1P3KD

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
92
structure length
92
Chain Sequence
KESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein/dna
molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 92
sequence length 92
chains with identical sequence H
ec nomenclature
pdb deposition date 2003-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3kD00
3REHD 4HGAC 1P3GD 4EO5B 3KWQD 3AZMA 5GXQA 4G92B 5JA4B 3RELB 4JJNA 4Z5TC 3REKC 3AZMD 5GXQD 4JJND 3KUYA 3AZHA 3AV2A 3X1TB 1N1JB 5JRGB 3WA9C 3KUYD 3KXBA 3AZHD 4ZUXA 3LJAA 3AV2D 3B6FC 5AV8A 5AY8B 4Z2MH 4R8PB 5CP6C 3KXBD 5AVBA 1KX3B 4ZUXD 3LJAD 3UTBB 5C3IB 5AV8D 5AVBD 5B2JA 1EQZB 1P3KA 3X1SC 5B2JD 3AZFB 5AV9B 5CPIA 1B67A 1P3KD 3MGRB 5E5AC 3W96A 5CPKB 5CPID 3AN2C 3UT9A 3W96D 4HGAB 4H9RB 4YM6C 3AZNA 2RVQD 1P3MA 4Z5TB 4XUJA 3VH6W 3REKB 5AVCC 3C1CA 5AV6A 3AZND 1P3MD 1TAFA 4UUZA 4H9OA 3AZEC 4XUJD 4YS3A 3C1CD 5AV6D 3WA9B 1JFIB 4LD9C 3AYWC 3B6FB 4YS3D 3REIA 5CPJA 3REJA 5CP6B 4WU8A 1P3IA 3REID 5CPJD 2FJ7C 3REJD 4WU8D 4KGCC 2L5AA 4QLCC 4H9NB 5GSUA 1P3ID 3R45A 5GSUD 3NQUB 4X23A 2BYKB 5BNXB 3AZJA 5B0YA 5E5AB 2PYOA 4X23D 5DNNC 3AN2B 5DNMA 3AZJD 5B0YD 3MGSC 2PYOD 3B6GC 3W97A 1HQ3A 5DNMD 4YM6B 1HQ3D 3AZKA 5AVCB 4WZSB 3AZEB 3NQJB 3LELC 2NQBA 3AZKD 3W98C 4LD9B 4NE6A 3AYWB 3WKJC 2NQBD 3B0CT 4G91C 1P3AA 5B40C 5B24C 1P3AD 1P3PC 1BH8A 4ZBJC 2YFWA 2FJ7B 4KGCB 1H3OB 4QLCB 3A6NA 5GT0A 3O62A 1P3GC 3A6ND 3LZ1A 4J8WC 3UTAD 5GT0D 3O62D 1WWIA 3LZ1D 4JJNC 1ZLAC 4CAYB 5DNNB 3X1UC 3WAAA 2HIOA 3MGSB 1S32A 5B32C 3B6GB 5B33A 3WAAD 2HIOD 3MNNA 1S32D 5B33D 3LJAC 5AV8C 3MNND 3AFAA 1KX4C 5AVBC 3LELB 3W98B 2YFVB 3WKJB 3AFAD 5C3IC 5BO0B 2AROC 4G91B 5B40B 1P3BA 5B24B 1P3PB 4ZBJB 1P3BD 5CPIC 5B0ZC 3AZLA 5BS7A 1P3GB 4J8WB 3AZLD 5F99A 4J8UA 4H9PB 1P34A 5F99D 1M18A 4JJNB 1ZLAB 4XUJC 3X1UB 4J8UD 1P34D 3LZ0C 5B32B 1M18D 5AV5A 5B31G 1AOIA 4WNNA 2BYMB 4Z66C 3LJAB 5AV8B 5AV5D 3MVDA 1AOID 4CSRB 1KX4B 5AVBB 3MVDD 4J8XA 2AROB 1F66C 4KHAB 1M1AA 3B0CW 5G49A 1BH9A 4J8XD 1M1AD 5CPIB 5B0ZB 4X23C 3RELA 3VH5W 5BT1D 3RELD 1HQ3C 5CHLB 5FUGB 3X1TA 1N1JA 3AZNB 1P3MB 4XUJB 5BNVB 4WU9C 2F8NG 5B2IC 3UT9D 1BFMA 3X1TD 5B1MC 3LZ0B 1TZYC 4R8PA 4UUZB 5KDMA 5B31A 1KX3A 2NZDC 2NQBC 3UTBA 5B1LA 4R8PD 4Z66B 3X1VA 1KX3D 5B31D 1U35A 1M19C 5B1LD 1EQZA 3X1VD 1U35D 3V9RB 1P3IB 3AZFA 5AV9A 1EQZD 1F1EA 1F66B 3MGRA 3UTAC 3AZGC 5AV9D 3AZFD 3O62C 3MGRD 1P3FC 4X23B 4H9RA 3TU4A 3AZIA 3REKA 3WAAC 3TU4D 5GT3A 3AZID 1HQ3B 3C1BA 3REKD 5B33C 2F8NA 3WA9A 5GT3D 3C1BD 4WU9B 5B2IB 2F8ND 5B1MB 2F8NH 1TZYB 3W97D 3WA9D 5CP6A 3AFAC 2NZDB 2NQBB 5CP6D 1M19B 1ID3C 4H9NA 4KUDC 3X1SA 3B0BA 5BNXA 4H9QB 1P3OC 5E5AA 3X1SD 3UTAB 3AZLC 3AZGB 5BS7C 3O62B 3AN2A 3REHC 5E5AD 1P3FB 1P3LA 3KWQC 3AN2D 4YM6A 1P3LD 3AZMC 5GXQC 5AVCA 3WAAB 3AZEA 3NQJA 5B33B 1Q9CA 5AVCD 5AV5C 3KUYC 1AOIC 3AYWA 3AZHC 3AZED 3AV2C 4LD9A 4LD9D 3KXBC 3AYWD 4ZUXC 3AFAB 4NE3A 2FJ7A 4KGCA 1H3OA 4QLCA 1ID3B 2FJ7D 4KUDB 4H9SA 4KGCD 5B2JC 3VH6A 1P3KC 1P3OB 5BT1C 3AZLB 3W99A 3VH6T 4CAYA 5DNNA 3KSYA 3REHB 3W96C 3W99D 3B6GA 3KWQB 5DNND 5B32G 2RVQC 3UT9C 3B6GD 3AZMB 5GXQB 3AZNC 1P3MC 3WTPA 3AV1A 5B31C 3C1CC 5AV6C 3MGQA 3W98A 5B1LC 3WTPD 5AV5B 3KUYB 1AOIB 4WNNB 3AZHB 3AV2B 3AV1D 3WKJA 5BO0A 4YS3C 1U35C 3MGQD 3W98D 5B40A 3KXBB 4ZUXB 5B24A 3WKJD 3REIC 5CPJC 1P3PA 4J8VA 5B40D 3REJC 4WU8C 4XZQA 5B24D 1P3IC 1P3PD 4J8VD 4XZQD 2CV5A 1KX5A 5G49B 3MGPA 5GSUC 5B2JB 4J8WA 2CV5D 1P3KB 4AWLC 1KX5D 3MGPD 4J8WD 4H9PA 3TU4C 1ZLAA 3AZIC 3AZJC 5B0YC 3X1UA 5JA4A 2PYOC 3W96B 5B32A 5GT3C 5DNMC 1ZLAD 3X1UD 3C1BC 3UT9B 5B32D 2BYMA 3W97C 5JRGA 4CSRA 3AZKC 1KX4A 5KDMB 5B31B 3C1CB 5AV6B 5AY8A 5JRGD 5B1LB 1TAFB 4H9OB 3X1VB 4YS3B 2AROA 1KX4D 4KHAA 5AY8D 1U35B 3UTBD 1P3AC 2AROD 3REIB 5CPJB 3REJB 4WU8B 5B0ZA 5B0ZD 3A6NC 5GSUB 5CPKA 5GT0C 1P3LC 3B0DC 3R45B 4AWLB 3LZ1C 5FUGA 4M6BA 2F8NK 3TU4B 5CPKD 3AZIB 3AZJB 5BNVA 5B0YB 2PYOB 3LZ0A 4Z5TA 5GT3B 4E45A 5DNMB 2HIOC 1S32C 3C1BB 3LZ0D 2F8NB 4Z5TD 3W97B 4Z66A 3MNNC 1JFIA 3B6FA 4Z66D 3AZKB 3V9RA 2CWEA 3B6FD 1F66A 1WWSA 4E44A 2HUEC 4H9SC 1P3AB 1F66D 1P3BC 3X1SB 1BH8B 2YFWB 3NQUA 1ULYA 2BYKA 3W99C 3A6NB 3WTPE 5GT0B 2IO5C 1P3LB 3B0DB 3LZ1B 4NFTA 5F99C 2JSSA 4J8UC 4WU9A 1P34C 5B2IA 1M18C 5B1MA 3WTPC 1TZYA 3AV1C 2NZDA 2HIOB 4YM6D 4WU9D 1S32B 5B2ID 3MGQC 5B1MD 1TZYD 2NZDD 1M19A 3MNNB 4WV4B 1M19D 3VH5A 3MVDC 4J8VC 2LY8A 1R4VA 4XZQC 4H9QA 3UTAA 3VH5T 3AZGA 4J8XC 2CV5C 1KX5C 2HUEB 1M1AC 3MGPC 1P3BB 1P3FA 3AZGD 4QLCD 1P3FD 3W99B 4DRBA 4EO5C 4G92C 3RELC 2IO5B 3MGSA 5F99B 1B6WA 4NE5A 4J8UB 3MGSD 3X1TC 5JRGC 1P34B 1M18B 3WTPB 4Z2MG 3AV1B 4DRAA 5AY8C 3MGQB 4R8PC 1KX3C 3LELA 1HTAA 3UTBC 1KU5A 2YFVA 1ID3A 1A7WA 3X1VC 3LELD 4KUDA 3MVDB 1ID3D 4J8VB 1EQZC 4XZQB 4KUDD 1P3OA 3AZFC 5AV9C 4J8XB 2CV5B 1KX5B 3MGRC 1M1AB 3MGPB 3REHA 1P3OD 5CPKC 1P3GA 1BH9B 3KWQA
chains in the Genus database with same CATH superfamily
3REHD 4HGAC 1P3GD 4EO5B 3KWQD 3AZMA 5GXQA 4G92B 5JA4B 3RELB 4JJNA 4Z5TC 3REKC 3AZMD 5GXQD 4JJND 3KUYA 3AZHA 3AV2A 3X1TB 1N1JB 5JRGB 3WA9C 3KUYD 3KXBA 3AZHD 4ZUXA 3LJAA 3AV2D 3B6FC 5AV8A 5AY8B 4Z2MH 4R8PB 5CP6C 3KXBD 5AVBA 1KX3B 4ZUXD 3LJAD 3UTBB 5C3IB 5AV8D 5AVBD 5B2JA 1EQZB 2G5HC 1P3KA 3X1SC 5B2JD 3EPJA 2FFFB 5AV9B 3AZFB 5CPIA 1B67A 1P3KD 3MGRB 5E5AC 3W96A 5CPKB 5CPID 3AN2C 3UT9A 3W96D 4HGAB 4H9RB 4YM6C 3AZNA 2RVQD 1P3MA 4Z5TB 4XUJA 3VH6W 3REKB 5AVCC 3C1CA 5AV6A 3AZND 1P3MD 1TAFA 4UUZA 4H9OA 3AZEC 2DF4C 2ZY4A 4XUJD 4YS3A 3C1CD 5AV6D 3WA9B 1JFIB 4LD9C 3AYWC 3B6FB 4YS3D 3REIA 5CPJA 3REJA 3IP4C 5CP6B 4WU8A 1P3IA 3REID 5CPJD 2FJ7C 2BG1A 3REJD 4WU8D 4KGCC 2L5AA 4QLCC 4H9NB 5GSUA 1P3ID 3R45A 5GSUD 3NQUB 4X23A 2BYKB 5BNXB 3AZJA 5B0YA 5E5AB 2PYOA 2W8SA 4X23D 5DNNC 3AN2B 5DNMA 3AZJD 5B0YD 3A1KA 3MGSC 2PYOD 3B6GC 3W97A 1HQ3A 5DNMD 4YM6B 2Y2IA 1HQ3D 3AZKA 5AVCB 4WZSB 3AZEB 3NQJB 3LELC 2NQBA 3AZKD 3W98C 4LD9B 4NE6A 3AYWB 3WKJC 2NQBD 3B0CT 4G91C 1P3AA 5B40C 5B24C 1P3AD 1P3PC 1BH8A 4ZBJC 2YFWA 2FJ7B 4KGCB 1H3OB 4QLCB 3A6NA 2Y2NA 2Y2GA 5GT0A 3O62A 1P3GC 2RIQA 3A6ND 3LZ1A 4J8WC 3UTAD 5GT0D 3O62D 1BH9B 1WWIA 3LZ1D 4JJNC 1ZLAC 4CAYB 5DNNB 3X1UC 3WAAA 2HIOA 3MGSB 1S32A 5B32C 3B6GB 5B33A 3WAAD 2HIOD 3MNNA 1S32D 5B33D 3LJAC 5AV8C 3MNND 3AFAA 1KX4C 5AVBC 3LELB 3W98B 2YFVB 3WKJB 3AFAD 5C3IC 5BO0B 2AROC 4G91B 5B40B 1P3BA 5B24B 4UPKA 1P3PB 4ZBJB 1P3BD 3AL0C 5CPIC 5B0ZC 3AZLA 5BS7A 1P3GB 4J8WB 3AZLD 5F99A 2Y2QA 4J8UA 4H9PB 1P34A 5F99D 1M18A 4JJNB 1ZLAB 4XUJC 3X1UB 2F2AC 4J8UD 1W2EA 1P34D 3LZ0C 5B32B 1M18D 5AV5A 5B31G 1AOIA 4WNNA 2BYMB 4Z66C 3LJAB 5AV8B 3FDDA 5AV5D 3MVDA 2Y2JA 1AOID 4CSRB 1KX4B 5AVBB 2VQRA 3MVDD 4J8XA 2AROB 1F66C 4KHAB 1M1AA 3B0CW 5G49A 1T3UA 1BH9A 3A1IA 4J8XD 1M1AD 5CPIB 5B0ZB 4X23C 3RELA 3VH5W 2XD5A 2ZM5A 5BT1D 3RELD 1HQ3C 5CHLB 5FUGB 3X1TA 1N1JA 3AZNB 1P3MB 4XUJB 5BNVB 4WU9C 2F8NG 5B2IC 3UT9D 1BFMA 3X1TD 5B1MC 3LZ0B 1TZYC 4R8PA 4UUZB 5KDMA 5B31A 1KX3A 2NZDC 2NQBC 3UTBA 5B1LA 2UWXA 4R8PD 4Z66B 3X1VA 1KX3D 5B31D 1U35A 1M19C 3KFUG 5B1LD 2Y2HA 1EQZA 3X1VD 1U35D 3V9RB 1P3IB 3AZFA 5AV9A 1EQZD 1F1EA 1F66B 3MGRA 3UTAC 3AZGC 5AV9D 3AZFD 3O62C 3MGRD 1P3FC 4X23B 4H9RA 3TU4A 3P5JB 3EPKA 3AZIA 3REKA 3WAAC 3TU4D 5GT3A 3AZID 1HQ3B 3C1BA 3REKD 5B33C 1Z2CB 2F8NA 3WA9A 5GT3D 3C1BD 4WU9B 5B2IB 2F8ND 5B1MB 2F8NH 1TZYB 3W97D 1PZRA 5CP6A 3WA9D 3AFAC 2NZDB 2NQBB 5CP6D 1M19B 1ID3C 4H9NA 4KUDC 3X1SA 3B0BA 5BNXA 4H9QB 1P3OC 5E5AA 3X1SD 3UTAB 3AZLC 3AZGB 5BS7C 3O62B 3AN2A 3REHC 5E5AD 1P3FB 1P3LA 3KWQC 3AN2D 4YM6A 1P3LD 3AZMC 5GXQC 5AVCA 3WAAB 3AZEA 3NQJA 3H0LC 5B33B 1Q9CA 5AVCD 5AV5C 3KUYC 1AOIC 3AYWA 3AZHC 3AZED 3AV2C 4LD9A 4LD9D 3KXBC 3AYWD 4ZUXC 3AFAB 4NE3A 2FJ7A 4WJ3C 4KGCA 1H3OA 4QLCA 1ID3B 2FJ7D 2J8PA 4KUDB 4H9SA 4KGCD 5B2JC 4DQYB 3VH6A 1P3KC 1P3OB 5BT1C 3AZLB 3W99A 3VH6T 4CAYA 5DNNA 3KSYA 3REHB 3W96C 3W99D 3B6GA 3KWQB 5DNND 5B32G 2RVQC 3UT9C 3B6GD 3AZMB 5GXQB 3AZNC 1P3MC 3WTPA 3AV1A 5B31C 3C1CC 5AV6C 3MGQA 3W98A 5B1LC 3WTPD 3EG5B 5AV5B 3KUYB 4WNNB 3AZHB 3AV2B 3AV1D 1AOIB 5BO0A 4YS3C 3EPLA 2Y2LA 1U35C 3MGQD 3WKJA 3W98D 2Y2OA 5B40A 3KXBB 4ZUXB 5B24A 3WKJD 3REIC 5CPJC 1P3PA 4J8VA 5B40D 3REJC 4WU8C 4XZQA 5B24D 1P3IC 1P3PD 4J8VD 4XZQD 2CV5A 1KX5A 5G49B 3MGPA 5GSUC 5B2JB 4J8WA 2JCHA 2CV5D 4AWLC 1P3KB 1KX5D 3MGPD 4J8WD 4H9PA 3TU4C 1ZLAA 3AZIC 3AZJC 5B0YC 3X1UA 5JA4A 2PYOC 3EPHA 3W96B 5B32A 5GT3C 5DNMC 1ZLAD 3X1UD 3C1BC 2DQNC 3UT9B 5B32D 2BYMA 2ZY5A 3W97C 5JRGA 4CSRA 3AZKC 1KX4A 5KDMB 5B31B 3C1CB 5AV6B 5AY8A 5JRGD 5B1LB 1TAFB 2ZY2A 4H9OB 2G5IC 3X1VB 4YS3B 2AROA 1KX4D 4KHAA 5AY8D 1U35B 3H0RC 3UTBD 1P3AC 2AROD 3REIB 5CPJB 3REJB 2XD1A 4WU8B 5B0ZA 5B0ZD 3A6NC 5GSUB 5CPKA 5GT0C 1P3LC 3B0DC 3R45B 4AWLB 3LZ1C 5FUGA 4M6BA 2F8NK 3TU4B 5CPKD 3AZIB 3AZJB 5BNVA 5B0YB 2PYOB 3LZ0A 4Z5TA 5GT3B 4E45A 5DNMB 2HIOC 1S32C 3C1BB 3LZ0D 2F8NB 4Z5TD 3W97B 4Z66A 3MNNC 1JFIA 3B6FA 4Z66D 3AZKB 3V9RA 3F6TA 2CWEA 3B6FD 1F66A 1WWSA 4E44A 2HUEC 4H9SC 1P3AB 1F66D 1P3BC 3X1SB 1BH8B 2YFWB 3NQUA 1ULYA 2BYKA 3W99C 3A6NB 5GT0B 3WTPE 2IO5C 1P3LB 3B0DB 3LZ1B 4NFTA 5F99C 2JSSA 4J8UC 4WU9A 1P34C 5B2IA 3H0MC 5B1MA 3WTPC 1TZYA 1M18C 3AV1C 2NZDA 2HIOB 4YM6D 4WU9D 1S32B 5B2ID 3MGQC 5B1MD 1TZYD 2NZDD 1M19A 3MNNB 4WV4B 1M19D 3VH5A 3MVDC 4J8VC 2LY8A 1R4VA 4XZQC 2JE5A 4H9QA 3UTAA 3VH5T 3AZGA 4J8XC 2CV5C 1KX5C 2HUEB 2Y2KA 1M1AC 3MGPC 1P3BB 1P3FA 3AZGD 4QLCD 1P3FD 3W99B 4DRBA 4EO5C 2Y2PA 4G92C 3RELC 2IO5B 3MGSA 5F99B 1B6WA 4NE5A 4J8UB 3MGSD 3X1TC 5JRGC 1P34B 1M18B 3WTPB 4Z2MG 3AV1B 4DRAA 5AY8C 3MGQB 4R8PC 1KX3C 3LELA 2ZY3A 1HTAA 3UTBC 1KU5A 2YFVA 1ID3A 1A7WA 3X1VC 3LELD 4KUDA 3MVDB 1ID3D 4J8VB 1EQZC 4XZQB 4KUDD 1P3OA 3AZFC 5AV9C 4J8XB 2CV5B 1KX5B 3MGRC 1M1AB 3MGPB 3REHA 1P3OD 5CPKC 1P3GA 2Y2MA 3KWQA
chains in the Genus database with same CATH topology
3REHD 4HGAC 1P3GD 4EO5B 3KWQD 3AZMA 5GXQA 4G92B 5JA4B 3RELB 4JJNA 4Z5TC 3REKC 3AZMD 5GXQD 4JJND 3KUYA 3AZHA 3AV2A 3X1TB 1N1JB 5JRGB 3WA9C 3KUYD 3KXBA 3AZHD 4ZUXA 3LJAA 3AV2D 3B6FC 5AV8A 5AY8B 4Z2MH 4R8PB 5CP6C 3KXBD 5AVBA 1KX3B 4ZUXD 3LJAD 3UTBB 5C3IB 5AV8D 5AVBD 5B2JA 1EQZB 2G5HC 1P3KA 3X1SC 5B2JD 3EPJA 2FFFB 5AV9B 3AZFB 5CPIA 1B67A 1P3KD 3MGRB 5E5AC 3W96A 5CPKB 5CPID 3AN2C 3UT9A 3W96D 4HGAB 4H9RB 4YM6C 3AZNA 2RVQD 1P3MA 4Z5TB 4XUJA 3VH6W 3REKB 5AVCC 3C1CA 5AV6A 3AZND 1P3MD 1TAFA 4UUZA 4H9OA 3AZEC 2DF4C 2ZY4A 4XUJD 4YS3A 3C1CD 5AV6D 3WA9B 1JFIB 4LD9C 3AYWC 3B6FB 4YS3D 3REIA 5CPJA 3REJA 3IP4C 5CP6B 4WU8A 1P3IA 3REID 5CPJD 2FJ7C 2BG1A 3REJD 4WU8D 4KGCC 2L5AA 4QLCC 4H9NB 5GSUA 1P3ID 3R45A 5GSUD 3NQUB 4X23A 2BYKB 5BNXB 3AZJA 5B0YA 5E5AB 2PYOA 2W8SA 4X23D 5DNNC 3AN2B 5DNMA 3AZJD 5B0YD 3A1KA 3MGSC 2PYOD 3B6GC 3W97A 1HQ3A 5DNMD 4YM6B 2Y2IA 1HQ3D 3AZKA 5AVCB 4WZSB 3AZEB 3NQJB 3LELC 2NQBA 3AZKD 3W98C 4LD9B 4NE6A 3AYWB 3WKJC 2NQBD 3B0CT 4G91C 1P3AA 5B40C 5B24C 1P3AD 1P3PC 1BH8A 4ZBJC 2YFWA 2FJ7B 4KGCB 1H3OB 4QLCB 3A6NA 2Y2NA 2Y2GA 5GT0A 3O62A 1P3GC 2RIQA 3A6ND 3LZ1A 4J8WC 3UTAD 5GT0D 3O62D 1BH9B 1WWIA 3LZ1D 4JJNC 1ZLAC 4CAYB 5DNNB 3X1UC 3WAAA 2HIOA 3MGSB 1S32A 5B32C 3B6GB 5B33A 3WAAD 2HIOD 3MNNA 1S32D 5B33D 3LJAC 5AV8C 3MNND 3AFAA 1KX4C 5AVBC 3LELB 3W98B 2YFVB 3WKJB 3AFAD 5C3IC 5BO0B 2AROC 4G91B 5B40B 1P3BA 5B24B 4UPKA 1P3PB 4ZBJB 1P3BD 3AL0C 5CPIC 5B0ZC 3AZLA 5BS7A 1P3GB 4J8WB 3AZLD 5F99A 2Y2QA 4J8UA 4H9PB 1P34A 5F99D 1M18A 4JJNB 1ZLAB 4XUJC 3X1UB 2F2AC 4J8UD 1W2EA 1P34D 3LZ0C 5B32B 1M18D 5AV5A 5B31G 1AOIA 4WNNA 2BYMB 4Z66C 3LJAB 5AV8B 3FDDA 5AV5D 3MVDA 2Y2JA 1AOID 4CSRB 1KX4B 5AVBB 2VQRA 3MVDD 4J8XA 2AROB 1F66C 4KHAB 1M1AA 3B0CW 5G49A 1T3UA 1BH9A 3A1IA 4J8XD 1M1AD 5CPIB 5B0ZB 4X23C 3RELA 3VH5W 2XD5A 2ZM5A 5BT1D 3RELD 1HQ3C 5CHLB 5FUGB 3X1TA 1N1JA 3AZNB 1P3MB 4XUJB 5BNVB 4WU9C 2F8NG 5B2IC 3UT9D 1BFMA 3X1TD 5B1MC 3LZ0B 1TZYC 4R8PA 4UUZB 5KDMA 5B31A 1KX3A 2NZDC 2NQBC 3UTBA 5B1LA 2UWXA 4R8PD 4Z66B 3X1VA 1KX3D 5B31D 1U35A 1M19C 3KFUG 5B1LD 2Y2HA 1EQZA 3X1VD 1U35D 3V9RB 1P3IB 3AZFA 5AV9A 1EQZD 1F1EA 1F66B 3MGRA 3UTAC 3AZGC 5AV9D 3AZFD 3O62C 3MGRD 1P3FC 4X23B 4H9RA 3TU4A 3P5JB 3EPKA 3AZIA 3REKA 3WAAC 3TU4D 5GT3A 3AZID 1HQ3B 3C1BA 3REKD 5B33C 1Z2CB 2F8NA 3WA9A 5GT3D 3C1BD 4WU9B 5B2IB 2F8ND 5B1MB 2F8NH 1TZYB 3W97D 1PZRA 5CP6A 3WA9D 3AFAC 2NZDB 2NQBB 5CP6D 1M19B 1ID3C 4H9NA 4KUDC 3X1SA 3B0BA 5BNXA 4H9QB 1P3OC 5E5AA 3X1SD 3UTAB 3AZLC 3AZGB 5BS7C 3O62B 3AN2A 3REHC 5E5AD 1P3FB 1P3LA 3KWQC 3AN2D 4YM6A 1P3LD 3AZMC 5GXQC 5AVCA 3WAAB 3AZEA 3NQJA 3H0LC 5B33B 1Q9CA 5AVCD 5AV5C 3KUYC 1AOIC 3AYWA 3AZHC 3AZED 3AV2C 4LD9A 4LD9D 3KXBC 3AYWD 4ZUXC 3AFAB 4NE3A 2FJ7A 4WJ3C 4KGCA 1H3OA 4QLCA 1ID3B 2FJ7D 2J8PA 4KUDB 4H9SA 4KGCD 5B2JC 4DQYB 3VH6A 1P3KC 1P3OB 5BT1C 3AZLB 3W99A 3VH6T 4CAYA 5DNNA 3KSYA 3REHB 3W96C 3W99D 3B6GA 3KWQB 5DNND 5B32G 2RVQC 3UT9C 3B6GD 3AZMB 5GXQB 3AZNC 1P3MC 3WTPA 3AV1A 5B31C 3C1CC 5AV6C 3MGQA 3W98A 5B1LC 3WTPD 3EG5B 5AV5B 3KUYB 4WNNB 3AZHB 3AV2B 3AV1D 1AOIB 5BO0A 4YS3C 3EPLA 2Y2LA 1U35C 3MGQD 3WKJA 3W98D 2Y2OA 5B40A 3KXBB 4ZUXB 5B24A 3WKJD 3REIC 5CPJC 1P3PA 4J8VA 5B40D 3REJC 4WU8C 4XZQA 5B24D 1P3IC 1P3PD 4J8VD 4XZQD 2CV5A 1KX5A 5G49B 3MGPA 5GSUC 5B2JB 4J8WA 2JCHA 2CV5D 4AWLC 1P3KB 1KX5D 3MGPD 4J8WD 4H9PA 3TU4C 1ZLAA 3AZIC 3AZJC 5B0YC 3X1UA 5JA4A 2PYOC 3EPHA 3W96B 5B32A 5GT3C 5DNMC 1ZLAD 3X1UD 3C1BC 2DQNC 3UT9B 5B32D 2BYMA 2ZY5A 3W97C 5JRGA 4CSRA 3AZKC 1KX4A 5KDMB 5B31B 3C1CB 5AV6B 5AY8A 5JRGD 5B1LB 1TAFB 2ZY2A 4H9OB 2G5IC 3X1VB 4YS3B 2AROA 1KX4D 4KHAA 5AY8D 1U35B 3H0RC 3UTBD 1P3AC 2AROD 3REIB 5CPJB 3REJB 2XD1A 4WU8B 5B0ZA 5B0ZD 3A6NC 5GSUB 5CPKA 5GT0C 1P3LC 3B0DC 3R45B 4AWLB 3LZ1C 5FUGA 4M6BA 2F8NK 3TU4B 5CPKD 3AZIB 3AZJB 5BNVA 5B0YB 2PYOB 3LZ0A 4Z5TA 5GT3B 4E45A 5DNMB 2HIOC 1S32C 3C1BB 3LZ0D 2F8NB 4Z5TD 3W97B 4Z66A 3MNNC 1JFIA 3B6FA 4Z66D 3AZKB 3V9RA 3F6TA 2CWEA 3B6FD 1F66A 1WWSA 4E44A 2HUEC 4H9SC 1P3AB 1F66D 1P3BC 3X1SB 1BH8B 2YFWB 3NQUA 1ULYA 2BYKA 3W99C 3A6NB 5GT0B 3WTPE 2IO5C 1P3LB 3B0DB 3LZ1B 4NFTA 5F99C 2JSSA 4J8UC 4WU9A 1P34C 5B2IA 3H0MC 5B1MA 3WTPC 1TZYA 1M18C 3AV1C 2NZDA 2HIOB 4YM6D 4WU9D 1S32B 5B2ID 3MGQC 5B1MD 1TZYD 2NZDD 1M19A 3MNNB 4WV4B 1M19D 3VH5A 3MVDC 4J8VC 2LY8A 1R4VA 4XZQC 2JE5A 4H9QA 3UTAA 3VH5T 3AZGA 4J8XC 2CV5C 1KX5C 2HUEB 2Y2KA 1M1AC 3MGPC 1P3BB 1P3FA 3AZGD 4QLCD 1P3FD 3W99B 4DRBA 4EO5C 2Y2PA 4G92C 3RELC 2IO5B 3MGSA 5F99B 1B6WA 4NE5A 4J8UB 3MGSD 3X1TC 5JRGC 1P34B 1M18B 3WTPB 4Z2MG 3AV1B 4DRAA 5AY8C 3MGQB 4R8PC 1KX3C 3LELA 2ZY3A 1HTAA 3UTBC 1KU5A 2YFVA 1ID3A 1A7WA 3X1VC 3LELD 4KUDA 3MVDB 1ID3D 4J8VB 1EQZC 4XZQB 4KUDD 1P3OA 3AZFC 5AV9C 4J8XB 2CV5B 1KX5B 3MGRC 1M1AB 3MGPB 3REHA 1P3OD 5CPKC 1P3GA 2Y2MA 3KWQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3REH D;  4HGA C;  1P3G D;  4EO5 B;  3KWQ D;  3AZM A;  5GXQ A;  4G92 B;  5JA4 B;  3REL B;  4JJN A;  4Z5T C;  3REK C;  3AZM D;  5GXQ D;  4JJN D;  3KUY A;  3AZH A;  3AV2 A;  3X1T B;  1N1J B;  5JRG B;  3WA9 C;  3KUY D;  3KXB A;  3AZH D;  4ZUX A;  3LJA A;  3AV2 D;  3B6F C;  5AV8 A;  5AY8 B;  4Z2M H;  4R8P B;  5CP6 C;  3KXB D;  5AVB A;  1KX3 B;  4ZUX D;  3LJA D;  3UTB B;  5C3I B;  5AV8 D;  5AVB D;  5B2J A;  1EQZ B;  1P3K A;  3X1S C;  5B2J D;  3AZF B;  5AV9 B;  5CPI A;  1B67 A;  1P3K D;  3MGR B;  5E5A C;  3W96 A;  5CPK B;  5CPI D;  3AN2 C;  3UT9 A;  3W96 D;  4HGA B;  4H9R B;  4YM6 C;  3AZN A;  2RVQ D;  1P3M A;  4Z5T B;  4XUJ A;  3VH6 W;  3REK B;  5AVC C;  3C1C A;  5AV6 A;  3AZN D;  1P3M D;  1TAF A;  4UUZ A;  4H9O A;  3AZE C;  4XUJ D;  4YS3 A;  3C1C D;  5AV6 D;  3WA9 B;  1JFI B;  4LD9 C;  3AYW C;  3B6F B;  4YS3 D;  3REI A;  5CPJ A;  3REJ A;  5CP6 B;  4WU8 A;  1P3I A;  3REI D;  5CPJ D;  2FJ7 C;  3REJ D;  4WU8 D;  4KGC C;  2L5A A;  4QLC C;  4H9N B;  5GSU A;  1P3I D;  3R45 A;  5GSU D;  3NQU B;  4X23 A;  2BYK B;  5BNX B;  3AZJ A;  5B0Y A;  5E5A B;  2PYO A;  4X23 D;  5DNN C;  3AN2 B;  5DNM A;  3AZJ D;  5B0Y D;  3MGS C;  2PYO D;  3B6G C;  3W97 A;  1HQ3 A;  5DNM D;  4YM6 B;  1HQ3 D;  3AZK A;  5AVC B;  4WZS B;  3AZE B;  3NQJ B;  3LEL C;  2NQB A;  3AZK D;  3W98 C;  4LD9 B;  4NE6 A;  3AYW B;  3WKJ C;  2NQB D;  3B0C T;  4G91 C;  1P3A A;  5B40 C;  5B24 C;  1P3A D;  1P3P C;  1BH8 A;  4ZBJ C;  2YFW A;  2FJ7 B;  4KGC B;  1H3O B;  4QLC B;  3A6N A;  5GT0 A;  3O62 A;  1P3G C;  3A6N D;  3LZ1 A;  4J8W C;  3UTA D;  5GT0 D;  3O62 D;  1WWI A;  3LZ1 D;  4JJN C;  1ZLA C;  4CAY B;  5DNN B;  3X1U C;  3WAA A;  2HIO A;  3MGS B;  1S32 A;  5B32 C;  3B6G B;  5B33 A;  3WAA D;  2HIO D;  3MNN A;  1S32 D;  5B33 D;  3LJA C;  5AV8 C;  3MNN D;  3AFA A;  1KX4 C;  5AVB C;  3LEL B;  3W98 B;  2YFV B;  3WKJ B;  3AFA D;  5C3I C;  5BO0 B;  2ARO C;  4G91 B;  5B40 B;  1P3B A;  5B24 B;  1P3P B;  4ZBJ B;  1P3B D;  5CPI C;  5B0Z C;  3AZL A;  5BS7 A;  1P3G B;  4J8W B;  3AZL D;  5F99 A;  4J8U A;  4H9P B;  1P34 A;  5F99 D;  1M18 A;  4JJN B;  1ZLA B;  4XUJ C;  3X1U B;  4J8U D;  1P34 D;  3LZ0 C;  5B32 B;  1M18 D;  5AV5 A;  5B31 G;  1AOI A;  4WNN A;  2BYM B;  4Z66 C;  3LJA B;  5AV8 B;  5AV5 D;  3MVD A;  1AOI D;  4CSR B;  1KX4 B;  5AVB B;  3MVD D;  4J8X A;  2ARO B;  1F66 C;  4KHA B;  1M1A A;  3B0C W;  5G49 A;  1BH9 A;  4J8X D;  1M1A D;  5CPI B;  5B0Z B;  4X23 C;  3REL A;  3VH5 W;  5BT1 D;  3REL D;  1HQ3 C;  5CHL B;  5FUG B;  3X1T A;  1N1J A;  3AZN B;  1P3M B;  4XUJ B;  5BNV B;  4WU9 C;  2F8N G;  5B2I C;  3UT9 D;  1BFM A;  3X1T D;  5B1M C;  3LZ0 B;  1TZY C;  4R8P A;  4UUZ B;  5KDM A;  5B31 A;  1KX3 A;  2NZD C;  2NQB C;  3UTB A;  5B1L A;  4R8P D;  4Z66 B;  3X1V A;  1KX3 D;  5B31 D;  1U35 A;  1M19 C;  5B1L D;  1EQZ A;  3X1V D;  1U35 D;  3V9R B;  1P3I B;  3AZF A;  5AV9 A;  1EQZ D;  1F1E A;  1F66 B;  3MGR A;  3UTA C;  3AZG C;  5AV9 D;  3AZF D;  3O62 C;  3MGR D;  1P3F C;  4X23 B;  4H9R A;  3TU4 A;  3AZI A;  3REK A;  3WAA C;  3TU4 D;  5GT3 A;  3AZI D;  1HQ3 B;  3C1B A;  3REK D;  5B33 C;  2F8N A;  3WA9 A;  5GT3 D;  3C1B D;  4WU9 B;  5B2I B;  2F8N D;  5B1M B;  2F8N H;  1TZY B;  3W97 D;  3WA9 D;  5CP6 A;  3AFA C;  2NZD B;  2NQB B;  5CP6 D;  1M19 B;  1ID3 C;  4H9N A;  4KUD C;  3X1S A;  3B0B A;  5BNX A;  4H9Q B;  1P3O C;  5E5A A;  3X1S D;  3UTA B;  3AZL C;  3AZG B;  5BS7 C;  3O62 B;  3AN2 A;  3REH C;  5E5A D;  1P3F B;  1P3L A;  3KWQ C;  3AN2 D;  4YM6 A;  1P3L D;  3AZM C;  5GXQ C;  5AVC A;  3WAA B;  3AZE A;  3NQJ A;  5B33 B;  1Q9C A;  5AVC D;  5AV5 C;  3KUY C;  1AOI C;  3AYW A;  3AZH C;  3AZE D;  3AV2 C;  4LD9 A;  4LD9 D;  3KXB C;  3AYW D;  4ZUX C;  3AFA B;  4NE3 A;  2FJ7 A;  4KGC A;  1H3O A;  4QLC A;  1ID3 B;  2FJ7 D;  4KUD B;  4H9S A;  4KGC D;  5B2J C;  3VH6 A;  1P3K C;  1P3O B;  5BT1 C;  3AZL B;  3W99 A;  3VH6 T;  4CAY A;  5DNN A;  3KSY A;  3REH B;  3W96 C;  3W99 D;  3B6G A;  3KWQ B;  5DNN D;  5B32 G;  2RVQ C;  3UT9 C;  3B6G D;  3AZM B;  5GXQ B;  3AZN C;  1P3M C;  3WTP A;  3AV1 A;  5B31 C;  3C1C C;  5AV6 C;  3MGQ A;  3W98 A;  5B1L C;  3WTP D;  5AV5 B;  3KUY B;  1AOI B;  4WNN B;  3AZH B;  3AV2 B;  3AV1 D;  3WKJ A;  5BO0 A;  4YS3 C;  1U35 C;  3MGQ D;  3W98 D;  5B40 A;  3KXB B;  4ZUX B;  5B24 A;  3WKJ D;  3REI C;  5CPJ C;  1P3P A;  4J8V A;  5B40 D;  3REJ C;  4WU8 C;  4XZQ A;  5B24 D;  1P3I C;  1P3P D;  4J8V D;  4XZQ D;  2CV5 A;  1KX5 A;  5G49 B;  3MGP A;  5GSU C;  5B2J B;  4J8W A;  2CV5 D;  1P3K B;  4AWL C;  1KX5 D;  3MGP D;  4J8W D;  4H9P A;  3TU4 C;  1ZLA A;  3AZI C;  3AZJ C;  5B0Y C;  3X1U A;  5JA4 A;  2PYO C;  3W96 B;  5B32 A;  5GT3 C;  5DNM C;  1ZLA D;  3X1U D;  3C1B C;  3UT9 B;  5B32 D;  2BYM A;  3W97 C;  5JRG A;  4CSR A;  3AZK C;  1KX4 A;  5KDM B;  5B31 B;  3C1C B;  5AV6 B;  5AY8 A;  5JRG D;  5B1L B;  1TAF B;  4H9O B;  3X1V B;  4YS3 B;  2ARO A;  1KX4 D;  4KHA A;  5AY8 D;  1U35 B;  3UTB D;  1P3A C;  2ARO D;  3REI B;  5CPJ B;  3REJ B;  4WU8 B;  5B0Z A;  5B0Z D;  3A6N C;  5GSU B;  5CPK A;  5GT0 C;  1P3L C;  3B0D C;  3R45 B;  4AWL B;  3LZ1 C;  5FUG A;  4M6B A;  2F8N K;  3TU4 B;  5CPK D;  3AZI B;  3AZJ B;  5BNV A;  5B0Y B;  2PYO B;  3LZ0 A;  4Z5T A;  5GT3 B;  4E45 A;  5DNM B;  2HIO C;  1S32 C;  3C1B B;  3LZ0 D;  2F8N B;  4Z5T D;  3W97 B;  4Z66 A;  3MNN C;  1JFI A;  3B6F A;  4Z66 D;  3AZK B;  3V9R A;  2CWE A;  3B6F D;  1F66 A;  1WWS A;  4E44 A;  2HUE C;  4H9S C;  1P3A B;  1F66 D;  1P3B C;  3X1S B;  1BH8 B;  2YFW B;  3NQU A;  1ULY A;  2BYK A;  3W99 C;  3A6N B;  3WTP E;  5GT0 B;  2IO5 C;  1P3L B;  3B0D B;  3LZ1 B;  4NFT A;  5F99 C;  2JSS A;  4J8U C;  4WU9 A;  1P34 C;  5B2I A;  1M18 C;  5B1M A;  3WTP C;  1TZY A;  3AV1 C;  2NZD A;  2HIO B;  4YM6 D;  4WU9 D;  1S32 B;  5B2I D;  3MGQ C;  5B1M D;  1TZY D;  2NZD D;  1M19 A;  3MNN B;  4WV4 B;  1M19 D;  3VH5 A;  3MVD C;  4J8V C;  2LY8 A;  1R4V A;  4XZQ C;  4H9Q A;  3UTA A;  3VH5 T;  3AZG A;  4J8X C;  2CV5 C;  1KX5 C;  2HUE B;  1M1A C;  3MGP C;  1P3B B;  1P3F A;  3AZG D;  4QLC D;  1P3F D;  3W99 B;  4DRB A;  4EO5 C;  4G92 C;  3REL C;  2IO5 B;  3MGS A;  5F99 B;  1B6W A;  4NE5 A;  4J8U B;  3MGS D;  3X1T C;  5JRG C;  1P34 B;  1M18 B;  3WTP B;  4Z2M G;  3AV1 B;  4DRA A;  5AY8 C;  3MGQ B;  4R8P C;  1KX3 C;  3LEL A;  1HTA A;  3UTB C;  1KU5 A;  2YFV A;  1ID3 A;  1A7W A;  3X1V C;  3LEL D;  4KUD A;  3MVD B;  1ID3 D;  4J8V B;  1EQZ C;  4XZQ B;  4KUD D;  1P3O A;  3AZF C;  5AV9 C;  4J8X B;  2CV5 B;  1KX5 B;  3MGR C;  1M1A B;  3MGP B;  3REH A;  1P3O D;  5CPK C;  1P3G A;  1BH9 B;  3KWQ A; 
#chains in the Genus database with same CATH topology
 3REH D;  4HGA C;  1P3G D;  4EO5 B;  3KWQ D;  3AZM A;  5GXQ A;  4G92 B;  5JA4 B;  3REL B;  4JJN A;  4Z5T C;  3REK C;  3AZM D;  5GXQ D;  4JJN D;  3KUY A;  3AZH A;  3AV2 A;  3X1T B;  1N1J B;  5JRG B;  3WA9 C;  3KUY D;  3KXB A;  3AZH D;  4ZUX A;  3LJA A;  3AV2 D;  3B6F C;  5AV8 A;  5AY8 B;  4Z2M H;  4R8P B;  5CP6 C;  3KXB D;  5AVB A;  1KX3 B;  4ZUX D;  3LJA D;  3UTB B;  5C3I B;  5AV8 D;  5AVB D;  5B2J A;  1EQZ B;  2G5H C;  1P3K A;  3X1S C;  5B2J D;  3EPJ A;  2FFF B;  5AV9 B;  3AZF B;  5CPI A;  1B67 A;  1P3K D;  3MGR B;  5E5A C;  3W96 A;  5CPK B;  5CPI D;  3AN2 C;  3UT9 A;  3W96 D;  4HGA B;  4H9R B;  4YM6 C;  3AZN A;  2RVQ D;  1P3M A;  4Z5T B;  4XUJ A;  3VH6 W;  3REK B;  5AVC C;  3C1C A;  5AV6 A;  3AZN D;  1P3M D;  1TAF A;  4UUZ A;  4H9O A;  3AZE C;  2DF4 C;  2ZY4 A;  4XUJ D;  4YS3 A;  3C1C D;  5AV6 D;  3WA9 B;  1JFI B;  4LD9 C;  3AYW C;  3B6F B;  4YS3 D;  3REI A;  5CPJ A;  3REJ A;  3IP4 C;  5CP6 B;  4WU8 A;  1P3I A;  3REI D;  5CPJ D;  2FJ7 C;  2BG1 A;  3REJ D;  4WU8 D;  4KGC C;  2L5A A;  4QLC C;  4H9N B;  5GSU A;  1P3I D;  3R45 A;  5GSU D;  3NQU B;  4X23 A;  2BYK B;  5BNX B;  3AZJ A;  5B0Y A;  5E5A B;  2PYO A;  2W8S A;  4X23 D;  5DNN C;  3AN2 B;  5DNM A;  3AZJ D;  5B0Y D;  3A1K A;  3MGS C;  2PYO D;  3B6G C;  3W97 A;  1HQ3 A;  5DNM D;  4YM6 B;  2Y2I A;  1HQ3 D;  3AZK A;  5AVC B;  4WZS B;  3AZE B;  3NQJ B;  3LEL C;  2NQB A;  3AZK D;  3W98 C;  4LD9 B;  4NE6 A;  3AYW B;  3WKJ C;  2NQB D;  3B0C T;  4G91 C;  1P3A A;  5B40 C;  5B24 C;  1P3A D;  1P3P C;  1BH8 A;  4ZBJ C;  2YFW A;  2FJ7 B;  4KGC B;  1H3O B;  4QLC B;  3A6N A;  2Y2N A;  2Y2G A;  5GT0 A;  3O62 A;  1P3G C;  2RIQ A;  3A6N D;  3LZ1 A;  4J8W C;  3UTA D;  5GT0 D;  3O62 D;  1BH9 B;  1WWI A;  3LZ1 D;  4JJN C;  1ZLA C;  4CAY B;  5DNN B;  3X1U C;  3WAA A;  2HIO A;  3MGS B;  1S32 A;  5B32 C;  3B6G B;  5B33 A;  3WAA D;  2HIO D;  3MNN A;  1S32 D;  5B33 D;  3LJA C;  5AV8 C;  3MNN D;  3AFA A;  1KX4 C;  5AVB C;  3LEL B;  3W98 B;  2YFV B;  3WKJ B;  3AFA D;  5C3I C;  5BO0 B;  2ARO C;  4G91 B;  5B40 B;  1P3B A;  5B24 B;  4UPK A;  1P3P B;  4ZBJ B;  1P3B D;  3AL0 C;  5CPI C;  5B0Z C;  3AZL A;  5BS7 A;  1P3G B;  4J8W B;  3AZL D;  5F99 A;  2Y2Q A;  4J8U A;  4H9P B;  1P34 A;  5F99 D;  1M18 A;  4JJN B;  1ZLA B;  4XUJ C;  3X1U B;  2F2A C;  4J8U D;  1W2E A;  1P34 D;  3LZ0 C;  5B32 B;  1M18 D;  5AV5 A;  5B31 G;  1AOI A;  4WNN A;  2BYM B;  4Z66 C;  3LJA B;  5AV8 B;  3FDD A;  5AV5 D;  3MVD A;  2Y2J A;  1AOI D;  4CSR B;  1KX4 B;  5AVB B;  2VQR A;  3MVD D;  4J8X A;  2ARO B;  1F66 C;  4KHA B;  1M1A A;  3B0C W;  5G49 A;  1T3U A;  1BH9 A;  3A1I A;  4J8X D;  1M1A D;  5CPI B;  5B0Z B;  4X23 C;  3REL A;  3VH5 W;  2XD5 A;  2ZM5 A;  5BT1 D;  3REL D;  1HQ3 C;  5CHL B;  5FUG B;  3X1T A;  1N1J A;  3AZN B;  1P3M B;  4XUJ B;  5BNV B;  4WU9 C;  2F8N G;  5B2I C;  3UT9 D;  1BFM A;  3X1T D;  5B1M C;  3LZ0 B;  1TZY C;  4R8P A;  4UUZ B;  5KDM A;  5B31 A;  1KX3 A;  2NZD C;  2NQB C;  3UTB A;  5B1L A;  2UWX A;  4R8P D;  4Z66 B;  3X1V A;  1KX3 D;  5B31 D;  1U35 A;  1M19 C;  3KFU G;  5B1L D;  2Y2H A;  1EQZ A;  3X1V D;  1U35 D;  3V9R B;  1P3I B;  3AZF A;  5AV9 A;  1EQZ D;  1F1E A;  1F66 B;  3MGR A;  3UTA C;  3AZG C;  5AV9 D;  3AZF D;  3O62 C;  3MGR D;  1P3F C;  4X23 B;  4H9R A;  3TU4 A;  3P5J B;  3EPK A;  3AZI A;  3REK A;  3WAA C;  3TU4 D;  5GT3 A;  3AZI D;  1HQ3 B;  3C1B A;  3REK D;  5B33 C;  1Z2C B;  2F8N A;  3WA9 A;  5GT3 D;  3C1B D;  4WU9 B;  5B2I B;  2F8N D;  5B1M B;  2F8N H;  1TZY B;  3W97 D;  1PZR A;  5CP6 A;  3WA9 D;  3AFA C;  2NZD B;  2NQB B;  5CP6 D;  1M19 B;  1ID3 C;  4H9N A;  4KUD C;  3X1S A;  3B0B A;  5BNX A;  4H9Q B;  1P3O C;  5E5A A;  3X1S D;  3UTA B;  3AZL C;  3AZG B;  5BS7 C;  3O62 B;  3AN2 A;  3REH C;  5E5A D;  1P3F B;  1P3L A;  3KWQ C;  3AN2 D;  4YM6 A;  1P3L D;  3AZM C;  5GXQ C;  5AVC A;  3WAA B;  3AZE A;  3NQJ A;  3H0L C;  5B33 B;  1Q9C A;  5AVC D;  5AV5 C;  3KUY C;  1AOI C;  3AYW A;  3AZH C;  3AZE D;  3AV2 C;  4LD9 A;  4LD9 D;  3KXB C;  3AYW D;  4ZUX C;  3AFA B;  4NE3 A;  2FJ7 A;  4WJ3 C;  4KGC A;  1H3O A;  4QLC A;  1ID3 B;  2FJ7 D;  2J8P A;  4KUD B;  4H9S A;  4KGC D;  5B2J C;  4DQY B;  3VH6 A;  1P3K C;  1P3O B;  5BT1 C;  3AZL B;  3W99 A;  3VH6 T;  4CAY A;  5DNN A;  3KSY A;  3REH B;  3W96 C;  3W99 D;  3B6G A;  3KWQ B;  5DNN D;  5B32 G;  2RVQ C;  3UT9 C;  3B6G D;  3AZM B;  5GXQ B;  3AZN C;  1P3M C;  3WTP A;  3AV1 A;  5B31 C;  3C1C C;  5AV6 C;  3MGQ A;  3W98 A;  5B1L C;  3WTP D;  3EG5 B;  5AV5 B;  3KUY B;  4WNN B;  3AZH B;  3AV2 B;  3AV1 D;  1AOI B;  5BO0 A;  4YS3 C;  3EPL A;  2Y2L A;  1U35 C;  3MGQ D;  3WKJ A;  3W98 D;  2Y2O A;  5B40 A;  3KXB B;  4ZUX B;  5B24 A;  3WKJ D;  3REI C;  5CPJ C;  1P3P A;  4J8V A;  5B40 D;  3REJ C;  4WU8 C;  4XZQ A;  5B24 D;  1P3I C;  1P3P D;  4J8V D;  4XZQ D;  2CV5 A;  1KX5 A;  5G49 B;  3MGP A;  5GSU C;  5B2J B;  4J8W A;  2JCH A;  2CV5 D;  4AWL C;  1P3K B;  1KX5 D;  3MGP D;  4J8W D;  4H9P A;  3TU4 C;  1ZLA A;  3AZI C;  3AZJ C;  5B0Y C;  3X1U A;  5JA4 A;  2PYO C;  3EPH A;  3W96 B;  5B32 A;  5GT3 C;  5DNM C;  1ZLA D;  3X1U D;  3C1B C;  2DQN C;  3UT9 B;  5B32 D;  2BYM A;  2ZY5 A;  3W97 C;  5JRG A;  4CSR A;  3AZK C;  1KX4 A;  5KDM B;  5B31 B;  3C1C B;  5AV6 B;  5AY8 A;  5JRG D;  5B1L B;  1TAF B;  2ZY2 A;  4H9O B;  2G5I C;  3X1V B;  4YS3 B;  2ARO A;  1KX4 D;  4KHA A;  5AY8 D;  1U35 B;  3H0R C;  3UTB D;  1P3A C;  2ARO D;  3REI B;  5CPJ B;  3REJ B;  2XD1 A;  4WU8 B;  5B0Z A;  5B0Z D;  3A6N C;  5GSU B;  5CPK A;  5GT0 C;  1P3L C;  3B0D C;  3R45 B;  4AWL B;  3LZ1 C;  5FUG A;  4M6B A;  2F8N K;  3TU4 B;  5CPK D;  3AZI B;  3AZJ B;  5BNV A;  5B0Y B;  2PYO B;  3LZ0 A;  4Z5T A;  5GT3 B;  4E45 A;  5DNM B;  2HIO C;  1S32 C;  3C1B B;  3LZ0 D;  2F8N B;  4Z5T D;  3W97 B;  4Z66 A;  3MNN C;  1JFI A;  3B6F A;  4Z66 D;  3AZK B;  3V9R A;  3F6T A;  2CWE A;  3B6F D;  1F66 A;  1WWS A;  4E44 A;  2HUE C;  4H9S C;  1P3A B;  1F66 D;  1P3B C;  3X1S B;  1BH8 B;  2YFW B;  3NQU A;  1ULY A;  2BYK A;  3W99 C;  3A6N B;  5GT0 B;  3WTP E;  2IO5 C;  1P3L B;  3B0D B;  3LZ1 B;  4NFT A;  5F99 C;  2JSS A;  4J8U C;  4WU9 A;  1P34 C;  5B2I A;  3H0M C;  5B1M A;  3WTP C;  1TZY A;  1M18 C;  3AV1 C;  2NZD A;  2HIO B;  4YM6 D;  4WU9 D;  1S32 B;  5B2I D;  3MGQ C;  5B1M D;  1TZY D;  2NZD D;  1M19 A;  3MNN B;  4WV4 B;  1M19 D;  3VH5 A;  3MVD C;  4J8V C;  2LY8 A;  1R4V A;  4XZQ C;  2JE5 A;  4H9Q A;  3UTA A;  3VH5 T;  3AZG A;  4J8X C;  2CV5 C;  1KX5 C;  2HUE B;  2Y2K A;  1M1A C;  3MGP C;  1P3B B;  1P3F A;  3AZG D;  4QLC D;  1P3F D;  3W99 B;  4DRB A;  4EO5 C;  2Y2P A;  4G92 C;  3REL C;  2IO5 B;  3MGS A;  5F99 B;  1B6W A;  4NE5 A;  4J8U B;  3MGS D;  3X1T C;  5JRG C;  1P34 B;  1M18 B;  3WTP B;  4Z2M G;  3AV1 B;  4DRA A;  5AY8 C;  3MGQ B;  4R8P C;  1KX3 C;  3LEL A;  2ZY3 A;  1HTA A;  3UTB C;  1KU5 A;  2YFV A;  1ID3 A;  1A7W A;  3X1V C;  3LEL D;  4KUD A;  3MVD B;  1ID3 D;  4J8V B;  1EQZ C;  4XZQ B;  4KUD D;  1P3O A;  3AZF C;  5AV9 C;  4J8X B;  2CV5 B;  1KX5 B;  3MGR C;  1M1A B;  3MGP B;  3REH A;  1P3O D;  5CPK C;  1P3G A;  2Y2M A;  3KWQ A; 
#chains in the Genus database with same CATH homology
 3REH D;  4HGA C;  1P3G D;  4EO5 B;  3KWQ D;  3AZM A;  5GXQ A;  4G92 B;  5JA4 B;  3REL B;  4JJN A;  4Z5T C;  3REK C;  3AZM D;  5GXQ D;  4JJN D;  3KUY A;  3AZH A;  3AV2 A;  3X1T B;  1N1J B;  5JRG B;  3WA9 C;  3KUY D;  3KXB A;  3AZH D;  4ZUX A;  3LJA A;  3AV2 D;  3B6F C;  5AV8 A;  5AY8 B;  4Z2M H;  4R8P B;  5CP6 C;  3KXB D;  5AVB A;  1KX3 B;  4ZUX D;  3LJA D;  3UTB B;  5C3I B;  5AV8 D;  5AVB D;  5B2J A;  1EQZ B;  2G5H C;  1P3K A;  3X1S C;  5B2J D;  3EPJ A;  2FFF B;  5AV9 B;  3AZF B;  5CPI A;  1B67 A;  1P3K D;  3MGR B;  5E5A C;  3W96 A;  5CPK B;  5CPI D;  3AN2 C;  3UT9 A;  3W96 D;  4HGA B;  4H9R B;  4YM6 C;  3AZN A;  2RVQ D;  1P3M A;  4Z5T B;  4XUJ A;  3VH6 W;  3REK B;  5AVC C;  3C1C A;  5AV6 A;  3AZN D;  1P3M D;  1TAF A;  4UUZ A;  4H9O A;  3AZE C;  2DF4 C;  2ZY4 A;  4XUJ D;  4YS3 A;  3C1C D;  5AV6 D;  3WA9 B;  1JFI B;  4LD9 C;  3AYW C;  3B6F B;  4YS3 D;  3REI A;  5CPJ A;  3REJ A;  3IP4 C;  5CP6 B;  4WU8 A;  1P3I A;  3REI D;  5CPJ D;  2FJ7 C;  2BG1 A;  3REJ D;  4WU8 D;  4KGC C;  2L5A A;  4QLC C;  4H9N B;  5GSU A;  1P3I D;  3R45 A;  5GSU D;  3NQU B;  4X23 A;  2BYK B;  5BNX B;  3AZJ A;  5B0Y A;  5E5A B;  2PYO A;  2W8S A;  4X23 D;  5DNN C;  3AN2 B;  5DNM A;  3AZJ D;  5B0Y D;  3A1K A;  3MGS C;  2PYO D;  3B6G C;  3W97 A;  1HQ3 A;  5DNM D;  4YM6 B;  2Y2I A;  1HQ3 D;  3AZK A;  5AVC B;  4WZS B;  3AZE B;  3NQJ B;  3LEL C;  2NQB A;  3AZK D;  3W98 C;  4LD9 B;  4NE6 A;  3AYW B;  3WKJ C;  2NQB D;  3B0C T;  4G91 C;  1P3A A;  5B40 C;  5B24 C;  1P3A D;  1P3P C;  1BH8 A;  4ZBJ C;  2YFW A;  2FJ7 B;  4KGC B;  1H3O B;  4QLC B;  3A6N A;  2Y2N A;  2Y2G A;  5GT0 A;  3O62 A;  1P3G C;  2RIQ A;  3A6N D;  3LZ1 A;  4J8W C;  3UTA D;  5GT0 D;  3O62 D;  1BH9 B;  1WWI A;  3LZ1 D;  4JJN C;  1ZLA C;  4CAY B;  5DNN B;  3X1U C;  3WAA A;  2HIO A;  3MGS B;  1S32 A;  5B32 C;  3B6G B;  5B33 A;  3WAA D;  2HIO D;  3MNN A;  1S32 D;  5B33 D;  3LJA C;  5AV8 C;  3MNN D;  3AFA A;  1KX4 C;  5AVB C;  3LEL B;  3W98 B;  2YFV B;  3WKJ B;  3AFA D;  5C3I C;  5BO0 B;  2ARO C;  4G91 B;  5B40 B;  1P3B A;  5B24 B;  4UPK A;  1P3P B;  4ZBJ B;  1P3B D;  3AL0 C;  5CPI C;  5B0Z C;  3AZL A;  5BS7 A;  1P3G B;  4J8W B;  3AZL D;  5F99 A;  2Y2Q A;  4J8U A;  4H9P B;  1P34 A;  5F99 D;  1M18 A;  4JJN B;  1ZLA B;  4XUJ C;  3X1U B;  2F2A C;  4J8U D;  1W2E A;  1P34 D;  3LZ0 C;  5B32 B;  1M18 D;  5AV5 A;  5B31 G;  1AOI A;  4WNN A;  2BYM B;  4Z66 C;  3LJA B;  5AV8 B;  3FDD A;  5AV5 D;  3MVD A;  2Y2J A;  1AOI D;  4CSR B;  1KX4 B;  5AVB B;  2VQR A;  3MVD D;  4J8X A;  2ARO B;  1F66 C;  4KHA B;  1M1A A;  3B0C W;  5G49 A;  1T3U A;  1BH9 A;  3A1I A;  4J8X D;  1M1A D;  5CPI B;  5B0Z B;  4X23 C;  3REL A;  3VH5 W;  2XD5 A;  2ZM5 A;  5BT1 D;  3REL D;  1HQ3 C;  5CHL B;  5FUG B;  3X1T A;  1N1J A;  3AZN B;  1P3M B;  4XUJ B;  5BNV B;  4WU9 C;  2F8N G;  5B2I C;  3UT9 D;  1BFM A;  3X1T D;  5B1M C;  3LZ0 B;  1TZY C;  4R8P A;  4UUZ B;  5KDM A;  5B31 A;  1KX3 A;  2NZD C;  2NQB C;  3UTB A;  5B1L A;  2UWX A;  4R8P D;  4Z66 B;  3X1V A;  1KX3 D;  5B31 D;  1U35 A;  1M19 C;  3KFU G;  5B1L D;  2Y2H A;  1EQZ A;  3X1V D;  1U35 D;  3V9R B;  1P3I B;  3AZF A;  5AV9 A;  1EQZ D;  1F1E A;  1F66 B;  3MGR A;  3UTA C;  3AZG C;  5AV9 D;  3AZF D;  3O62 C;  3MGR D;  1P3F C;  4X23 B;  4H9R A;  3TU4 A;  3P5J B;  3EPK A;  3AZI A;  3REK A;  3WAA C;  3TU4 D;  5GT3 A;  3AZI D;  1HQ3 B;  3C1B A;  3REK D;  5B33 C;  1Z2C B;  2F8N A;  3WA9 A;  5GT3 D;  3C1B D;  4WU9 B;  5B2I B;  2F8N D;  5B1M B;  2F8N H;  1TZY B;  3W97 D;  1PZR A;  5CP6 A;  3WA9 D;  3AFA C;  2NZD B;  2NQB B;  5CP6 D;  1M19 B;  1ID3 C;  4H9N A;  4KUD C;  3X1S A;  3B0B A;  5BNX A;  4H9Q B;  1P3O C;  5E5A A;  3X1S D;  3UTA B;  3AZL C;  3AZG B;  5BS7 C;  3O62 B;  3AN2 A;  3REH C;  5E5A D;  1P3F B;  1P3L A;  3KWQ C;  3AN2 D;  4YM6 A;  1P3L D;  3AZM C;  5GXQ C;  5AVC A;  3WAA B;  3AZE A;  3NQJ A;  3H0L C;  5B33 B;  1Q9C A;  5AVC D;  5AV5 C;  3KUY C;  1AOI C;  3AYW A;  3AZH C;  3AZE D;  3AV2 C;  4LD9 A;  4LD9 D;  3KXB C;  3AYW D;  4ZUX C;  3AFA B;  4NE3 A;  2FJ7 A;  4WJ3 C;  4KGC A;  1H3O A;  4QLC A;  1ID3 B;  2FJ7 D;  2J8P A;  4KUD B;  4H9S A;  4KGC D;  5B2J C;  4DQY B;  3VH6 A;  1P3K C;  1P3O B;  5BT1 C;  3AZL B;  3W99 A;  3VH6 T;  4CAY A;  5DNN A;  3KSY A;  3REH B;  3W96 C;  3W99 D;  3B6G A;  3KWQ B;  5DNN D;  5B32 G;  2RVQ C;  3UT9 C;  3B6G D;  3AZM B;  5GXQ B;  3AZN C;  1P3M C;  3WTP A;  3AV1 A;  5B31 C;  3C1C C;  5AV6 C;  3MGQ A;  3W98 A;  5B1L C;  3WTP D;  3EG5 B;  5AV5 B;  3KUY B;  4WNN B;  3AZH B;  3AV2 B;  3AV1 D;  1AOI B;  5BO0 A;  4YS3 C;  3EPL A;  2Y2L A;  1U35 C;  3MGQ D;  3WKJ A;  3W98 D;  2Y2O A;  5B40 A;  3KXB B;  4ZUX B;  5B24 A;  3WKJ D;  3REI C;  5CPJ C;  1P3P A;  4J8V A;  5B40 D;  3REJ C;  4WU8 C;  4XZQ A;  5B24 D;  1P3I C;  1P3P D;  4J8V D;  4XZQ D;  2CV5 A;  1KX5 A;  5G49 B;  3MGP A;  5GSU C;  5B2J B;  4J8W A;  2JCH A;  2CV5 D;  4AWL C;  1P3K B;  1KX5 D;  3MGP D;  4J8W D;  4H9P A;  3TU4 C;  1ZLA A;  3AZI C;  3AZJ C;  5B0Y C;  3X1U A;  5JA4 A;  2PYO C;  3EPH A;  3W96 B;  5B32 A;  5GT3 C;  5DNM C;  1ZLA D;  3X1U D;  3C1B C;  2DQN C;  3UT9 B;  5B32 D;  2BYM A;  2ZY5 A;  3W97 C;  5JRG A;  4CSR A;  3AZK C;  1KX4 A;  5KDM B;  5B31 B;  3C1C B;  5AV6 B;  5AY8 A;  5JRG D;  5B1L B;  1TAF B;  2ZY2 A;  4H9O B;  2G5I C;  3X1V B;  4YS3 B;  2ARO A;  1KX4 D;  4KHA A;  5AY8 D;  1U35 B;  3H0R C;  3UTB D;  1P3A C;  2ARO D;  3REI B;  5CPJ B;  3REJ B;  2XD1 A;  4WU8 B;  5B0Z A;  5B0Z D;  3A6N C;  5GSU B;  5CPK A;  5GT0 C;  1P3L C;  3B0D C;  3R45 B;  4AWL B;  3LZ1 C;  5FUG A;  4M6B A;  2F8N K;  3TU4 B;  5CPK D;  3AZI B;  3AZJ B;  5BNV A;  5B0Y B;  2PYO B;  3LZ0 A;  4Z5T A;  5GT3 B;  4E45 A;  5DNM B;  2HIO C;  1S32 C;  3C1B B;  3LZ0 D;  2F8N B;  4Z5T D;  3W97 B;  4Z66 A;  3MNN C;  1JFI A;  3B6F A;  4Z66 D;  3AZK B;  3V9R A;  3F6T A;  2CWE A;  3B6F D;  1F66 A;  1WWS A;  4E44 A;  2HUE C;  4H9S C;  1P3A B;  1F66 D;  1P3B C;  3X1S B;  1BH8 B;  2YFW B;  3NQU A;  1ULY A;  2BYK A;  3W99 C;  3A6N B;  5GT0 B;  3WTP E;  2IO5 C;  1P3L B;  3B0D B;  3LZ1 B;  4NFT A;  5F99 C;  2JSS A;  4J8U C;  4WU9 A;  1P34 C;  5B2I A;  3H0M C;  5B1M A;  3WTP C;  1TZY A;  1M18 C;  3AV1 C;  2NZD A;  2HIO B;  4YM6 D;  4WU9 D;  1S32 B;  5B2I D;  3MGQ C;  5B1M D;  1TZY D;  2NZD D;  1M19 A;  3MNN B;  4WV4 B;  1M19 D;  3VH5 A;  3MVD C;  4J8V C;  2LY8 A;  1R4V A;  4XZQ C;  2JE5 A;  4H9Q A;  3UTA A;  3VH5 T;  3AZG A;  4J8X C;  2CV5 C;  1KX5 C;  2HUE B;  2Y2K A;  1M1A C;  3MGP C;  1P3B B;  1P3F A;  3AZG D;  4QLC D;  1P3F D;  3W99 B;  4DRB A;  4EO5 C;  2Y2P A;  4G92 C;  3REL C;  2IO5 B;  3MGS A;  5F99 B;  1B6W A;  4NE5 A;  4J8U B;  3MGS D;  3X1T C;  5JRG C;  1P34 B;  1M18 B;  3WTP B;  4Z2M G;  3AV1 B;  4DRA A;  5AY8 C;  3MGQ B;  4R8P C;  1KX3 C;  3LEL A;  2ZY3 A;  1HTA A;  3UTB C;  1KU5 A;  2YFV A;  1ID3 A;  1A7W A;  3X1V C;  3LEL D;  4KUD A;  3MVD B;  1ID3 D;  4J8V B;  1EQZ C;  4XZQ B;  4KUD D;  1P3O A;  3AZF C;  5AV9 C;  4J8X B;  2CV5 B;  1KX5 B;  3MGR C;  1M1A B;  3MGP B;  3REH A;  1P3O D;  5CPK C;  1P3G A;  2Y2M A;  3KWQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...