  3UTA D;  3FDD A;  2F8N G;  1H3O A;  4KGC D;  3VH5 W;  2G5H C;  3B0D C;  4G91 B;  5B1M C;  5B32 A;  3WA9 A;  2PYO A;  4WNN A;  3LZ1 D;  4QLC C;  3AZF C;  4XUJ B;  3W97 C;  3AL0 C;  1P3L B;  5B32 B;  1HQ3 A;  3MNN A;  2PYO B;  5GT3 A;  3X1T A;  4H9S C;  4ZUX A;  4J8V D;  3KUY D;  3P5J B;  1P3G D;  4H9Q A;  3H0L C;  4XZQ B;  1P34 A;  1PZR A;  3LZ0 B;  4Z66 D;  3KXB C;  1M18 A;  4NE6 A;  2Y2O A;  5GSU D;  5B24 D;  4YS3 B;  2YFW B;  3C1B C;  3NQU B;  1AOI A;  4ZUX B;  1N1J B;  5B1L B;  3EPJ A;  2F8N B;  1ULY A;  2Y2G A;  5CPJ C;  4H9P A;  5F99 B;  4Z5T A;  3UT9 B;  3AZL D;  3O62 A;  3AV1 D;  5BNX A;  3UTA A;  3AZI A;  1P3O B;  4KGC A;  3MGQ D;  2XD5 A;  4XUJ C;  4NE3 A;  3A6N D;  3C1C B;  5BNX B;  3REH D;  1P3L C;  3AZI B;  5B32 C;  4H9R B;  2PYO C;  3LZ0 C;  5AVC D;  3TU4 A;  2Y2Q A;  3EPK A;  4WU9 D;  1B6W A;  4X23 D;  3MNN C;  4DRB A;  1P3G A;  3X1T C;  5BNV A;  4ZUX C;  5B1L C; 
#chains in the Genus database with same CATH homology
 5JRG D;  3REL B;  4Z66 A;  3WAA D;  1P34 C;  5F99 C;  1M18 C;  3UT9 C;  3REI B;  5AY8 D;  1P3F D;  5B31 D;  3W96 D;  3F6T A;  3AZL A;  4LD9 B;  4ZBJ B;  3C1C C;  2ZY3 A;  1U35 D;  3AZK D;  3AZI C;  3MGQ A;  3A6N A;  4E44 A;  3KSY A;  3REH A;  4R8P D;  3H0M C;  2BYK A;  4KUD D;  4J8W A;  1M19 D;  1P3I D;  5AVC A;  1KX4 B;  4WU9 A;  3TU4 C;  5DNN A;  4X23 A;  2BYK B;  5AV6 A;  4EO5 B;  3LJA B;  5JRG A;  5B0Z B;  3WKJ B;  1P3P D;  3WAA A;  3REI C;  5DNM A;  4H9O A;  4J8U B;  2HIO D;  5BS7 C;  1HTA A;  5B33 A;  4LD9 C;  3X1S B;  4HGA B;  5DNN B;  5BT1 C;  5AY8 A;  1P3F A;  5B31 A;  3W96 A;  3B6F B;  3B6G D;  2F2A C;  1BH8 B;  3W98 B;  5B33 B;  5AVB B;  4M6B A;  1BH9 A;  3VH6 T;  1U35 A;  3AZK A;  4CSR B;  2ZY5 A;  5GXQ D;  3REJ D;  1P3K B;  3MGQ C;  3W99 B;  5CPI D;  3A1I A;  3AV2 B;  3W97 B;  1F1E A;  1TZY D;  4KUD A;  4AWL C;  3UTB B;  5GT0 D;  3REK B;  3X1V A;  1P3I A;  3LJA C;  1WWI A;  5B0Z C;  1P3B D;  3WKJ C;  4J8W C;  4J8U C;  2FJ7 B;  3AYW B;  1M1A D;  3WTP D;  3X1S C;  4WU9 C;  5DNN C;  2Y2M A;  3AZG D;  1P3P A;  2NQB D;  5AV6 C;  4Z2M G;  2UWX A;  5JRG C;  3C1B B;  2HIO A;  2G5I C;  3WAA C;  3B6F C;  5DNM C;  3W98 C;  3LEL A;  5B33 C;  5CPJ B;  5AVB C;  1KX5 B;  1P3F C;  4JJN D;  3W99 C;  5CP6 A;  1P3K C;  3LEL B;  4KHA A;  1H3O B;  1T3U A;  3AV2 C;  5GXQ A;  5KDM A;  3VH6 W;  3UTB C;  3REK C;  5BO0 A;  1W2E A;  5CPI A;  3WA9 B;  4WNN B;  4DRA A;  5CP6 B;  1TZY A;  2ZY4 A;  3AN2 A;  2FJ7 C;  3AYW C;  3AZJ A;  1P3M D;  2NZD D;  1P3B A;  2ARO D;  4KUD C;  2JE5 A;  3V9R A;  5CPK A;  3R45 A;  3X1V C;  1HQ3 B;  5B2I A;  3MNN B;  5GT3 B;  3X1T B;  2BYM A;  2DF4 C;  3X1U D;  1M1A A;  2JCH A;  4H9Q B;  1P34 B;  4YM6 D;  3AZG A;  3AZN D;  1JFI A;  2NQB A;  3MVD A;  3AZJ B;  1KX3 D;  1KX5 C;  1M18 B;  2RVQ D;  1AOI B;  3MGR D;  1S32 D;  4WV4 B;  3AZH D;  5AV5 D;  3LEL C;  4H9P B;  4JJN A;  4Z5T B;  1ID3 D;  3O62 B;  1EQZ D;  3UTA B;  3LZ1 A;  3WA9 C;  3AZE D;  4KGC B;  3NQJ A;  5CP6 C;  4DQY B;  1ZLA D;  4UPK A;  5FUG A;  4J8V A;  3LZ1 B;  3KUY A;  3A1K A;  1HQ3 C;  3IP4 C;  5GT3 C;  5B2J D;  2J8P A;  2NZD A;  1P3M A;  1TZY C;  4J8X D;  2ARO A;  3AZM D;  5B24 A;  3AN2 C;  5GSU A;  4WU8 D;  3TU4 B;  3VH5 A;  3AZJ C;  3KWQ D;  5AV8 D;  5E5A D;  3X1U A;  3KUY B;  5CPK C;  1P3G B;  5B2I C;  1KX4 D;  1F66 D;  3EG5 B;  5BNV B;  3AZN A;  2CV5 D;  1AOI C;  2XD1 A;  3MGS D;  1M1A C;  4Z66 B;  5G49 A;  1KX3 A;  3MGP D;  3AV1 A;  5B24 B;  5GSU B;  3MVD C;  4Z5T C;  3O62 C;  3AFA D;  3MGR A;  2ZM5 A;  4CAY A;  1S32 A;  3UTA C;  5B0Y D;  3EPH A;  5AV5 A;  4KGC C;  1WWS A;  1TAF A;  1P3A D;  3AZL B;  3AV1 B;  1ID3 A;  1EQZ A;  5B40 D;  2RIQ A;  5B31 G;  3LZ1 C;  5AV9 D;  3MGQ B;  1ZLA A;  3A6N B;  5B1M D;  3REH B;  4AWL B;  5B2J A;  4J8V C;  3KUY C;  4QLC D;  3AZF D;  4J8W B;  1P3G C;  3AZM A;  4WU8 A;  5AVC B;  4Z66 C;  3KWQ A;  4UUZ A;  5AV8 A;  5B24 C;  5GSU C;  4WU9 B;  5E5A A;  5JA4 A;  1F66 A;  4X23 B;  2CV5 A;  5AV6 B;  3MGS A;  5JRG B;  3WAA B;  3MGP A;  5DNM B;  4H9O B;  3KXB D;  4WJ3 C;  3AZL C;  3AV1 C;  3AFA A;  5JA4 B;  3C1B D;  5B0Y A;  5AY8 B;  1P3F B;  1S32 C;  5B31 B;  1P3A A;  2L5A A;  3W96 B;  5AV5 C;  5B40 A;  3A6N C;  1BH9 B;  4R8P A;  1U35 B;  1EQZ C;  3AZK B;  3REH C;  3B0C T;  5AV9 A;  1M19 A;  4XUJ D;  5B1M A;  3B0B A;  5AVC C;  1ZLA C;  4R8P B;  1P3L D;  5B32 D;  4KUD B;  2YFV A;  2PYO D;  4QLC A;  4X23 C;  3AZF A;  1M19 B;  2F8N H;  5B2J C;  3X1V B;  1P3I B;  4XZQ D;  3LZ0 D;  4WU8 C;  1BFM A;  3KWQ C;  4YS3 D;  4H9S A;  5E5A C;  1P3P B;  4ZUX D;  1R4V A;  1A7W A;  5B1L D;  5AY8 C;  3KXB A;  3B6G A;  5B31 C;  3W96 C;  2HIO B;  2F8N D;  5F99 D;  4H9N A;  1M18 D;  3UT9 D;  2ZY2 A;  3AFA C;  3H0R C;  1U35 C;  3REJ A;  3AZK C;  1P3O D;  3B6G B;  3WTP E;  2Y2I A;  2Y2J A;  4KHA B;  3C1C D;  5GXQ B;  4R8P C;  5GT0 A;  3REJ B;  3AZI D;  2Y2P A;  5KDM B;  5AV9 C;  4XUJ A;  1M19 C;  5BO0 B;  5CPI B;  3B0C W;  1P3I C;  5CHL B;  2VQR A;  1P3L A;  3WTP A;  1TZY B;  3AN2 B;  5GT0 B;  1P3B B;  1P3P C;  4XZQ A;  3LZ0 A;  3V9R B;  5CPK B;  3R45 B;  3REL D;  5B2I B;  2IO5 B;  2BYM B;  2HIO C;  4YS3 A;  1M1A B;  3WTP B;  3TU4 D;  2YFW A;  1JFI B;  3AZG B;  3NQU A;  2NQB B;  1N1J A;  5B1L A;  3MVD B;  3REI D;  2F8N A;  3B6G C;  5F99 A;  2DQN C;  2Y2L A;  3UT9 A;  4LD9 D;  5BT1 D;  1P3O A;  5C3I B;  5GXQ C;  4JJN B;  4NE5 A;  3REJ C;  2Y2N A;  5CPI C;  2HUE B;  4G91 C;  3C1C A;  3NQJ B;  4H9R A;  5GT0 C;  5FUG B;  1P3B C;  4J8V B;  2IO5 C;  4YM6 A;  2NZD B;  3WTP C;  1P3M B;  2ARO B;  3AZG C;  2NQB C;  3LJA D;  5B0Z D;  3REL A;  3WKJ D;  4J8W D;  4XZQ C;  3X1U B;  3VH6 A;  4J8U D;  3AZH A;  4YM6 B;  3AZN B;  4YS3 C;  3X1S D;  5G49 B;  1KX3 B;  5DNN D;  5AV6 D;  5C3I C;  4JJN C;  5BS7 A;  3B6F D;  5DNM D;  3MGR B;  3EPL A;  3AZE A;  4CAY B;  1S32 B;  3W98 D;  4LD9 A;  5B33 D;  3AZH B;  5AV5 B;  2HUE C;  5AVB D;  1TAF B;  1ID3 B;  1P3O C;  1EQZ B;  4NFT A;  2JSS A;  3W99 D;  4WZS B;  3AZE B;  1P3K D;  4J8X A;  3AV2 D;  3W97 D;  1Z2C B;  1ZLA B;  2NZD C;  1P3M C;  3UTB D;  2ARO C;  3REK D;  3REI A;  1KX4 A;  5B2J B;  3X1U C;  4J8X B;  2FJ7 D;  3AZM B;  4YM6 C;  4WU8 B;  3AZN C;  3AYW D;  3LJA A;  4G92 B;  5B0Z A;  3KWQ B;  1KX3 C;  4UUZ B;  3WKJ A;  5AV8 B;  3X1V D;  5E5A B;  1F66 B;  4J8U A;  3REL C;  2RVQ C;  2CV5 B;  3MGR C;  3MGS B;  3X1S A;  1B67 A;  5CPJ D;  3MGP B;  3AZH C;  1KX5 D;  2Y2H A;  1ID3 C;  3B6F A;  3AFA B;  3KFU G;  3VH5 T;  1BH8 A;  3W98 A;  5B0Y B;  5AVB A;  2BG1 A;  3AZE C;  4ZBJ C;  1P3A B;  3LEL D;  4CSR A;  5B40 B;  4Z2M H;  1P3K A;  3W99 A;  2CWE A;  2FFF B;  3WA9 D;  5AV9 B;  3AV2 A;  3W97 A;  5CP6 D;  3B0D B;  4J8X C;  3UTB A;  2W8S A;  3AZM C;  5B1M B;  3REK A;  4G92 C;  5AV8 C;  1HQ3 D;  2YFV B;  3MNN D;  5GT3 D;  3X1T D;  4QLC B;  3AZF B;  1KX4 C;  2Y2K A;  1F66 C;  3AYW A;  2CV5 C;  2FJ7 A;  3MGS C;  3AN2 D;  1P34 D;  3MGP C;  2LY8 A;  5B32 G;  3AZJ D;  4EO5 C;  3C1B A;  1KU5 A;  5CPK D;  5B2I D;  5B0Y C;  5CPJ A;  1AOI D;  4E45 A;  3KXB B;  1KX5 A;  1P3A C;  4HGA C;  2F8N K;  1Q9C A;  3MVD D;  4H9N B;  5B40 C;  4Z5T D;  3O62 D;  3UTA D;  3FDD A;  2F8N G;  1H3O A;  4KGC D;  3VH5 W;  2G5H C;  3B0D C;  4G91 B;  5B1M C;  5B32 A;  3WA9 A;  2PYO A;  4WNN A;  3LZ1 D;  4QLC C;  3AZF C;  4XUJ B;  3W97 C;  3AL0 C;  1P3L B;  5B32 B;  1HQ3 A;  3MNN A;  2PYO B;  5GT3 A;  3X1T A;  4H9S C;  4ZUX A;  4J8V D;  3KUY D;  3P5J B;  1P3G D;  4H9Q A;  3H0L C;  4XZQ B;  1P34 A;  1PZR A;  3LZ0 B;  4Z66 D;  3KXB C;  1M18 A;  4NE6 A;  2Y2O A;  5GSU D;  5B24 D;  4YS3 B;  2YFW B;  3C1B C;  3NQU B;  1AOI A;  4ZUX B;  1N1J B;  5B1L B;  3EPJ A;  2F8N B;  1ULY A;  2Y2G A;  5CPJ C;  4H9P A;  5F99 B;  4Z5T A;  3UT9 B;  3AZL D;  3O62 A;  3AV1 D;  5BNX A;  3UTA A;  3AZI A;  1P3O B;  4KGC A;  3MGQ D;  2XD5 A;  4XUJ C;  4NE3 A;  3A6N D;  3C1C B;  5BNX B;  3REH D;  1P3L C;  3AZI B;  5B32 C;  4H9R B;  2PYO C;  3LZ0 C;  5AVC D;  3TU4 A;  2Y2Q A;  3EPK A;  4WU9 D;  1B6W A;  4X23 D;  3MNN C;  4DRB A;  1P3G A;  3X1T C;  5BNV A;  4ZUX C;  5B1L C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...