1P3KD

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
92
structure length
92
Chain Sequence
KESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
total genus 35
structure length 92
sequence length 92
chains with identical sequence H
ec nomenclature
pdb deposition date 2003-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3kD00
3MVDA 4WU9B 1M18C 3AV1D 2AROB 1H3OB 5AVBB 3AZFB 3REJB 2HIOD 2F8NB 4JJND 3UTBB 4M6BA 3AFAD 2L5AA 1BH8B 3AN2B 1P3KA 3KWQC 1ID3C 3WA9B 1P3AC 3AZNA 3AZND 3REIA 3AYWA 3RELA 5GT0C 4JJNA 4H9PA 5B0ZC 3W96B 4Z66A 4WNNB 2CV5B 3W97D 3AZKB 5F99C 2NZDB 5CPJC 1TAFB 5AV6B 1KX5B 3RELD 4XZQC 5KDMB 4J8UC 5FUGB 5AV9D 3KXBC 3TU4C 4Z66D 3MGSB 5GXQA 3W98B 5GXQD 4ZUXA 2AROC 4G91C 5B1MB 4KUDD 3NQUA 3AZNB 5DNND 1BH9A 5DNNA 1BH8A 3AN2A 1P3KB 4J8VB 3UT9C 2HIOC 1HQ3B 4XUJB 1AOIA 5DNMA 4J8XB 5DNMD 3O62D 5B40C 1B6WA 3AZFA 3KWQB 5B1MC 4XZQA 3AV2A 1BFMA 3AZEC 4G92B 5CP6B 3V9RB 2RVQC 3UT9B 4XZQB 4ZUXB 2NZDC 3AZMC 3AZID 1P3MD 1U35A 3REKC 5KDMA 3VH5W 4J8WB 3WA9D 3MGQC 3UTAC 3AZLD 2YFVA 5BO0A 5AV9A 4ZBJC 1P3BB 4WU8D 5AVCB 5CPJA 5DNMB 2BYMA 3W98A 1P3PD 4EO5B 3NQJB 5B0YD 4E45A 3W97A 5GT0A 3X1VD 1EQZB 1F66B 5B24C 5B40D 5DNMC 3AZIA 5B31A 4Z66B 5GXQB 3AZIB 4KGCD 4H9SC 1F1EA 3AN2C 2FJ7A 1P3PA 3REHB 5AV6A 4CAYB 1P3IA 3X1TA 5GT3B 5C3IC 1A7WA 3REID 4R8PA 2FJ7B 4WNNA 3MGPA 4AWLC 4X23A 4J8XD 3REJA 5CPIC 2F8NG 1P3BA 1H3OA 5CP6C 2YFVB 1M18D 1KX3D 3VH6W 1HTAA 5CP6D 3REJC 1F66D 5B40A 5CPKC 4UUZA 2F8NA 3A6NA 1JFIB 1P3PC 4H9NA 4NFTA 4ZUXD 3LZ0C 3C1CD 3AZNC 3B0CT 5GT3D 3AZED 4J8WD 1ZLAA 4J8WA 1ZLAD 5B24D 4WU8A 3AZLB 1M19C 1S32A 3AZIC 1P34C 4H9OB 4HGAB 3W97C 2PYOC 4EO5C 1TZYB 4NE3A 5F99D 3LZ1A 4KUDA 1R4VA 4Z5TA 5BNVA 3LZ1C 3REIC 5GSUD 5B1MA 1B67A 5B0ZB 3AZLC 3WTPA 3B6GA 3KSYA 3B0CW 1ID3A 4H9NB 1ID3D 4WU8C 1WWIA 3MGPB 5B32C 4KGCB 4E44A 1P3OB 5B24A 3R45B 1P3LA 3AZEB 1ZLAB 5B0YC 4CAYA 2NZDA 5CPKA 2FJ7C 2F8NK 2HUEB 3AFAB 4Z2MH 3KUYA 5JRGD 2CV5A 5F99A 4ZUXC 1TZYD 2IO5B 3MGSA 3AZGC 3AFAA 4KGCC 1F66A 1P3IB 4WU9C 1M18B 1KX3B 3WAAA 5JA4A 1HQ3C 5GSUB 2CV5D 1P3LD 4X23C 3B6FA 3X1UC 2NZDD 3AZJC 3AZGB 5DNNC 5B0YA 5CPID 5B31C 1M1AB 3WA9A 3X1SD 4H9RA 3LZ0A 5B24B 5B31D 5B1MD 3MGRD 1F66C 3X1VA 3WTPD 3B6GD 3C1BA 2HUEC 3AFAC 4KGCA 4Z5TC 5B32D 5F99B 5B1LD 4Z5TD 3MGQB 3UTAB 5BS7C 4YM6D 3B0DB 3LZ0D 3C1CC 1P34D 2PYOA 5GT0D 3R45A 1WWSA 4NE6A 5AVCC 1P3LB 4LD9C 5B32G 3AZGD 1KX4B 1ID3B 4QLCA 4YS3D 2JSSA 3O62A 4G92C 4YM6A 3MGPD 2PYOD 3VH6A 4XZQD 3LJAA 3AZLA 3X1UB 5AY8B 1M19B 3WAAD 5B2JD 3X1UA 3C1BD 4Z2MG 1S32D 2BYKA 5B2JC 4J8XC 1Q9CA 4KUDC 1HQ3A 5B1LB 1P3BD 4H9RB 3LZ0B 3NQUB 3MGSC 1P3ID 1P3PB 3AV2B 3B0BA 4R8PD 1KX4D 3A6ND 4YS3B 3RELC 5B31G 5E5AB 4WU9D 1KX4C 3AV1B 1P3LC 1ZLAC 3X1UD 5JA4B 5GSUA 1M19D 3LELD 3AZHD 1M18A 3WAAB 4LD9B 4CSRA 1M1AD 1M1AA 4LD9A 3X1SB 3WKJA 1P3FD 3AZKA 3KUYD 1KX5C 5C3IB 3AZGA 5CPJB 5B32B 5AVCA 5AVBA 3REIB 5AV9B 3WAAC 4WU9A 3B6FB 1P34B 3C1BC 2CWEA 3AYWC 5GT0B 1S32C 1P34A 4HGAC 3W97B 3W99B 4JJNC 3X1SC 3NQJA 3AYWD 5CHLB 3MGRC 1P3FA 5BNXB 4H9SA 4H9QA 5E5AD 3REKA 4J8WC 2RVQD 5E5AC 3MGSD 4J8VD 3LELB 3AZHB 4XUJD 3AZJA 5CPKB 1P3IC 4LD9D 4CSRB 5AY8D 5AY8A 5B2JB 1N1JA 1P3GD 4KUDB 5CPJD 2F8NH 4QLCB 1HQ3D 5BT1D 3MVDB 1M19A 3W99D 3KUYC 1P3MB 5AV8D 1U35B 5AV8A 3W99C 1P3AD 1P3GA 5B1LA 5AV5B 3A6NB 4UUZB 3WKJC 4XUJA 3LJAD 3W99A 5CPKD 4WU8B 3WKJD 1TAFA 3WTPC 3B6GC 3O62C 3LELA 3AZHA 3MGRA 3W96A 1AOID 4NE5A 3B6FC 1AOIC 4Z66C 5AVCD 5B2JA 2AROD 5AVBD 4ZBJB 3AZJD 1KX5A 3B6FD 5AV6C 3UTBD 3UTBA 5E5AA 3REKD 1KX3C 5AV5D 5B32A 5BNXA 3WA9C 2AROA 5AV5C 5GSUC 4KHAA 3X1SA 3WKJB 1U35C 3AZMB 3W96D 5CPIB 3AZKD 5BS7A 3REHD 3KXBA 4DRAA 4QLCD 3TU4A 4YS3A 5B31B 3RELB 5G49B 3AZFC 2FJ7D 3MNND 3AV2C 1P3MC 4R8PC 4YS3C 1P3AA 3MGPC 3AV1A 3VH5T 4YM6B 1KX4A 2BYMB 3LZ1D 5B33B 5B2IA 3LELC 3AZHC 5AV8C 5GXQC 1P3FC 3X1TD 5BNVB 5BT1C 2IO5C 5B2IC 3KWQD 1KU5A 4J8UB 5B2ID 1AOIB 3C1BB 4J8VA 3B0DC 1S32B 3W98C 3C1CA 5B0ZA 1N1JB 5B0ZD 3MNNB 3UT9A 3UT9D 1TZYC 3W96C 3AZJB 5CP6A 3AZKC 4WZSB 3MGQA 3UTAA 5G49A 3REKB 3KWQA 5AV9C 3LZ1B 2HIOA 4YM6C 2CV5C 5B33D 3KXBD 3TU4D 1M1AC 2YFWB 4DRBA 4H9OA 3MNNC 3AV2D 4R8PB 5FUGA 5B33C 3UTBC 1P3GC 3AZMD 3AZMA 3AV1C 3REHA 2LY8A 1P3OD 5B2IB 5B0YB 4X23B 2NQBA 3MVDC 2NQBD 1P3OC 3VH6T 3X1VB 1P3FB 1EQZD 3KUYB 5JRGB 5CPIA 1ULYA 5B40B 1P3OA 4KHAB 3VH5A 1P3KC 5JRGA 3AZFD 2HIOB 4XUJC 3KXBB 3REHC 4H9PB 3X1VC 3LJAC 5AY8C 4JJNB 3TU4B 3AYWB 3MGRB 4G91B 5JRGC 1EQZA 1KX3A 3X1TB 4AWLB 3MGQD 3UTAD 2YFWA 1TZYA 2NQBB 4WV4B 4J8UD 4J8UA 1P3GB 2BYKB 3WTPB 5BO0B 3B6GB 1P3MA 5AV6D 3AZEA 1KX5D 4Z5TB 3X1TC 1P3BC 3C1CB 5B33A 3MVDD 2NQBC 3W98D 5AV5A 1EQZC 1JFIA 4J8XA 3REJD 2F8ND 5AV8B 1U35D 1P3AB 3A6NC 3AN2D 5DNNB 2PYOB 1P3KD 3MNNA 5B1LC 3LJAB 4QLCC 5GT3C 5AVBC 3O62B 4X23D 4H9QB 4J8VC 3WTPE 1BH9B 5GT3A 3V9RA
chains in the Genus database with same CATH superfamily
3MVDA 4WU9B 1M18C 3AV1D 2AROB 1H3OB 5AVBB 3AZFB 3REJB 2HIOD 2F8NB 4JJND 3UTBB 4M6BA 3AFAD 2L5AA 1BH8B 3AN2B 1P3KA 3KWQC 1ID3C 3WA9B 1P3AC 3AZNA 3AZND 3REIA 3AYWA 3RELA 3P5JB 5GT0C 4JJNA 3IP4C 4H9PA 5B0ZC 3W96B 4Z66A 4WNNB 2CV5B 3W97D 3AZKB 5F99C 2NZDB 5CPJC 1TAFB 5AV6B 1KX5B 3RELD 4XZQC 5KDMB 4J8UC 5FUGB 5AV9D 3KXBC 3TU4C 4Z66D 3MGSB 5GXQA 3W98B 5GXQD 4ZUXA 2AROC 4G91C 5B1MB 4KUDD 3NQUA 3AZNB 5DNND 1BH9A 5DNNA 1BH8A 3AN2A 2UWXA 1P3KB 4J8VB 3UT9C 2HIOC 1HQ3B 4XUJB 1AOIA 5DNMA 4J8XB 5DNMD 3O62D 5B40C 1B6WA 3AZFA 3KWQB 5B1MC 4XZQA 1Z2CB 3AV2A 1BFMA 3AZEC 4G92B 5CP6B 3V9RB 2RVQC 3UT9B 4XZQB 4ZUXB 2NZDC 3AZMC 3AZID 1P3MD 1U35A 3REKC 5KDMA 3VH5W 4J8WB 3WA9D 3MGQC 3UTAC 3AZLD 2YFVA 5BO0A 5AV9A 4ZBJC 1P3BB 4WU8D 5AVCB 2ZM5A 5CPJA 5DNMB 2BYMA 3W98A 1P3PD 4EO5B 3NQJB 5B0YD 4E45A 3W97A 5GT0A 3X1VD 1EQZB 1F66B 5B24C 5B40D 5DNMC 3AZIA 5B31A 4Z66B 5GXQB 3AZIB 4KGCD 4H9SC 1F1EA 3AN2C 2FJ7A 2ZY3A 1P3PA 3REHB 5AV6A 4CAYB 1P3IA 3X1TA 5GT3B 5C3IC 1A7WA 2Y2LA 4R8PA 3REID 2FJ7B 4WNNA 3MGPA 4AWLC 4X23A 4J8XD 3REJA 5CPIC 2F8NG 2ZY4A 1P3BA 1H3OA 5CP6C 2YFVB 1M18D 1KX3D 3VH6W 1HTAA 5CP6D 3REJC 1F66D 5B40A 5CPKC 4UUZA 2F8NA 3A6NA 1JFIB 1P3PC 4H9NA 3H0LC 4NFTA 4ZUXD 3LZ0C 3C1CD 3AZNC 3B0CT 5GT3D 3AZED 4J8WD 1ZLAA 4J8WA 1ZLAD 5B24D 4WU8A 3AZLB 1M19C 1S32A 3H0RC 3AZIC 1P34C 4H9OB 4HGAB 3W97C 2PYOC 4EO5C 1TZYB 4NE3A 5F99D 3LZ1A 4KUDA 2ZY2A 1R4VA 4Z5TA 5BNVA 3LZ1C 3REIC 5GSUD 3EPJA 5B1MA 4WJ3C 1B67A 5B0ZB 3AZLC 3WTPA 3B6GA 3KSYA 3B0CW 1ID3A 4H9NB 1ID3D 4WU8C 1WWIA 3MGPB 5B32C 4KGCB 4E44A 1P3OB 5B24A 3R45B 1P3LA 3AZEB 1ZLAB 5B0YC 4CAYA 2NZDA 5CPKA 2FJ7C 2F8NK 2HUEB 3AFAB 4Z2MH 3KUYA 5JRGD 2CV5A 5F99A 4ZUXC 1TZYD 2IO5B 2Y2QA 4UPKA 3MGSA 3AZGC 3EPHA 2Y2JA 3AFAA 4KGCC 1F66A 1P3IB 4WU9C 1M18B 1KX3B 3WAAA 5JA4A 1HQ3C 5GSUB 2CV5D 1P3LD 4X23C 3B6FA 3X1UC 2NZDD 2Y2MA 3AZJC 3AZGB 5DNNC 5B0YA 3EPLA 5CPID 5B31C 1M1AB 3WA9A 3X1SD 4H9RA 3A1KA 3LZ0A 5B24B 5B31D 5B1MD 2JE5A 3MGRD 1F66C 3X1VA 3WTPD 3B6GD 3C1BA 2HUEC 3AFAC 4KGCA 2BG1A 4Z5TC 5B32D 2G5HC 5F99B 5B1LD 4Z5TD 3MGQB 3UTAB 5BS7C 4YM6D 3B0DB 3LZ0D 3C1CC 1P34D 2PYOA 5GT0D 1PZRA 1WWSA 2XD5A 3R45A 4NE6A 5AVCC 1P3LB 2J8PA 4LD9C 5B32G 3AL0C 3AZGD 1KX4B 1ID3B 4QLCA 4YS3D 2JSSA 3O62A 2Y2PA 4G92C 4YM6A 3MGPD 2PYOD 3VH6A 4XZQD 3LJAA 3AZLA 3X1UB 5AY8B 1M19B 3WAAD 5B2JD 3X1UA 3C1BD 4Z2MG 1S32D 2BYKA 5B2JC 4J8XC 1Q9CA 4KUDC 1HQ3A 5B1LB 3EG5B 1P3BD 4H9RB 3LZ0B 3NQUB 3MGSC 1P3ID 1P3PB 2Y2IA 3AV2B 3B0BA 4R8PD 1KX4D 3A6ND 4YS3B 3RELC 5B31G 5E5AB 4WU9D 1KX4C 3AV1B 1P3LC 1ZLAC 3X1UD 5JA4B 5GSUA 1M19D 3LELD 3AZHD 1M18A 3WAAB 4LD9B 4CSRA 1M1AD 1M1AA 4LD9A 3X1SB 3WKJA 1P3FD 3AZKA 3KUYD 1KX5C 5C3IB 3AZGA 5CPJB 5B32B 5AVCA 5AVBA 3REIB 5AV9B 3WAAC 4WU9A 3B6FB 1P34B 3C1BC 2CWEA 3AYWC 5GT0B 1S32C 1P34A 4HGAC 3W97B 3W99B 3H0MC 4JJNC 3X1SC 3NQJA 3AYWD 5CHLB 3MGRC 1P3FA 5BNXB 4H9SA 4H9QA 5E5AD 3REKA 4J8WC 2RVQD 5E5AC 3MGSD 4J8VD 3LELB 3AZHB 4XUJD 3AZJA 5CPKB 1P3IC 4LD9D 4CSRB 5AY8D 5AY8A 5B2JB 1N1JA 1P3GD 4KUDB 5CPJD 2F8NH 4QLCB 1HQ3D 5BT1D 3MVDB 1M19A 3W99D 3KUYC 2ZY5A 1P3MB 1W2EA 5AV8D 1U35B 5AV8A 3W99C 2W8SA 1P3AD 1P3GA 5B1LA 5AV5B 3A6NB 4UUZB 3WKJC 4XUJA 3LJAD 3W99A 5CPKD 4WU8B 3WKJD 1TAFA 3WTPC 3B6GC 3O62C 3LELA 3AZHA 3MGRA 3W96A 1AOID 4NE5A 3B6FC 1AOIC 4Z66C 5AVCD 5B2JA 2AROD 5AVBD 4ZBJB 3AZJD 1KX5A 3B6FD 2Y2NA 5AV6C 3UTBD 3UTBA 5E5AA 3REKD 1KX3C 5AV5D 5B32A 5BNXA 3WA9C 1T3UA 2AROA 5AV5C 5GSUC 4KHAA 2VQRA 3X1SA 3WKJB 1U35C 3AZMB 3W96D 2G5IC 5CPIB 3AZKD 5BS7A 3REHD 3KXBA 4DRAA 4QLCD 3TU4A 4YS3A 5B31B 3RELB 5G49B 3AZFC 2FJ7D 3MNND 3AV2C 3EPKA 1P3MC 4R8PC 4YS3C 1P3AA 3MGPC 3AV1A 3VH5T 4YM6B 1KX4A 3A1IA 2BYMB 3LZ1D 5B33B 5B2IA 3LELC 3AZHC 5AV8C 5GXQC 1P3FC 3X1TD 3KFUG 5BNVB 5BT1C 2IO5C 2RIQA 5B2IC 1KU5A 3KWQD 4J8UB 5B2ID 1AOIB 3C1BB 4J8VA 3B0DC 1S32B 3W98C 3C1CA 5B0ZA 1N1JB 5B0ZD 3MNNB 3UT9A 3UT9D 1TZYC 3W96C 3AZJB 5CP6A 3AZKC 4WZSB 3MGQA 3UTAA 5G49A 2Y2KA 3KWQA 3REKB 5AV9C 3LZ1B 2HIOA 4YM6C 2CV5C 5B33D 3KXBD 3TU4D 1M1AC 2FFFB 2YFWB 4DRBA 4H9OA 3MNNC 3AV2D 4R8PB 5FUGA 5B33C 2Y2HA 3UTBC 1P3GC 3AZMD 3AZMA 3AV1C 3REHA 2LY8A 1P3OD 5B2IB 5B0YB 4X23B 2NQBA 3MVDC 2NQBD 1P3OC 3VH6T 3X1VB 1P3FB 1EQZD 3KUYB 5JRGB 5CPIA 1ULYA 5B40B 1P3OA 4KHAB 3VH5A 1P3KC 5JRGA 3AZFD 2HIOB 4XUJC 3KXBB 3REHC 4H9PB 3X1VC 3LJAC 5AY8C 4JJNB 3TU4B 3AYWB 3F6TA 3MGRB 4G91B 5JRGC 4DQYB 1EQZA 1KX3A 3FDDA 3X1TB 4AWLB 3MGQD 3UTAD 2YFWA 1TZYA 2NQBB 4WV4B 2F2AC 4J8UA 4J8UD 2JCHA 2BYKB 1P3GB 3WTPB 5BO0B 3B6GB 1P3MA 5AV6D 3AZEA 1KX5D 4Z5TB 3X1TC 1P3BC 3C1CB 5B33A 3MVDD 2NQBC 3W98D 2DQNC 5AV5A 1JFIA 1EQZC 4J8XA 3REJD 2F8ND 5AV8B 1U35D 1P3AB 2Y2GA 3A6NC 3AN2D 5DNNB 2PYOB 1P3KD 3MNNA 5B1LC 3LJAB 4QLCC 2XD1A 2DF4C 5GT3C 5AVBC 3O62B 4X23D 4H9QB 4J8VC 3WTPE 2Y2OA 1BH9B 5GT3A 3V9RA
chains in the Genus database with same CATH topology
3MVDA 4WU9B 1M18C 3AV1D 2AROB 1H3OB 5AVBB 3AZFB 3REJB 2HIOD 2F8NB 4JJND 3UTBB 4M6BA 3AFAD 2L5AA 1BH8B 3AN2B 1P3KA 3KWQC 1ID3C 3WA9B 1P3AC 3AZNA 3AZND 3REIA 3AYWA 3RELA 3P5JB 5GT0C 4JJNA 3IP4C 4H9PA 5B0ZC 3W96B 4Z66A 4WNNB 2CV5B 3W97D 3AZKB 5F99C 2NZDB 5CPJC 1TAFB 5AV6B 1KX5B 3RELD 4XZQC 5KDMB 4J8UC 5FUGB 5AV9D 3KXBC 3TU4C 4Z66D 3MGSB 5GXQA 3W98B 5GXQD 4ZUXA 2AROC 4G91C 5B1MB 4KUDD 3NQUA 3AZNB 5DNND 1BH9A 5DNNA 1BH8A 3AN2A 2UWXA 1P3KB 4J8VB 3UT9C 2HIOC 1HQ3B 4XUJB 1AOIA 5DNMA 4J8XB 5DNMD 3O62D 5B40C 1B6WA 3AZFA 3KWQB 5B1MC 4XZQA 1Z2CB 3AV2A 1BFMA 3AZEC 4G92B 5CP6B 3V9RB 2RVQC 3UT9B 4XZQB 4ZUXB 2NZDC 3AZMC 3AZID 1P3MD 1U35A 3REKC 5KDMA 3VH5W 4J8WB 3WA9D 3MGQC 3UTAC 3AZLD 2YFVA 5BO0A 5AV9A 4ZBJC 1P3BB 4WU8D 5AVCB 2ZM5A 5CPJA 5DNMB 2BYMA 3W98A 1P3PD 4EO5B 3NQJB 5B0YD 4E45A 3W97A 5GT0A 3X1VD 1EQZB 1F66B 5B24C 5B40D 5DNMC 3AZIA 5B31A 4Z66B 5GXQB 3AZIB 4KGCD 4H9SC 1F1EA 3AN2C 2FJ7A 2ZY3A 1P3PA 3REHB 5AV6A 4CAYB 1P3IA 3X1TA 5GT3B 5C3IC 1A7WA 2Y2LA 4R8PA 3REID 2FJ7B 4WNNA 3MGPA 4AWLC 4X23A 4J8XD 3REJA 5CPIC 2F8NG 2ZY4A 1P3BA 1H3OA 5CP6C 2YFVB 1M18D 1KX3D 3VH6W 1HTAA 5CP6D 3REJC 1F66D 5B40A 5CPKC 4UUZA 2F8NA 3A6NA 1JFIB 1P3PC 4H9NA 3H0LC 4NFTA 4ZUXD 3LZ0C 3C1CD 3AZNC 3B0CT 5GT3D 3AZED 4J8WD 1ZLAA 4J8WA 1ZLAD 5B24D 4WU8A 3AZLB 1M19C 1S32A 3H0RC 3AZIC 1P34C 4H9OB 4HGAB 3W97C 2PYOC 4EO5C 1TZYB 4NE3A 5F99D 3LZ1A 4KUDA 2ZY2A 1R4VA 4Z5TA 5BNVA 3LZ1C 3REIC 5GSUD 3EPJA 5B1MA 4WJ3C 1B67A 5B0ZB 3AZLC 3WTPA 3B6GA 3KSYA 3B0CW 1ID3A 4H9NB 1ID3D 4WU8C 1WWIA 3MGPB 5B32C 4KGCB 4E44A 1P3OB 5B24A 3R45B 1P3LA 3AZEB 1ZLAB 5B0YC 4CAYA 2NZDA 5CPKA 2FJ7C 2F8NK 2HUEB 3AFAB 4Z2MH 3KUYA 5JRGD 2CV5A 5F99A 4ZUXC 1TZYD 2IO5B 2Y2QA 4UPKA 3MGSA 3AZGC 3EPHA 2Y2JA 3AFAA 4KGCC 1F66A 1P3IB 4WU9C 1M18B 1KX3B 3WAAA 5JA4A 1HQ3C 5GSUB 2CV5D 1P3LD 4X23C 3B6FA 3X1UC 2NZDD 2Y2MA 3AZJC 3AZGB 5DNNC 5B0YA 3EPLA 5CPID 5B31C 1M1AB 3WA9A 3X1SD 4H9RA 3A1KA 3LZ0A 5B24B 5B31D 5B1MD 2JE5A 3MGRD 1F66C 3X1VA 3WTPD 3B6GD 3C1BA 2HUEC 3AFAC 4KGCA 2BG1A 4Z5TC 5B32D 2G5HC 5F99B 5B1LD 4Z5TD 3MGQB 3UTAB 5BS7C 4YM6D 3B0DB 3LZ0D 3C1CC 1P34D 2PYOA 5GT0D 1PZRA 1WWSA 2XD5A 3R45A 4NE6A 5AVCC 1P3LB 2J8PA 4LD9C 5B32G 3AL0C 3AZGD 1KX4B 1ID3B 4QLCA 4YS3D 2JSSA 3O62A 2Y2PA 4G92C 4YM6A 3MGPD 2PYOD 3VH6A 4XZQD 3LJAA 3AZLA 3X1UB 5AY8B 1M19B 3WAAD 5B2JD 3X1UA 3C1BD 4Z2MG 1S32D 2BYKA 5B2JC 4J8XC 1Q9CA 4KUDC 1HQ3A 5B1LB 3EG5B 1P3BD 4H9RB 3LZ0B 3NQUB 3MGSC 1P3ID 1P3PB 2Y2IA 3AV2B 3B0BA 4R8PD 1KX4D 3A6ND 4YS3B 3RELC 5B31G 5E5AB 4WU9D 1KX4C 3AV1B 1P3LC 1ZLAC 3X1UD 5JA4B 5GSUA 1M19D 3LELD 3AZHD 1M18A 3WAAB 4LD9B 4CSRA 1M1AD 1M1AA 4LD9A 3X1SB 3WKJA 1P3FD 3AZKA 3KUYD 1KX5C 5C3IB 3AZGA 5CPJB 5B32B 5AVCA 5AVBA 3REIB 5AV9B 3WAAC 4WU9A 3B6FB 1P34B 3C1BC 2CWEA 3AYWC 5GT0B 1S32C 1P34A 4HGAC 3W97B 3W99B 3H0MC 4JJNC 3X1SC 3NQJA 3AYWD 5CHLB 3MGRC 1P3FA 5BNXB 4H9SA 4H9QA 5E5AD 3REKA 4J8WC 2RVQD 5E5AC 3MGSD 4J8VD 3LELB 3AZHB 4XUJD 3AZJA 5CPKB 1P3IC 4LD9D 4CSRB 5AY8D 5AY8A 5B2JB 1N1JA 1P3GD 4KUDB 5CPJD 2F8NH 4QLCB 1HQ3D 5BT1D 3MVDB 1M19A 3W99D 3KUYC 2ZY5A 1P3MB 1W2EA 5AV8D 1U35B 5AV8A 3W99C 2W8SA 1P3AD 1P3GA 5B1LA 5AV5B 3A6NB 4UUZB 3WKJC 4XUJA 3LJAD 3W99A 5CPKD 4WU8B 3WKJD 1TAFA 3WTPC 3B6GC 3O62C 3LELA 3AZHA 3MGRA 3W96A 1AOID 4NE5A 3B6FC 1AOIC 4Z66C 5AVCD 5B2JA 2AROD 5AVBD 4ZBJB 3AZJD 1KX5A 3B6FD 2Y2NA 5AV6C 3UTBD 3UTBA 5E5AA 3REKD 1KX3C 5AV5D 5B32A 5BNXA 3WA9C 1T3UA 2AROA 5AV5C 5GSUC 4KHAA 2VQRA 3X1SA 3WKJB 1U35C 3AZMB 3W96D 2G5IC 5CPIB 3AZKD 5BS7A 3REHD 3KXBA 4DRAA 4QLCD 3TU4A 4YS3A 5B31B 3RELB 5G49B 3AZFC 2FJ7D 3MNND 3AV2C 3EPKA 1P3MC 4R8PC 4YS3C 1P3AA 3MGPC 3AV1A 3VH5T 4YM6B 1KX4A 3A1IA 2BYMB 3LZ1D 5B33B 5B2IA 3LELC 3AZHC 5AV8C 5GXQC 1P3FC 3X1TD 3KFUG 5BNVB 5BT1C 2IO5C 2RIQA 5B2IC 1KU5A 3KWQD 4J8UB 5B2ID 1AOIB 3C1BB 4J8VA 3B0DC 1S32B 3W98C 3C1CA 5B0ZA 1N1JB 5B0ZD 3MNNB 3UT9A 3UT9D 1TZYC 3W96C 3AZJB 5CP6A 3AZKC 4WZSB 3MGQA 3UTAA 5G49A 2Y2KA 3KWQA 3REKB 5AV9C 3LZ1B 2HIOA 4YM6C 2CV5C 5B33D 3KXBD 3TU4D 1M1AC 2FFFB 2YFWB 4DRBA 4H9OA 3MNNC 3AV2D 4R8PB 5FUGA 5B33C 2Y2HA 3UTBC 1P3GC 3AZMD 3AZMA 3AV1C 3REHA 2LY8A 1P3OD 5B2IB 5B0YB 4X23B 2NQBA 3MVDC 2NQBD 1P3OC 3VH6T 3X1VB 1P3FB 1EQZD 3KUYB 5JRGB 5CPIA 1ULYA 5B40B 1P3OA 4KHAB 3VH5A 1P3KC 5JRGA 3AZFD 2HIOB 4XUJC 3KXBB 3REHC 4H9PB 3X1VC 3LJAC 5AY8C 4JJNB 3TU4B 3AYWB 3F6TA 3MGRB 4G91B 5JRGC 4DQYB 1EQZA 1KX3A 3FDDA 3X1TB 4AWLB 3MGQD 3UTAD 2YFWA 1TZYA 2NQBB 4WV4B 2F2AC 4J8UA 4J8UD 2JCHA 2BYKB 1P3GB 3WTPB 5BO0B 3B6GB 1P3MA 5AV6D 3AZEA 1KX5D 4Z5TB 3X1TC 1P3BC 3C1CB 5B33A 3MVDD 2NQBC 3W98D 2DQNC 5AV5A 1JFIA 1EQZC 4J8XA 3REJD 2F8ND 5AV8B 1U35D 1P3AB 2Y2GA 3A6NC 3AN2D 5DNNB 2PYOB 1P3KD 3MNNA 5B1LC 3LJAB 4QLCC 2XD1A 2DF4C 5GT3C 5AVBC 3O62B 4X23D 4H9QB 4J8VC 3WTPE 2Y2OA 1BH9B 5GT3A 3V9RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MVD A;  4WU9 B;  1M18 C;  3AV1 D;  2ARO B;  1H3O B;  5AVB B;  3AZF B;  3REJ B;  2HIO D;  2F8N B;  4JJN D;  3UTB B;  4M6B A;  3AFA D;  2L5A A;  1BH8 B;  3AN2 B;  1P3K A;  3KWQ C;  1ID3 C;  3WA9 B;  1P3A C;  3AZN A;  3AZN D;  3REI A;  3AYW A;  3REL A;  5GT0 C;  4JJN A;  4H9P A;  5B0Z C;  3W96 B;  4Z66 A;  4WNN B;  2CV5 B;  3W97 D;  3AZK B;  5F99 C;  2NZD B;  5CPJ C;  1TAF B;  5AV6 B;  1KX5 B;  3REL D;  4XZQ C;  5KDM B;  4J8U C;  5FUG B;  5AV9 D;  3KXB C;  3TU4 C;  4Z66 D;  3MGS B;  5GXQ A;  3W98 B;  5GXQ D;  4ZUX A;  2ARO C;  4G91 C;  5B1M B;  4KUD D;  3NQU A;  3AZN B;  5DNN D;  1BH9 A;  5DNN A;  1BH8 A;  3AN2 A;  1P3K B;  4J8V B;  3UT9 C;  2HIO C;  1HQ3 B;  4XUJ B;  1AOI A;  5DNM A;  4J8X B;  5DNM D;  3O62 D;  5B40 C;  1B6W A;  3AZF A;  3KWQ B;  5B1M C;  4XZQ A;  3AV2 A;  1BFM A;  3AZE C;  4G92 B;  5CP6 B;  3V9R B;  2RVQ C;  3UT9 B;  4XZQ B;  4ZUX B;  2NZD C;  3AZM C;  3AZI D;  1P3M D;  1U35 A;  3REK C;  5KDM A;  3VH5 W;  4J8W B;  3WA9 D;  3MGQ C;  3UTA C;  3AZL D;  2YFV A;  5BO0 A;  5AV9 A;  4ZBJ C;  1P3B B;  4WU8 D;  5AVC B;  5CPJ A;  5DNM B;  2BYM A;  3W98 A;  1P3P D;  4EO5 B;  3NQJ B;  5B0Y D;  4E45 A;  3W97 A;  5GT0 A;  3X1V D;  1EQZ B;  1F66 B;  5B24 C;  5B40 D;  5DNM C;  3AZI A;  5B31 A;  4Z66 B;  5GXQ B;  3AZI B;  4KGC D;  4H9S C;  1F1E A;  3AN2 C;  2FJ7 A;  1P3P A;  3REH B;  5AV6 A;  4CAY B;  1P3I A;  3X1T A;  5GT3 B;  5C3I C;  1A7W A;  3REI D;  4R8P A;  2FJ7 B;  4WNN A;  3MGP A;  4AWL C;  4X23 A;  4J8X D;  3REJ A;  5CPI C;  2F8N G;  1P3B A;  1H3O A;  5CP6 C;  2YFV B;  1M18 D;  1KX3 D;  3VH6 W;  1HTA A;  5CP6 D;  3REJ C;  1F66 D;  5B40 A;  5CPK C;  4UUZ A;  2F8N A;  3A6N A;  1JFI B;  1P3P C;  4H9N A;  4NFT A;  4ZUX D;  3LZ0 C;  3C1C D;  3AZN C;  3B0C T;  5GT3 D;  3AZE D;  4J8W D;  1ZLA A;  4J8W A;  1ZLA D;  5B24 D;  4WU8 A;  3AZL B;  1M19 C;  1S32 A;  3AZI C;  1P34 C;  4H9O B;  4HGA B;  3W97 C;  2PYO C;  4EO5 C;  1TZY B;  4NE3 A;  5F99 D;  3LZ1 A;  4KUD A;  1R4V A;  4Z5T A;  5BNV A;  3LZ1 C;  3REI C;  5GSU D;  5B1M A;  1B67 A;  5B0Z B;  3AZL C;  3WTP A;  3B6G A;  3KSY A;  3B0C W;  1ID3 A;  4H9N B;  1ID3 D;  4WU8 C;  1WWI A;  3MGP B;  5B32 C;  4KGC B;  4E44 A;  1P3O B;  5B24 A;  3R45 B;  1P3L A;  3AZE B;  1ZLA B;  5B0Y C;  4CAY A;  2NZD A;  5CPK A;  2FJ7 C;  2F8N K;  2HUE B;  3AFA B;  4Z2M H;  3KUY A;  5JRG D;  2CV5 A;  5F99 A;  4ZUX C;  1TZY D;  2IO5 B;  3MGS A;  3AZG C;  3AFA A;  4KGC C;  1F66 A;  1P3I B;  4WU9 C;  1M18 B;  1KX3 B;  3WAA A;  5JA4 A;  1HQ3 C;  5GSU B;  2CV5 D;  1P3L D;  4X23 C;  3B6F A;  3X1U C;  2NZD D;  3AZJ C;  3AZG B;  5DNN C;  5B0Y A;  5CPI D;  5B31 C;  1M1A B;  3WA9 A;  3X1S D;  4H9R A;  3LZ0 A;  5B24 B;  5B31 D;  5B1M D;  3MGR D;  1F66 C;  3X1V A;  3WTP D;  3B6G D;  3C1B A;  2HUE C;  3AFA C;  4KGC A;  4Z5T C;  5B32 D;  5F99 B;  5B1L D;  4Z5T D;  3MGQ B;  3UTA B;  5BS7 C;  4YM6 D;  3B0D B;  3LZ0 D;  3C1C C;  1P34 D;  2PYO A;  5GT0 D;  3R45 A;  1WWS A;  4NE6 A;  5AVC C;  1P3L B;  4LD9 C;  5B32 G;  3AZG D;  1KX4 B;  1ID3 B;  4QLC A;  4YS3 D;  2JSS A;  3O62 A;  4G92 C;  4YM6 A;  3MGP D;  2PYO D;  3VH6 A;  4XZQ D;  3LJA A;  3AZL A;  3X1U B;  5AY8 B;  1M19 B;  3WAA D;  5B2J D;  3X1U A;  3C1B D;  4Z2M G;  1S32 D;  2BYK A;  5B2J C;  4J8X C;  1Q9C A;  4KUD C;  1HQ3 A;  5B1L B;  1P3B D;  4H9R B;  3LZ0 B;  3NQU B;  3MGS C;  1P3I D;  1P3P B;  3AV2 B;  3B0B A;  4R8P D;  1KX4 D;  3A6N D;  4YS3 B;  3REL C;  5B31 G;  5E5A B;  4WU9 D;  1KX4 C;  3AV1 B;  1P3L C;  1ZLA C;  3X1U D;  5JA4 B;  5GSU A;  1M19 D;  3LEL D;  3AZH D;  1M18 A;  3WAA B;  4LD9 B;  4CSR A;  1M1A D;  1M1A A;  4LD9 A;  3X1S B;  3WKJ A;  1P3F D;  3AZK A;  3KUY D;  1KX5 C;  5C3I B;  3AZG A;  5CPJ B;  5B32 B;  5AVC A;  5AVB A;  3REI B;  5AV9 B;  3WAA C;  4WU9 A;  3B6F B;  1P34 B;  3C1B C;  2CWE A;  3AYW C;  5GT0 B;  1S32 C;  1P34 A;  4HGA C;  3W97 B;  3W99 B;  4JJN C;  3X1S C;  3NQJ A;  3AYW D;  5CHL B;  3MGR C;  1P3F A;  5BNX B;  4H9S A;  4H9Q A;  5E5A D;  3REK A;  4J8W C;  2RVQ D;  5E5A C;  3MGS D;  4J8V D;  3LEL B;  3AZH B;  4XUJ D;  3AZJ A;  5CPK B;  1P3I C;  4LD9 D;  4CSR B;  5AY8 D;  5AY8 A;  5B2J B;  1N1J A;  1P3G D;  4KUD B;  5CPJ D;  2F8N H;  4QLC B;  1HQ3 D;  5BT1 D;  3MVD B;  1M19 A;  3W99 D;  3KUY C;  1P3M B;  5AV8 D;  1U35 B;  5AV8 A;  3W99 C;  1P3A D;  1P3G A;  5B1L A;  5AV5 B;  3A6N B;  4UUZ B;  3WKJ C;  4XUJ A;  3LJA D;  3W99 A;  5CPK D;  4WU8 B;  3WKJ D;  1TAF A;  3WTP C;  3B6G C;  3O62 C;  3LEL A;  3AZH A;  3MGR A;  3W96 A;  1AOI D;  4NE5 A;  3B6F C;  1AOI C;  4Z66 C;  5AVC D;  5B2J A;  2ARO D;  5AVB D;  4ZBJ B;  3AZJ D;  1KX5 A;  3B6F D;  5AV6 C;  3UTB D;  3UTB A;  5E5A A;  3REK D;  1KX3 C;  5AV5 D;  5B32 A;  5BNX A;  3WA9 C;  2ARO A;  5AV5 C;  5GSU C;  4KHA A;  3X1S A;  3WKJ B;  1U35 C;  3AZM B;  3W96 D;  5CPI B;  3AZK D;  5BS7 A;  3REH D;  3KXB A;  4DRA A;  4QLC D;  3TU4 A;  4YS3 A;  5B31 B;  3REL B;  5G49 B;  3AZF C;  2FJ7 D;  3MNN D;  3AV2 C;  1P3M C;  4R8P C;  4YS3 C;  1P3A A;  3MGP C;  3AV1 A;  3VH5 T;  4YM6 B;  1KX4 A;  2BYM B;  3LZ1 D;  5B33 B;  5B2I A;  3LEL C;  3AZH C;  5AV8 C;  5GXQ C;  1P3F C;  3X1T D;  5BNV B;  5BT1 C;  2IO5 C;  5B2I C;  3KWQ D;  1KU5 A;  4J8U B;  5B2I D;  1AOI B;  3C1B B;  4J8V A;  3B0D C;  1S32 B;  3W98 C;  3C1C A;  5B0Z A;  1N1J B;  5B0Z D;  3MNN B;  3UT9 A;  3UT9 D;  1TZY C;  3W96 C;  3AZJ B;  5CP6 A;  3AZK C;  4WZS B;  3MGQ A;  3UTA A;  5G49 A;  3REK B;  3KWQ A;  5AV9 C;  3LZ1 B;  2HIO A;  4YM6 C;  2CV5 C;  5B33 D;  3KXB D;  3TU4 D;  1M1A C;  2YFW B;  4DRB A;  4H9O A;  3MNN C;  3AV2 D;  4R8P B;  5FUG A;  5B33 C;  3UTB C;  1P3G C;  3AZM D;  3AZM A;  3AV1 C;  3REH A;  2LY8 A;  1P3O D;  5B2I B;  5B0Y B;  4X23 B;  2NQB A;  3MVD C;  2NQB D;  1P3O C;  3VH6 T;  3X1V B;  1P3F B;  1EQZ D;  3KUY B;  5JRG B;  5CPI A;  1ULY A;  5B40 B;  1P3O A;  4KHA B;  3VH5 A;  1P3K C;  5JRG A;  3AZF D;  2HIO B;  4XUJ C;  3KXB B;  3REH C;  4H9P B;  3X1V C;  3LJA C;  5AY8 C;  4JJN B;  3TU4 B;  3AYW B;  3MGR B;  4G91 B;  5JRG C;  1EQZ A;  1KX3 A;  3X1T B;  4AWL B;  3MGQ D;  3UTA D;  2YFW A;  1TZY A;  2NQB B;  4WV4 B;  4J8U D;  4J8U A;  1P3G B;  2BYK B;  3WTP B;  5BO0 B;  3B6G B;  1P3M A;  5AV6 D;  3AZE A;  1KX5 D;  4Z5T B;  3X1T C;  1P3B C;  3C1C B;  5B33 A;  3MVD D;  2NQB C;  3W98 D;  5AV5 A;  1EQZ C;  1JFI A;  4J8X A;  3REJ D;  2F8N D;  5AV8 B;  1U35 D;  1P3A B;  3A6N C;  3AN2 D;  5DNN B;  2PYO B;  1P3K D;  3MNN A;  5B1L C;  3LJA B;  4QLC C;  5GT3 C;  5AVB C;  3O62 B;  4X23 D;  4H9Q B;  4J8V C;  3WTP E;  1BH9 B;  5GT3 A;  3V9R A; 
#chains in the Genus database with same CATH topology
 3MVD A;  4WU9 B;  1M18 C;  3AV1 D;  2ARO B;  1H3O B;  5AVB B;  3AZF B;  3REJ B;  2HIO D;  2F8N B;  4JJN D;  3UTB B;  4M6B A;  3AFA D;  2L5A A;  1BH8 B;  3AN2 B;  1P3K A;  3KWQ C;  1ID3 C;  3WA9 B;  1P3A C;  3AZN A;  3AZN D;  3REI A;  3AYW A;  3REL A;  3P5J B;  5GT0 C;  4JJN A;  3IP4 C;  4H9P A;  5B0Z C;  3W96 B;  4Z66 A;  4WNN B;  2CV5 B;  3W97 D;  3AZK B;  5F99 C;  2NZD B;  5CPJ C;  1TAF B;  5AV6 B;  1KX5 B;  3REL D;  4XZQ C;  5KDM B;  4J8U C;  5FUG B;  5AV9 D;  3KXB C;  3TU4 C;  4Z66 D;  3MGS B;  5GXQ A;  3W98 B;  5GXQ D;  4ZUX A;  2ARO C;  4G91 C;  5B1M B;  4KUD D;  3NQU A;  3AZN B;  5DNN D;  1BH9 A;  5DNN A;  1BH8 A;  3AN2 A;  2UWX A;  1P3K B;  4J8V B;  3UT9 C;  2HIO C;  1HQ3 B;  4XUJ B;  1AOI A;  5DNM A;  4J8X B;  5DNM D;  3O62 D;  5B40 C;  1B6W A;  3AZF A;  3KWQ B;  5B1M C;  4XZQ A;  1Z2C B;  3AV2 A;  1BFM A;  3AZE C;  4G92 B;  5CP6 B;  3V9R B;  2RVQ C;  3UT9 B;  4XZQ B;  4ZUX B;  2NZD C;  3AZM C;  3AZI D;  1P3M D;  1U35 A;  3REK C;  5KDM A;  3VH5 W;  4J8W B;  3WA9 D;  3MGQ C;  3UTA C;  3AZL D;  2YFV A;  5BO0 A;  5AV9 A;  4ZBJ C;  1P3B B;  4WU8 D;  5AVC B;  2ZM5 A;  5CPJ A;  5DNM B;  2BYM A;  3W98 A;  1P3P D;  4EO5 B;  3NQJ B;  5B0Y D;  4E45 A;  3W97 A;  5GT0 A;  3X1V D;  1EQZ B;  1F66 B;  5B24 C;  5B40 D;  5DNM C;  3AZI A;  5B31 A;  4Z66 B;  5GXQ B;  3AZI B;  4KGC D;  4H9S C;  1F1E A;  3AN2 C;  2FJ7 A;  2ZY3 A;  1P3P A;  3REH B;  5AV6 A;  4CAY B;  1P3I A;  3X1T A;  5GT3 B;  5C3I C;  1A7W A;  2Y2L A;  4R8P A;  3REI D;  2FJ7 B;  4WNN A;  3MGP A;  4AWL C;  4X23 A;  4J8X D;  3REJ A;  5CPI C;  2F8N G;  2ZY4 A;  1P3B A;  1H3O A;  5CP6 C;  2YFV B;  1M18 D;  1KX3 D;  3VH6 W;  1HTA A;  5CP6 D;  3REJ C;  1F66 D;  5B40 A;  5CPK C;  4UUZ A;  2F8N A;  3A6N A;  1JFI B;  1P3P C;  4H9N A;  3H0L C;  4NFT A;  4ZUX D;  3LZ0 C;  3C1C D;  3AZN C;  3B0C T;  5GT3 D;  3AZE D;  4J8W D;  1ZLA A;  4J8W A;  1ZLA D;  5B24 D;  4WU8 A;  3AZL B;  1M19 C;  1S32 A;  3H0R C;  3AZI C;  1P34 C;  4H9O B;  4HGA B;  3W97 C;  2PYO C;  4EO5 C;  1TZY B;  4NE3 A;  5F99 D;  3LZ1 A;  4KUD A;  2ZY2 A;  1R4V A;  4Z5T A;  5BNV A;  3LZ1 C;  3REI C;  5GSU D;  3EPJ A;  5B1M A;  4WJ3 C;  1B67 A;  5B0Z B;  3AZL C;  3WTP A;  3B6G A;  3KSY A;  3B0C W;  1ID3 A;  4H9N B;  1ID3 D;  4WU8 C;  1WWI A;  3MGP B;  5B32 C;  4KGC B;  4E44 A;  1P3O B;  5B24 A;  3R45 B;  1P3L A;  3AZE B;  1ZLA B;  5B0Y C;  4CAY A;  2NZD A;  5CPK A;  2FJ7 C;  2F8N K;  2HUE B;  3AFA B;  4Z2M H;  3KUY A;  5JRG D;  2CV5 A;  5F99 A;  4ZUX C;  1TZY D;  2IO5 B;  2Y2Q A;  4UPK A;  3MGS A;  3AZG C;  3EPH A;  2Y2J A;  3AFA A;  4KGC C;  1F66 A;  1P3I B;  4WU9 C;  1M18 B;  1KX3 B;  3WAA A;  5JA4 A;  1HQ3 C;  5GSU B;  2CV5 D;  1P3L D;  4X23 C;  3B6F A;  3X1U C;  2NZD D;  2Y2M A;  3AZJ C;  3AZG B;  5DNN C;  5B0Y A;  3EPL A;  5CPI D;  5B31 C;  1M1A B;  3WA9 A;  3X1S D;  4H9R A;  3A1K A;  3LZ0 A;  5B24 B;  5B31 D;  5B1M D;  2JE5 A;  3MGR D;  1F66 C;  3X1V A;  3WTP D;  3B6G D;  3C1B A;  2HUE C;  3AFA C;  4KGC A;  2BG1 A;  4Z5T C;  5B32 D;  2G5H C;  5F99 B;  5B1L D;  4Z5T D;  3MGQ B;  3UTA B;  5BS7 C;  4YM6 D;  3B0D B;  3LZ0 D;  3C1C C;  1P34 D;  2PYO A;  5GT0 D;  1PZR A;  1WWS A;  2XD5 A;  3R45 A;  4NE6 A;  5AVC C;  1P3L B;  2J8P A;  4LD9 C;  5B32 G;  3AL0 C;  3AZG D;  1KX4 B;  1ID3 B;  4QLC A;  4YS3 D;  2JSS A;  3O62 A;  2Y2P A;  4G92 C;  4YM6 A;  3MGP D;  2PYO D;  3VH6 A;  4XZQ D;  3LJA A;  3AZL A;  3X1U B;  5AY8 B;  1M19 B;  3WAA D;  5B2J D;  3X1U A;  3C1B D;  4Z2M G;  1S32 D;  2BYK A;  5B2J C;  4J8X C;  1Q9C A;  4KUD C;  1HQ3 A;  5B1L B;  3EG5 B;  1P3B D;  4H9R B;  3LZ0 B;  3NQU B;  3MGS C;  1P3I D;  1P3P B;  2Y2I A;  3AV2 B;  3B0B A;  4R8P D;  1KX4 D;  3A6N D;  4YS3 B;  3REL C;  5B31 G;  5E5A B;  4WU9 D;  1KX4 C;  3AV1 B;  1P3L C;  1ZLA C;  3X1U D;  5JA4 B;  5GSU A;  1M19 D;  3LEL D;  3AZH D;  1M18 A;  3WAA B;  4LD9 B;  4CSR A;  1M1A D;  1M1A A;  4LD9 A;  3X1S B;  3WKJ A;  1P3F D;  3AZK A;  3KUY D;  1KX5 C;  5C3I B;  3AZG A;  5CPJ B;  5B32 B;  5AVC A;  5AVB A;  3REI B;  5AV9 B;  3WAA C;  4WU9 A;  3B6F B;  1P34 B;  3C1B C;  2CWE A;  3AYW C;  5GT0 B;  1S32 C;  1P34 A;  4HGA C;  3W97 B;  3W99 B;  3H0M C;  4JJN C;  3X1S C;  3NQJ A;  3AYW D;  5CHL B;  3MGR C;  1P3F A;  5BNX B;  4H9S A;  4H9Q A;  5E5A D;  3REK A;  4J8W C;  2RVQ D;  5E5A C;  3MGS D;  4J8V D;  3LEL B;  3AZH B;  4XUJ D;  3AZJ A;  5CPK B;  1P3I C;  4LD9 D;  4CSR B;  5AY8 D;  5AY8 A;  5B2J B;  1N1J A;  1P3G D;  4KUD B;  5CPJ D;  2F8N H;  4QLC B;  1HQ3 D;  5BT1 D;  3MVD B;  1M19 A;  3W99 D;  3KUY C;  2ZY5 A;  1P3M B;  1W2E A;  5AV8 D;  1U35 B;  5AV8 A;  3W99 C;  2W8S A;  1P3A D;  1P3G A;  5B1L A;  5AV5 B;  3A6N B;  4UUZ B;  3WKJ C;  4XUJ A;  3LJA D;  3W99 A;  5CPK D;  4WU8 B;  3WKJ D;  1TAF A;  3WTP C;  3B6G C;  3O62 C;  3LEL A;  3AZH A;  3MGR A;  3W96 A;  1AOI D;  4NE5 A;  3B6F C;  1AOI C;  4Z66 C;  5AVC D;  5B2J A;  2ARO D;  5AVB D;  4ZBJ B;  3AZJ D;  1KX5 A;  3B6F D;  2Y2N A;  5AV6 C;  3UTB D;  3UTB A;  5E5A A;  3REK D;  1KX3 C;  5AV5 D;  5B32 A;  5BNX A;  3WA9 C;  1T3U A;  2ARO A;  5AV5 C;  5GSU C;  4KHA A;  2VQR A;  3X1S A;  3WKJ B;  1U35 C;  3AZM B;  3W96 D;  2G5I C;  5CPI B;  3AZK D;  5BS7 A;  3REH D;  3KXB A;  4DRA A;  4QLC D;  3TU4 A;  4YS3 A;  5B31 B;  3REL B;  5G49 B;  3AZF C;  2FJ7 D;  3MNN D;  3AV2 C;  3EPK A;  1P3M C;  4R8P C;  4YS3 C;  1P3A A;  3MGP C;  3AV1 A;  3VH5 T;  4YM6 B;  1KX4 A;  3A1I A;  2BYM B;  3LZ1 D;  5B33 B;  5B2I A;  3LEL C;  3AZH C;  5AV8 C;  5GXQ C;  1P3F C;  3X1T D;  3KFU G;  5BNV B;  5BT1 C;  2IO5 C;  2RIQ A;  5B2I C;  1KU5 A;  3KWQ D;  4J8U B;  5B2I D;  1AOI B;  3C1B B;  4J8V A;  3B0D C;  1S32 B;  3W98 C;  3C1C A;  5B0Z A;  1N1J B;  5B0Z D;  3MNN B;  3UT9 A;  3UT9 D;  1TZY C;  3W96 C;  3AZJ B;  5CP6 A;  3AZK C;  4WZS B;  3MGQ A;  3UTA A;  5G49 A;  2Y2K A;  3KWQ A;  3REK B;  5AV9 C;  3LZ1 B;  2HIO A;  4YM6 C;  2CV5 C;  5B33 D;  3KXB D;  3TU4 D;  1M1A C;  2FFF B;  2YFW B;  4DRB A;  4H9O A;  3MNN C;  3AV2 D;  4R8P B;  5FUG A;  5B33 C;  2Y2H A;  3UTB C;  1P3G C;  3AZM D;  3AZM A;  3AV1 C;  3REH A;  2LY8 A;  1P3O D;  5B2I B;  5B0Y B;  4X23 B;  2NQB A;  3MVD C;  2NQB D;  1P3O C;  3VH6 T;  3X1V B;  1P3F B;  1EQZ D;  3KUY B;  5JRG B;  5CPI A;  1ULY A;  5B40 B;  1P3O A;  4KHA B;  3VH5 A;  1P3K C;  5JRG A;  3AZF D;  2HIO B;  4XUJ C;  3KXB B;  3REH C;  4H9P B;  3X1V C;  3LJA C;  5AY8 C;  4JJN B;  3TU4 B;  3AYW B;  3F6T A;  3MGR B;  4G91 B;  5JRG C;  4DQY B;  1EQZ A;  1KX3 A;  3FDD A;  3X1T B;  4AWL B;  3MGQ D;  3UTA D;  2YFW A;  1TZY A;  2NQB B;  4WV4 B;  2F2A C;  4J8U A;  4J8U D;  2JCH A;  2BYK B;  1P3G B;  3WTP B;  5BO0 B;  3B6G B;  1P3M A;  5AV6 D;  3AZE A;  1KX5 D;  4Z5T B;  3X1T C;  1P3B C;  3C1C B;  5B33 A;  3MVD D;  2NQB C;  3W98 D;  2DQN C;  5AV5 A;  1JFI A;  1EQZ C;  4J8X A;  3REJ D;  2F8N D;  5AV8 B;  1U35 D;  1P3A B;  2Y2G A;  3A6N C;  3AN2 D;  5DNN B;  2PYO B;  1P3K D;  3MNN A;  5B1L C;  3LJA B;  4QLC C;  2XD1 A;  2DF4 C;  5GT3 C;  5AVB C;  3O62 B;  4X23 D;  4H9Q B;  4J8V C;  3WTP E;  2Y2O A;  1BH9 B;  5GT3 A;  3V9R A; 
#chains in the Genus database with same CATH homology
 3MVD A;  4WU9 B;  1M18 C;  3AV1 D;  2ARO B;  1H3O B;  5AVB B;  3AZF B;  3REJ B;  2HIO D;  2F8N B;  4JJN D;  3UTB B;  4M6B A;  3AFA D;  2L5A A;  1BH8 B;  3AN2 B;  1P3K A;  3KWQ C;  1ID3 C;  3WA9 B;  1P3A C;  3AZN A;  3AZN D;  3REI A;  3AYW A;  3REL A;  3P5J B;  5GT0 C;  4JJN A;  3IP4 C;  4H9P A;  5B0Z C;  3W96 B;  4Z66 A;  4WNN B;  2CV5 B;  3W97 D;  3AZK B;  5F99 C;  2NZD B;  5CPJ C;  1TAF B;  5AV6 B;  1KX5 B;  3REL D;  4XZQ C;  5KDM B;  4J8U C;  5FUG B;  5AV9 D;  3KXB C;  3TU4 C;  4Z66 D;  3MGS B;  5GXQ A;  3W98 B;  5GXQ D;  4ZUX A;  2ARO C;  4G91 C;  5B1M B;  4KUD D;  3NQU A;  3AZN B;  5DNN D;  1BH9 A;  5DNN A;  1BH8 A;  3AN2 A;  2UWX A;  1P3K B;  4J8V B;  3UT9 C;  2HIO C;  1HQ3 B;  4XUJ B;  1AOI A;  5DNM A;  4J8X B;  5DNM D;  3O62 D;  5B40 C;  1B6W A;  3AZF A;  3KWQ B;  5B1M C;  4XZQ A;  1Z2C B;  3AV2 A;  1BFM A;  3AZE C;  4G92 B;  5CP6 B;  3V9R B;  2RVQ C;  3UT9 B;  4XZQ B;  4ZUX B;  2NZD C;  3AZM C;  3AZI D;  1P3M D;  1U35 A;  3REK C;  5KDM A;  3VH5 W;  4J8W B;  3WA9 D;  3MGQ C;  3UTA C;  3AZL D;  2YFV A;  5BO0 A;  5AV9 A;  4ZBJ C;  1P3B B;  4WU8 D;  5AVC B;  2ZM5 A;  5CPJ A;  5DNM B;  2BYM A;  3W98 A;  1P3P D;  4EO5 B;  3NQJ B;  5B0Y D;  4E45 A;  3W97 A;  5GT0 A;  3X1V D;  1EQZ B;  1F66 B;  5B24 C;  5B40 D;  5DNM C;  3AZI A;  5B31 A;  4Z66 B;  5GXQ B;  3AZI B;  4KGC D;  4H9S C;  1F1E A;  3AN2 C;  2FJ7 A;  2ZY3 A;  1P3P A;  3REH B;  5AV6 A;  4CAY B;  1P3I A;  3X1T A;  5GT3 B;  5C3I C;  1A7W A;  2Y2L A;  4R8P A;  3REI D;  2FJ7 B;  4WNN A;  3MGP A;  4AWL C;  4X23 A;  4J8X D;  3REJ A;  5CPI C;  2F8N G;  2ZY4 A;  1P3B A;  1H3O A;  5CP6 C;  2YFV B;  1M18 D;  1KX3 D;  3VH6 W;  1HTA A;  5CP6 D;  3REJ C;  1F66 D;  5B40 A;  5CPK C;  4UUZ A;  2F8N A;  3A6N A;  1JFI B;  1P3P C;  4H9N A;  3H0L C;  4NFT A;  4ZUX D;  3LZ0 C;  3C1C D;  3AZN C;  3B0C T;  5GT3 D;  3AZE D;  4J8W D;  1ZLA A;  4J8W A;  1ZLA D;  5B24 D;  4WU8 A;  3AZL B;  1M19 C;  1S32 A;  3H0R C;  3AZI C;  1P34 C;  4H9O B;  4HGA B;  3W97 C;  2PYO C;  4EO5 C;  1TZY B;  4NE3 A;  5F99 D;  3LZ1 A;  4KUD A;  2ZY2 A;  1R4V A;  4Z5T A;  5BNV A;  3LZ1 C;  3REI C;  5GSU D;  3EPJ A;  5B1M A;  4WJ3 C;  1B67 A;  5B0Z B;  3AZL C;  3WTP A;  3B6G A;  3KSY A;  3B0C W;  1ID3 A;  4H9N B;  1ID3 D;  4WU8 C;  1WWI A;  3MGP B;  5B32 C;  4KGC B;  4E44 A;  1P3O B;  5B24 A;  3R45 B;  1P3L A;  3AZE B;  1ZLA B;  5B0Y C;  4CAY A;  2NZD A;  5CPK A;  2FJ7 C;  2F8N K;  2HUE B;  3AFA B;  4Z2M H;  3KUY A;  5JRG D;  2CV5 A;  5F99 A;  4ZUX C;  1TZY D;  2IO5 B;  2Y2Q A;  4UPK A;  3MGS A;  3AZG C;  3EPH A;  2Y2J A;  3AFA A;  4KGC C;  1F66 A;  1P3I B;  4WU9 C;  1M18 B;  1KX3 B;  3WAA A;  5JA4 A;  1HQ3 C;  5GSU B;  2CV5 D;  1P3L D;  4X23 C;  3B6F A;  3X1U C;  2NZD D;  2Y2M A;  3AZJ C;  3AZG B;  5DNN C;  5B0Y A;  3EPL A;  5CPI D;  5B31 C;  1M1A B;  3WA9 A;  3X1S D;  4H9R A;  3A1K A;  3LZ0 A;  5B24 B;  5B31 D;  5B1M D;  2JE5 A;  3MGR D;  1F66 C;  3X1V A;  3WTP D;  3B6G D;  3C1B A;  2HUE C;  3AFA C;  4KGC A;  2BG1 A;  4Z5T C;  5B32 D;  2G5H C;  5F99 B;  5B1L D;  4Z5T D;  3MGQ B;  3UTA B;  5BS7 C;  4YM6 D;  3B0D B;  3LZ0 D;  3C1C C;  1P34 D;  2PYO A;  5GT0 D;  1PZR A;  1WWS A;  2XD5 A;  3R45 A;  4NE6 A;  5AVC C;  1P3L B;  2J8P A;  4LD9 C;  5B32 G;  3AL0 C;  3AZG D;  1KX4 B;  1ID3 B;  4QLC A;  4YS3 D;  2JSS A;  3O62 A;  2Y2P A;  4G92 C;  4YM6 A;  3MGP D;  2PYO D;  3VH6 A;  4XZQ D;  3LJA A;  3AZL A;  3X1U B;  5AY8 B;  1M19 B;  3WAA D;  5B2J D;  3X1U A;  3C1B D;  4Z2M G;  1S32 D;  2BYK A;  5B2J C;  4J8X C;  1Q9C A;  4KUD C;  1HQ3 A;  5B1L B;  3EG5 B;  1P3B D;  4H9R B;  3LZ0 B;  3NQU B;  3MGS C;  1P3I D;  1P3P B;  2Y2I A;  3AV2 B;  3B0B A;  4R8P D;  1KX4 D;  3A6N D;  4YS3 B;  3REL C;  5B31 G;  5E5A B;  4WU9 D;  1KX4 C;  3AV1 B;  1P3L C;  1ZLA C;  3X1U D;  5JA4 B;  5GSU A;  1M19 D;  3LEL D;  3AZH D;  1M18 A;  3WAA B;  4LD9 B;  4CSR A;  1M1A D;  1M1A A;  4LD9 A;  3X1S B;  3WKJ A;  1P3F D;  3AZK A;  3KUY D;  1KX5 C;  5C3I B;  3AZG A;  5CPJ B;  5B32 B;  5AVC A;  5AVB A;  3REI B;  5AV9 B;  3WAA C;  4WU9 A;  3B6F B;  1P34 B;  3C1B C;  2CWE A;  3AYW C;  5GT0 B;  1S32 C;  1P34 A;  4HGA C;  3W97 B;  3W99 B;  3H0M C;  4JJN C;  3X1S C;  3NQJ A;  3AYW D;  5CHL B;  3MGR C;  1P3F A;  5BNX B;  4H9S A;  4H9Q A;  5E5A D;  3REK A;  4J8W C;  2RVQ D;  5E5A C;  3MGS D;  4J8V D;  3LEL B;  3AZH B;  4XUJ D;  3AZJ A;  5CPK B;  1P3I C;  4LD9 D;  4CSR B;  5AY8 D;  5AY8 A;  5B2J B;  1N1J A;  1P3G D;  4KUD B;  5CPJ D;  2F8N H;  4QLC B;  1HQ3 D;  5BT1 D;  3MVD B;  1M19 A;  3W99 D;  3KUY C;  2ZY5 A;  1P3M B;  1W2E A;  5AV8 D;  1U35 B;  5AV8 A;  3W99 C;  2W8S A;  1P3A D;  1P3G A;  5B1L A;  5AV5 B;  3A6N B;  4UUZ B;  3WKJ C;  4XUJ A;  3LJA D;  3W99 A;  5CPK D;  4WU8 B;  3WKJ D;  1TAF A;  3WTP C;  3B6G C;  3O62 C;  3LEL A;  3AZH A;  3MGR A;  3W96 A;  1AOI D;  4NE5 A;  3B6F C;  1AOI C;  4Z66 C;  5AVC D;  5B2J A;  2ARO D;  5AVB D;  4ZBJ B;  3AZJ D;  1KX5 A;  3B6F D;  2Y2N A;  5AV6 C;  3UTB D;  3UTB A;  5E5A A;  3REK D;  1KX3 C;  5AV5 D;  5B32 A;  5BNX A;  3WA9 C;  1T3U A;  2ARO A;  5AV5 C;  5GSU C;  4KHA A;  2VQR A;  3X1S A;  3WKJ B;  1U35 C;  3AZM B;  3W96 D;  2G5I C;  5CPI B;  3AZK D;  5BS7 A;  3REH D;  3KXB A;  4DRA A;  4QLC D;  3TU4 A;  4YS3 A;  5B31 B;  3REL B;  5G49 B;  3AZF C;  2FJ7 D;  3MNN D;  3AV2 C;  3EPK A;  1P3M C;  4R8P C;  4YS3 C;  1P3A A;  3MGP C;  3AV1 A;  3VH5 T;  4YM6 B;  1KX4 A;  3A1I A;  2BYM B;  3LZ1 D;  5B33 B;  5B2I A;  3LEL C;  3AZH C;  5AV8 C;  5GXQ C;  1P3F C;  3X1T D;  3KFU G;  5BNV B;  5BT1 C;  2IO5 C;  2RIQ A;  5B2I C;  1KU5 A;  3KWQ D;  4J8U B;  5B2I D;  1AOI B;  3C1B B;  4J8V A;  3B0D C;  1S32 B;  3W98 C;  3C1C A;  5B0Z A;  1N1J B;  5B0Z D;  3MNN B;  3UT9 A;  3UT9 D;  1TZY C;  3W96 C;  3AZJ B;  5CP6 A;  3AZK C;  4WZS B;  3MGQ A;  3UTA A;  5G49 A;  2Y2K A;  3KWQ A;  3REK B;  5AV9 C;  3LZ1 B;  2HIO A;  4YM6 C;  2CV5 C;  5B33 D;  3KXB D;  3TU4 D;  1M1A C;  2FFF B;  2YFW B;  4DRB A;  4H9O A;  3MNN C;  3AV2 D;  4R8P B;  5FUG A;  5B33 C;  2Y2H A;  3UTB C;  1P3G C;  3AZM D;  3AZM A;  3AV1 C;  3REH A;  2LY8 A;  1P3O D;  5B2I B;  5B0Y B;  4X23 B;  2NQB A;  3MVD C;  2NQB D;  1P3O C;  3VH6 T;  3X1V B;  1P3F B;  1EQZ D;  3KUY B;  5JRG B;  5CPI A;  1ULY A;  5B40 B;  1P3O A;  4KHA B;  3VH5 A;  1P3K C;  5JRG A;  3AZF D;  2HIO B;  4XUJ C;  3KXB B;  3REH C;  4H9P B;  3X1V C;  3LJA C;  5AY8 C;  4JJN B;  3TU4 B;  3AYW B;  3F6T A;  3MGR B;  4G91 B;  5JRG C;  4DQY B;  1EQZ A;  1KX3 A;  3FDD A;  3X1T B;  4AWL B;  3MGQ D;  3UTA D;  2YFW A;  1TZY A;  2NQB B;  4WV4 B;  2F2A C;  4J8U A;  4J8U D;  2JCH A;  2BYK B;  1P3G B;  3WTP B;  5BO0 B;  3B6G B;  1P3M A;  5AV6 D;  3AZE A;  1KX5 D;  4Z5T B;  3X1T C;  1P3B C;  3C1C B;  5B33 A;  3MVD D;  2NQB C;  3W98 D;  2DQN C;  5AV5 A;  1JFI A;  1EQZ C;  4J8X A;  3REJ D;  2F8N D;  5AV8 B;  1U35 D;  1P3A B;  2Y2G A;  3A6N C;  3AN2 D;  5DNN B;  2PYO B;  1P3K D;  3MNN A;  5B1L C;  3LJA B;  4QLC C;  2XD1 A;  2DF4 C;  5GT3 C;  5AVB C;  3O62 B;  4X23 D;  4H9Q B;  4J8V C;  3WTP E;  2Y2O A;  1BH9 B;  5GT3 A;  3V9R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...