1P3GC

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
104
structure length
104
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
total genus 32
structure length 104
sequence length 104
chains with identical sequence G
ec nomenclature
pdb deposition date 2003-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3gC00
3MGRA 4Z66A 3RELC 3UT9D 3W98B 3KSYA 4CAYB 3AN2A 5CPJA 1B6WA 1ZLAD 3VH6W 5B2IC 3NQJB 3W97D 4EO5B 3AV2C 3MVDA 3X1UA 1P3MD 5BO0A 5CP6B 4J8XD 3LJAD 5AV9C 2BYKA 3MGPD 1TZYC 5AV5C 4X23C 4J8UD 2NQBB 4NFTA 5AVBD 3MNNA 1WWSA 4E45A 3KWQC 4UUZA 5B32C 3KUYA 3TU4B 2HIOC 4KUDD 5CPKA 5GT0C 1P3MA 4H9NA 3C1CC 5B33B 4ZUXD 3UTAA 5B1LA 1ID3A 2FJ7D 3NQJA 5E5AB 1P3OD 2BYMA 3X1UB 2AROD 3C1CD 3LJAB 3AYWA 1P3GD 5CPKD 5B0YB 4AWLB 3WKJA 1BH9A 3AZNA 4J8WB 5GXQC 2YFWA 4Z5TB 5GT3A 2PYOB 4XUJD 5CPKB 3O62C 4XZQA 5AV6D 3LELC 1M19C 5BS7C 4G91B 1N1JA 3R45B 3X1UD 1P34C 3C1BC 3AN2C 3B6GC 5B31C 3VH5A 4R8PC 4JJNB 5CPJC 3AZID 5AV9D 3REJD 3KXBC 3LJAA 3AYWB 4ZBJC 2HUEB 5FUGA 1HQ3C 5BO0B 5CP6A 1S32B 1S32C 3AZJA 3UTBD 1P3GB 2HUEC 2CV5D 1P3KB 4ZBJB 3KXBB 3REID 5AVCD 3VH6T 4CAYA 5B0ZD 4JJNC 4R8PB 5CPJB 1BH8B 2FJ7B 3MVDC 5B31B 3B0CW 1Q9CA 2RVQD 3B6GB 3C1BB 4QLCA 3REJA 1P34B 4G91C 1F66C 4H9NB 1P3BD 3VH5T 3AZLC 1M19B 1EQZD 3B6FA 3WAAB 3O62B 3REIC 4E44A 3LZ1B 3AZLA 4Z5TC 1ULYA 5GXQB 4J8WC 1H3OB 1A7WA 5AV6A 4XZQD 4WU8C 4AWLC 4XUJA 5B0YC 5GT3D 3B6FD 3B0CT 5BNXA 5JA4B 3X1UC 1JFIB 3X1VA 5DNMC 3VH6A 1M1AB 1P3IB 3AZHD 2BYMB 1P34A 3LELA 4J8VA 3REHA 5AVBB 3AZIA 4WNNA 3TU4C 1ID3D 5CPIC 4ZUXA 3UTAD 2F8NA 3KWQB 5CP6D 3C1BA 1HQ3A 5BT1D 4CSRB 2PYOA 3WA9A 1TZYB 4X23B 2F8NG 2NQBC 4YS3A 1P3OC 4YM6C 4H9SC 5CP6C 3AV1D 1TZYD 5B31G 4X23D 5AV8A 3B6GD 3UTAC 3AZND 5B2IB 5B1MB 3MGQD 3W98C 4LD9B 1ZLAC 5BNVB 4H9RB 3RELB 5B24A 2F8NB 3WTPD 1KX3B 5AV5D 4H9PA 5JRGC 5F99B 3AZNC 3REKC 1P3BB 3A6ND 4XZQC 3MNNC 3KWQA 5GT0A 5B40C 5GT3C 4Z66D 5B32A 3MGQA 3X1VD 5B31A 3B0DC 1P3FC 3AV2D 5B1LC 3AZGA 5B24D 4WU9B 3KXBA 5CPIA 4Z66C 4J8XA 3MGSD 1S32D 3O62A 3AZHB 2F8NK 3AZKB 2F8ND 1P3AB 2IO5C 3AZIB 3AV2A 1P3BA 3AFAC 4KUDC 1M19A 5B31D 3KUYC 4G92C 1KX5B 3AZMB 2AROB 5AVCB 1AOIA 5AY8A 1KU5A 3REJC 3X1TC 3X1VB 1KX5D 4CSRA 5AV6B 4YS3B 5C3IB 4Z5TD 3AN2D 5B1LD 3AZJD 4HGAC 1M1AA 3MGSC 5B1MA 3C1BD 3AZHA 4JJND 1M18C 1F66A 1WWIA 4LD9D 4QLCC 5B40D 3REHB 1P3LA 3AZFC 4XUJC 5B0YA 1KX4B 5DNNB 1P3MB 5F99A 3MGPA 4J8UA 1U35B 4J8WA 4QLCD 5AV8B 2PYOD 3W97B 1M1AD 4UUZB 3AZEC 3B6FC 1BH9B 5B0YD 3AV1C 1P3FA 3W96B 5B24B 4WU9D 1ID3B 5BS7A 3LZ0C 3X1SA 2JSSA 3NQUB 1EQZC 1N1JB 1M19D 1EQZB 5BNVA 4KUDA 2CV5A 3W96C 1KX5A 2HIOD 4KHAA 5DNMD 3RELD 4NE6A 5B0ZB 3AZED 5B2JD 4YM6A 5AY8C 1BH8A 3AZEB 3UTBB 3R45A 5B2ID 3W97C 5B40A 5AV8C 4DRBA 3AFAA 1P3AA 3WAAD 1P3MC 3AZJB 4JJNA 1AOIC 2HIOA 3AZFB 5GSUA 2YFVA 2NZDC 4QLCB 5FUGB 5JRGA 3A6NC 3WA9C 4WZSB 2FJ7A 1HTAA 4WV4B 4HGAB 3WKJD 3MGPB 3LELD 4J8UB 1U35A 1AOID 4J8XC 1P3AD 3WAAA 3MGQC 5C3IC 1P3FD 3AFAD 5AV6C 1P3PB 3WKJC 3WA9D 3AZGC 3MGRB 3X1VC 3X1TB 1P3ID 3REJB 3UT9C 3AZMC 5BNXB 1JFIA 1P3LB 5GSUB 1HQ3D 1F1EA 2IO5B 3AZIC 3KXBD 4ZUXC 1H3OA 5AVBA 3MNND 3AZGD 2CV5C 1P3IA 1TZYA 4X23A 1EQZA 1P3LD 3W99B 4KGCB 3WTPE 1KX4A 5B2JC 4Z66B 5DNNA 4J8VC 3MGRD 3W98A 4WU9C 3AYWD 5B1LB 5JA4A 3WTPB 3W96A 3LZ0A 3X1SC 4KHAB 1P3FB 1P3PD 1KX3D 3B0DB 3X1SB 3WTPC 1P3OA 4J8VB 5CPJD 1B67A 3UTBA 5B2JB 1BFMA 4KGCC 5B40B 3REHD 5E5AD 5GSUD 4J8VD 5KDMB 2NQBA 3W99C 5F99C 3AZNB 5B33D 4ZUXB 2CV5B 3X1SD 1KX3C 1M18A 2YFVB 3NQUA 1ZLAB 5GSUC 2NZDA 4LD9C 4NE3A 3AV1A 1P3LC 3UT9B 4LD9A 5B1MC 4YS3D 4H9OA 1F66D 5BT1C 4H9RA 3MGRC 3RELA 5B33A 2YFWB 3UTAB 3AZGB 3WKJB 3MGSA 2NQBD 1P3PC 5E5AA 3MGQB 4J8XB 4YM6B 1P3OB 3V9RA 4WU8A 3MGPC 5G49A 4J8UC 5KDMA 3AZFD 1M18D 3A6NB 4H9PB 5CPIB 1P3GA 3WA9B 5B32D 5DNND 4Z2MG 4WU9A 5GT0D 2NZDB 5AVBC 3KWQD 5AVCA 1AOIB 1KX4D 3AZJC 5JRGD 4H9OB 1P3IC 2CWEA 1M1AC 5DNMB 3X1TA 3UTBC 3LZ1D 3AZKA 1R4VA 1S32A 5AY8B 3KUYD 5AV9A 5B0ZC 4WU8B 2LY8A 5AV8D 3B6GA 1TAFB 4R8PA 3W99A 5B2JA 4YM6D 3LZ1C 3REIB 5CHLB 4KGCA 3WAAC 2L5AA 3LZ1A 3REKD 3AZLB 3C1CA 2AROA 1F66B 5GXQA 3W97A 3WTPA 3LZ0B 1ZLAA 1ID3C 5B24C 3MVDB 2FJ7C 3AV1B 1P34D 5AY8D 4KGCD 3W98D 3VH5W 2BYKB 1U35D 1P3KC 3B6FB 3W99D 1P3GC 5B32G 4R8PD 1HQ3B 1U35C 1P3KD 5GXQD 5DNNC 4H9QA 3AYWC 1KX4C 4XUJB 3O62D 3REHC 5CPID 4J8WD 5F99D 3AN2B 1M18B 5B2IA 3MGSB 4H9SA 3LELB 5CPKC 3UT9A 5G49B 2PYOC 4Z2MH 4YS3C 4WNNB 5B0ZA 4M6BA 3A6NA 5AV5A 5AVCC 3V9RB 2AROC 4WU8D 4H9QB 3LJAC 4DRAA 4G92B 1KX5C 3KUYB 3TU4A 4KUDB 3AFAB 3REKA 3LZ0D 1KX3A 1P3AC 5E5AC 3AZKC 5B33C 3AZFA 3AZHC 3AZLD 3C1CB 3AZMD 4NE5A 5GT0B 2NZDD 2HIOB 5B32B 3AZEA 5DNMA 3AZKD 3X1TD 3B0BA 3MVDD 3TU4D 5AV5B 1P3KA 3REIA 5AV9B 3AZMA 4Z5TA 5GT3B 3MNNB 4XZQB 2F8NH 1TAFA 3REKB 1P3BC 2RVQC 5JRGB 4EO5C 3AV2B 1P3PA 3W96D 5B1MD
chains in the Genus database with same CATH superfamily
3MGRA 4Z66A 3RELC 3UT9D 3W98B 3KSYA 4CAYB 3AN2A 5CPJA 1B6WA 1ZLAD 3VH6W 5B2IC 3NQJB 3W97D 4EO5B 3AV2C 3MVDA 3X1UA 1P3MD 2DF4C 5BO0A 5CP6B 4J8XD 3LJAD 5AV9C 2BYKA 3MGPD 1TZYC 5AV5C 4X23C 4J8UD 2NQBB 4NFTA 5AVBD 3MNNA 1WWSA 4E45A 3KWQC 4UUZA 3H0RC 5B32C 3KUYA 3TU4B 2HIOC 4KUDD 5CPKA 5GT0C 1P3MA 4H9NA 3C1CC 5B33B 4ZUXD 3UTAA 5B1LA 1ID3A 2FJ7D 3NQJA 5E5AB 1P3OD 2BYMA 3X1UB 2AROD 3C1CD 2F2AC 3LJAB 3AYWA 1P3GD 5CPKD 5B0YB 4AWLB 3WKJA 1BH9A 3AZNA 4J8WB 2J8PA 5GXQC 2YFWA 4Z5TB 5GT3A 2PYOB 4XUJD 5CPKB 3O62C 4XZQA 5AV6D 3LELC 1M19C 2Y2KA 3KFUG 5BS7C 4G91B 1N1JA 3R45B 3X1UD 1P34C 2ZY5A 3C1BC 3AN2C 3B6GC 5B31C 3VH5A 4R8PC 4JJNB 5CPJC 3AZID 5AV9D 3REJD 3KXBC 3LJAA 3AYWB 4ZBJC 2Y2MA 2HUEB 5FUGA 1HQ3C 5BO0B 5CP6A 1S32B 1S32C 2ZY4A 3AZJA 3UTBD 1P3GB 2HUEC 2CV5D 1P3KB 4ZBJB 3KXBB 3REID 5AVCD 3VH6T 4CAYA 5B0ZD 4JJNC 4R8PB 5CPJB 1BH8B 2FJ7B 3MVDC 5B31B 3B0CW 1Q9CA 2RVQD 3B6GB 2XD5A 3C1BB 4QLCA 3REJA 1P34B 4G91C 1F66C 1Z2CB 4H9NB 1P3BD 3VH5T 3AZLC 1M19B 2JE5A 1EQZD 3B6FA 3O62B 3REIC 3WAAB 4E44A 3LZ1B 3AZLA 4Z5TC 1ULYA 5GXQB 4J8WC 1H3OB 1A7WA 5AV6A 4XZQD 4WU8C 4AWLC 2W8SA 4XUJA 5B0YC 4UPKA 5GT3D 3B6FD 3B0CT 5BNXA 5JA4B 3X1UC 1JFIB 3X1VA 5DNMC 3VH6A 1M1AB 1P3IB 3AZHD 2BYMB 3EPKA 1P34A 3LELA 4J8VA 3REHA 5AVBB 3AZIA 2Y2OA 4WNNA 3TU4C 1ID3D 5CPIC 4ZUXA 2FFFB 3UTAD 2F8NA 3KWQB 5CP6D 3C1BA 1HQ3A 5BT1D 2G5IC 4CSRB 2PYOA 3WA9A 1TZYB 4X23B 2F8NG 2NQBC 4YS3A 4WJ3C 1P3OC 4YM6C 4H9SC 5CP6C 3AV1D 1TZYD 5B31G 4X23D 5AV8A 3B6GD 3UTAC 3AZND 3EPHA 5B2IB 2BG1A 2DQNC 5B1MB 3MGQD 3W98C 4LD9B 1ZLAC 5BNVB 4H9RB 3RELB 5B24A 2UWXA 3WTPD 1KX3B 5AV5D 4H9PA 5JRGC 5F99B 3AZNC 3REKC 1P3BB 3A6ND 4XZQC 3MNNC 3KWQA 5GT0A 5B40C 5GT3C 4Z66D 5B32A 3MGQA 3X1VD 5B31A 3B0DC 3EPLA 1P3FC 3AV2D 5B1LC 2Y2PA 5B24D 3AZGA 4WU9B 2ZY2A 3KXBA 2Y2LA 4Z66C 5CPIA 4J8XA 3MGSD 1S32D 3O62A 2XD1A 3AZHB 2F8NK 3AZKB 2F8ND 1P3AB 2IO5C 3AZIB 3AV2A 1P3BA 3AFAC 4KUDC 1M19A 5B31D 3KUYC 2F8NB 4G92C 1KX5B 3AZMB 2AROB 5AVCB 1AOIA 5AY8A 1KU5A 3REJC 3X1TC 3X1VB 1KX5D 4CSRA 5AV6B 4YS3B 5C3IB 4Z5TD 3AN2D 5B1LD 1PZRA 3AZJD 4HGAC 1M1AA 3MGSC 5B1MA 3C1BD 3H0LC 3AZHA 4JJND 1M18C 1F66A 1WWIA 4LD9D 4QLCC 5B40D 3REHB 1P3LA 3AZFC 4XUJC 5B0YA 1KX4B 5DNNB 1P3MB 5F99A 3MGPA 4J8UA 1U35B 4J8WA 4QLCD 5AV8B 2PYOD 3W97B 1M1AD 4UUZB 3AZEC 3B6FC 1BH9B 3IP4C 5B0YD 3AV1C 1P3FA 3W96B 5B24B 4WU9D 1ID3B 5BS7A 3X1SA 3LZ0C 2JSSA 3NQUB 1EQZC 1N1JB 1M19D 1EQZB 5BNVA 4KUDA 2CV5A 2Y2GA 3W96C 1KX5A 2HIOD 4KHAA 5DNMD 3RELD 4NE6A 5B0ZB 3AZED 5B2JD 4YM6A 5AY8C 1BH8A 3EPJA 3AZEB 3UTBB 3R45A 5B2ID 3W97C 5B40A 5AV8C 4DRBA 3AFAA 1P3AA 3WAAD 1P3MC 3AZJB 4JJNA 1AOIC 2HIOA 3AZFB 5GSUA 2YFVA 2NZDC 4QLCB 5FUGB 5JRGA 3A6NC 3WA9C 4WZSB 2FJ7A 1HTAA 4WV4B 4HGAB 3WKJD 3MGPB 3LELD 4J8UB 1U35A 1AOID 4J8XC 1P3AD 3WAAA 3MGQC 5C3IC 1P3FD 3AFAD 5AV6C 1P3PB 3WKJC 3WA9D 3AZGC 3MGRB 3X1VC 3X1TB 1P3ID 3REJB 3EG5B 3UT9C 3AZMC 5BNXB 1JFIA 1P3LB 3F6TA 5GSUB 1HQ3D 1F1EA 2IO5B 2Y2QA 3AZIC 3KXBD 4ZUXC 1H3OA 5AVBA 3MNND 3AZGD 2CV5C 1P3IA 1TZYA 4X23A 1EQZA 1P3LD 3W99B 2Y2NA 4KGCB 3WTPE 1KX4A 5B2JC 4Z66B 5DNNA 4J8VC 3MGRD 3W98A 2JCHA 4WU9C 3AYWD 5B1LB 5JA4A 3WTPB 3W96A 3LZ0A 3X1SC 4KHAB 1P3FB 1P3PD 1KX3D 3B0DB 3X1SB 3WTPC 1P3OA 4J8VB 5CPJD 1B67A 3UTBA 5B2JB 1BFMA 4KGCC 5B40B 3REHD 5E5AD 5GSUD 3H0MC 5KDMB 4J8VD 2NQBA 3W99C 5F99C 3AZNB 5B33D 4ZUXB 2CV5B 3X1SD 1KX3C 1M18A 3A1KA 2YFVB 3NQUA 1ZLAB 5GSUC 2NZDA 4LD9C 4NE3A 3AV1A 1P3LC 3UT9B 4LD9A 5B1MC 4YS3D 4H9OA 1F66D 5BT1C 4H9RA 3MGRC 3RELA 5B33A 2YFWB 3UTAB 3AZGB 3WKJB 3MGSA 2NQBD 1P3PC 5E5AA 3MGQB 2RIQA 4J8XB 4YM6B 1P3OB 3V9RA 4WU8A 3MGPC 5G49A 4J8UC 5KDMA 3AZFD 1M18D 3A1IA 3A6NB 4H9PB 5CPIB 1P3GA 3WA9B 5B32D 5DNND 4Z2MG 4WU9A 5GT0D 2NZDB 5AVBC 3KWQD 5AVCA 1AOIB 1KX4D 3AZJC 5JRGD 2VQRA 4H9OB 1P3IC 2CWEA 2Y2IA 1M1AC 5DNMB 3X1TA 3UTBC 3LZ1D 3AZKA 1R4VA 1S32A 5AY8B 3KUYD 5AV9A 5B0ZC 4WU8B 2LY8A 5AV8D 3B6GA 1TAFB 4R8PA 3W99A 5B2JA 4YM6D 3LZ1C 3REIB 5CHLB 4KGCA 3WAAC 2L5AA 3LZ1A 3REKD 3AZLB 3C1CA 2AROA 1F66B 5GXQA 2ZY3A 3W97A 3WTPA 3LZ0B 1ZLAA 1ID3C 5B24C 3MVDB 2FJ7C 3AV1B 1P34D 5AY8D 4KGCD 3W98D 3VH5W 2BYKB 1U35D 1P3KC 3B6FB 3W99D 1P3GC 5B32G 4R8PD 2Y2JA 1HQ3B 2G5HC 1U35C 1P3KD 5GXQD 5DNNC 4H9QA 3AYWC 1KX4C 2Y2HA 4XUJB 3O62D 1T3UA 3REHC 5CPID 4J8WD 5F99D 3AN2B 1M18B 5B2IA 3MGSB 4H9SA 3LELB 3FDDA 5CPKC 3UT9A 5G49B 2PYOC 4Z2MH 4YS3C 4WNNB 5B0ZA 4M6BA 3A6NA 5AV5A 5AVCC 3V9RB 2AROC 4WU8D 4H9QB 3LJAC 4DRAA 4G92B 1KX5C 3KUYB 3TU4A 4KUDB 3AFAB 3REKA 3LZ0D 1KX3A 1P3AC 5E5AC 3AZKC 5B33C 3AZFA 3AZHC 3AZLD 3C1CB 3AZMD 4NE5A 5GT0B 2NZDD 2HIOB 2ZM5A 5B32B 3AZEA 5DNMA 3AZKD 3X1TD 3B0BA 3MVDD 3TU4D 5AV5B 4DQYB 1P3KA 3REIA 5AV9B 3AZMA 4Z5TA 5GT3B 3P5JB 3MNNB 4XZQB 2F8NH 1TAFA 3REKB 1P3BC 2RVQC 5JRGB 4EO5C 3AV2B 1P3PA 3W96D 1W2EA 3AL0C 5B1MD
chains in the Genus database with same CATH topology
3MGRA 4Z66A 3RELC 3UT9D 3W98B 3KSYA 4CAYB 3AN2A 5CPJA 1B6WA 1ZLAD 3VH6W 5B2IC 3NQJB 3W97D 4EO5B 3AV2C 3MVDA 3X1UA 1P3MD 2DF4C 5BO0A 5CP6B 4J8XD 3LJAD 5AV9C 2BYKA 3MGPD 1TZYC 5AV5C 4X23C 4J8UD 2NQBB 4NFTA 5AVBD 3MNNA 1WWSA 4E45A 3KWQC 4UUZA 3H0RC 5B32C 3KUYA 3TU4B 2HIOC 4KUDD 5CPKA 5GT0C 1P3MA 4H9NA 3C1CC 5B33B 4ZUXD 3UTAA 5B1LA 1ID3A 2FJ7D 3NQJA 5E5AB 1P3OD 2BYMA 3X1UB 2AROD 3C1CD 2F2AC 3LJAB 3AYWA 1P3GD 5CPKD 5B0YB 4AWLB 3WKJA 1BH9A 3AZNA 4J8WB 2J8PA 5GXQC 2YFWA 4Z5TB 5GT3A 2PYOB 4XUJD 5CPKB 3O62C 4XZQA 5AV6D 3LELC 1M19C 2Y2KA 3KFUG 5BS7C 4G91B 1N1JA 3R45B 3X1UD 1P34C 2ZY5A 3C1BC 3AN2C 3B6GC 5B31C 3VH5A 4R8PC 4JJNB 5CPJC 3AZID 5AV9D 3REJD 3KXBC 3LJAA 3AYWB 4ZBJC 2Y2MA 2HUEB 5FUGA 1HQ3C 5BO0B 5CP6A 1S32B 1S32C 2ZY4A 3AZJA 3UTBD 1P3GB 2HUEC 2CV5D 1P3KB 4ZBJB 3KXBB 3REID 5AVCD 3VH6T 4CAYA 5B0ZD 4JJNC 4R8PB 5CPJB 1BH8B 2FJ7B 3MVDC 5B31B 3B0CW 1Q9CA 2RVQD 3B6GB 2XD5A 3C1BB 4QLCA 3REJA 1P34B 4G91C 1F66C 1Z2CB 4H9NB 1P3BD 3VH5T 3AZLC 1M19B 2JE5A 1EQZD 3B6FA 3O62B 3REIC 3WAAB 4E44A 3LZ1B 3AZLA 4Z5TC 1ULYA 5GXQB 4J8WC 1H3OB 1A7WA 5AV6A 4XZQD 4WU8C 4AWLC 2W8SA 4XUJA 5B0YC 4UPKA 5GT3D 3B6FD 3B0CT 5BNXA 5JA4B 3X1UC 1JFIB 3X1VA 5DNMC 3VH6A 1M1AB 1P3IB 3AZHD 2BYMB 3EPKA 1P34A 3LELA 4J8VA 3REHA 5AVBB 3AZIA 2Y2OA 4WNNA 3TU4C 1ID3D 5CPIC 4ZUXA 2FFFB 3UTAD 2F8NA 3KWQB 5CP6D 3C1BA 1HQ3A 5BT1D 2G5IC 4CSRB 2PYOA 3WA9A 1TZYB 4X23B 2F8NG 2NQBC 4YS3A 4WJ3C 1P3OC 4YM6C 4H9SC 5CP6C 3AV1D 1TZYD 5B31G 4X23D 5AV8A 3B6GD 3UTAC 3AZND 3EPHA 5B2IB 2BG1A 2DQNC 5B1MB 3MGQD 3W98C 4LD9B 1ZLAC 5BNVB 4H9RB 3RELB 5B24A 2UWXA 3WTPD 1KX3B 5AV5D 4H9PA 5JRGC 5F99B 3AZNC 3REKC 1P3BB 3A6ND 4XZQC 3MNNC 3KWQA 5GT0A 5B40C 5GT3C 4Z66D 5B32A 3MGQA 3X1VD 5B31A 3B0DC 3EPLA 1P3FC 3AV2D 5B1LC 2Y2PA 5B24D 3AZGA 4WU9B 2ZY2A 3KXBA 2Y2LA 4Z66C 5CPIA 4J8XA 3MGSD 1S32D 3O62A 2XD1A 3AZHB 2F8NK 3AZKB 2F8ND 1P3AB 2IO5C 3AZIB 3AV2A 1P3BA 3AFAC 4KUDC 1M19A 5B31D 3KUYC 2F8NB 4G92C 1KX5B 3AZMB 2AROB 5AVCB 1AOIA 5AY8A 1KU5A 3REJC 3X1TC 3X1VB 1KX5D 4CSRA 5AV6B 4YS3B 5C3IB 4Z5TD 3AN2D 5B1LD 1PZRA 3AZJD 4HGAC 1M1AA 3MGSC 5B1MA 3C1BD 3H0LC 3AZHA 4JJND 1M18C 1F66A 1WWIA 4LD9D 4QLCC 5B40D 3REHB 1P3LA 3AZFC 4XUJC 5B0YA 1KX4B 5DNNB 1P3MB 5F99A 3MGPA 4J8UA 1U35B 4J8WA 4QLCD 5AV8B 2PYOD 3W97B 1M1AD 4UUZB 3AZEC 3B6FC 1BH9B 3IP4C 5B0YD 3AV1C 1P3FA 3W96B 5B24B 4WU9D 1ID3B 5BS7A 3X1SA 3LZ0C 2JSSA 3NQUB 1EQZC 1N1JB 1M19D 1EQZB 5BNVA 4KUDA 2CV5A 2Y2GA 3W96C 1KX5A 2HIOD 4KHAA 5DNMD 3RELD 4NE6A 5B0ZB 3AZED 5B2JD 4YM6A 5AY8C 1BH8A 3EPJA 3AZEB 3UTBB 3R45A 5B2ID 3W97C 5B40A 5AV8C 4DRBA 3AFAA 1P3AA 3WAAD 1P3MC 3AZJB 4JJNA 1AOIC 2HIOA 3AZFB 5GSUA 2YFVA 2NZDC 4QLCB 5FUGB 5JRGA 3A6NC 3WA9C 4WZSB 2FJ7A 1HTAA 4WV4B 4HGAB 3WKJD 3MGPB 3LELD 4J8UB 1U35A 1AOID 4J8XC 1P3AD 3WAAA 3MGQC 5C3IC 1P3FD 3AFAD 5AV6C 1P3PB 3WKJC 3WA9D 3AZGC 3MGRB 3X1VC 3X1TB 1P3ID 3REJB 3EG5B 3UT9C 3AZMC 5BNXB 1JFIA 1P3LB 3F6TA 5GSUB 1HQ3D 1F1EA 2IO5B 2Y2QA 3AZIC 3KXBD 4ZUXC 1H3OA 5AVBA 3MNND 3AZGD 2CV5C 1P3IA 1TZYA 4X23A 1EQZA 1P3LD 3W99B 2Y2NA 4KGCB 3WTPE 1KX4A 5B2JC 4Z66B 5DNNA 4J8VC 3MGRD 3W98A 2JCHA 4WU9C 3AYWD 5B1LB 5JA4A 3WTPB 3W96A 3LZ0A 3X1SC 4KHAB 1P3FB 1P3PD 1KX3D 3B0DB 3X1SB 3WTPC 1P3OA 4J8VB 5CPJD 1B67A 3UTBA 5B2JB 1BFMA 4KGCC 5B40B 3REHD 5E5AD 5GSUD 3H0MC 5KDMB 4J8VD 2NQBA 3W99C 5F99C 3AZNB 5B33D 4ZUXB 2CV5B 3X1SD 1KX3C 1M18A 3A1KA 2YFVB 3NQUA 1ZLAB 5GSUC 2NZDA 4LD9C 4NE3A 3AV1A 1P3LC 3UT9B 4LD9A 5B1MC 4YS3D 4H9OA 1F66D 5BT1C 4H9RA 3MGRC 3RELA 5B33A 2YFWB 3UTAB 3AZGB 3WKJB 3MGSA 2NQBD 1P3PC 5E5AA 3MGQB 2RIQA 4J8XB 4YM6B 1P3OB 3V9RA 4WU8A 3MGPC 5G49A 4J8UC 5KDMA 3AZFD 1M18D 3A1IA 3A6NB 4H9PB 5CPIB 1P3GA 3WA9B 5B32D 5DNND 4Z2MG 4WU9A 5GT0D 2NZDB 5AVBC 3KWQD 5AVCA 1AOIB 1KX4D 3AZJC 5JRGD 2VQRA 4H9OB 1P3IC 2CWEA 2Y2IA 1M1AC 5DNMB 3X1TA 3UTBC 3LZ1D 3AZKA 1R4VA 1S32A 5AY8B 3KUYD 5AV9A 5B0ZC 4WU8B 2LY8A 5AV8D 3B6GA 1TAFB 4R8PA 3W99A 5B2JA 4YM6D 3LZ1C 3REIB 5CHLB 4KGCA 3WAAC 2L5AA 3LZ1A 3REKD 3AZLB 3C1CA 2AROA 1F66B 5GXQA 2ZY3A 3W97A 3WTPA 3LZ0B 1ZLAA 1ID3C 5B24C 3MVDB 2FJ7C 3AV1B 1P34D 5AY8D 4KGCD 3W98D 3VH5W 2BYKB 1U35D 1P3KC 3B6FB 3W99D 1P3GC 5B32G 4R8PD 2Y2JA 1HQ3B 2G5HC 1U35C 1P3KD 5GXQD 5DNNC 4H9QA 3AYWC 1KX4C 2Y2HA 4XUJB 3O62D 1T3UA 3REHC 5CPID 4J8WD 5F99D 3AN2B 1M18B 5B2IA 3MGSB 4H9SA 3LELB 3FDDA 5CPKC 3UT9A 5G49B 2PYOC 4Z2MH 4YS3C 4WNNB 5B0ZA 4M6BA 3A6NA 5AV5A 5AVCC 3V9RB 2AROC 4WU8D 4H9QB 3LJAC 4DRAA 4G92B 1KX5C 3KUYB 3TU4A 4KUDB 3AFAB 3REKA 3LZ0D 1KX3A 1P3AC 5E5AC 3AZKC 5B33C 3AZFA 3AZHC 3AZLD 3C1CB 3AZMD 4NE5A 5GT0B 2NZDD 2HIOB 2ZM5A 5B32B 3AZEA 5DNMA 3AZKD 3X1TD 3B0BA 3MVDD 3TU4D 5AV5B 4DQYB 1P3KA 3REIA 5AV9B 3AZMA 4Z5TA 5GT3B 3P5JB 3MNNB 4XZQB 2F8NH 1TAFA 3REKB 1P3BC 2RVQC 5JRGB 4EO5C 3AV2B 1P3PA 3W96D 1W2EA 3AL0C 5B1MD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MGR A;  4Z66 A;  3REL C;  3UT9 D;  3W98 B;  3KSY A;  4CAY B;  3AN2 A;  5CPJ A;  1B6W A;  1ZLA D;  3VH6 W;  5B2I C;  3NQJ B;  3W97 D;  4EO5 B;  3AV2 C;  3MVD A;  3X1U A;  1P3M D;  5BO0 A;  5CP6 B;  4J8X D;  3LJA D;  5AV9 C;  2BYK A;  3MGP D;  1TZY C;  5AV5 C;  4X23 C;  4J8U D;  2NQB B;  4NFT A;  5AVB D;  3MNN A;  1WWS A;  4E45 A;  3KWQ C;  4UUZ A;  5B32 C;  3KUY A;  3TU4 B;  2HIO C;  4KUD D;  5CPK A;  5GT0 C;  1P3M A;  4H9N A;  3C1C C;  5B33 B;  4ZUX D;  3UTA A;  5B1L A;  1ID3 A;  2FJ7 D;  3NQJ A;  5E5A B;  1P3O D;  2BYM A;  3X1U B;  2ARO D;  3C1C D;  3LJA B;  3AYW A;  1P3G D;  5CPK D;  5B0Y B;  4AWL B;  3WKJ A;  1BH9 A;  3AZN A;  4J8W B;  5GXQ C;  2YFW A;  4Z5T B;  5GT3 A;  2PYO B;  4XUJ D;  5CPK B;  3O62 C;  4XZQ A;  5AV6 D;  3LEL C;  1M19 C;  5BS7 C;  4G91 B;  1N1J A;  3R45 B;  3X1U D;  1P34 C;  3C1B C;  3AN2 C;  3B6G C;  5B31 C;  3VH5 A;  4R8P C;  4JJN B;  5CPJ C;  3AZI D;  5AV9 D;  3REJ D;  3KXB C;  3LJA A;  3AYW B;  4ZBJ C;  2HUE B;  5FUG A;  1HQ3 C;  5BO0 B;  5CP6 A;  1S32 B;  1S32 C;  3AZJ A;  3UTB D;  1P3G B;  2HUE C;  2CV5 D;  1P3K B;  4ZBJ B;  3KXB B;  3REI D;  5AVC D;  3VH6 T;  4CAY A;  5B0Z D;  4JJN C;  4R8P B;  5CPJ B;  1BH8 B;  2FJ7 B;  3MVD C;  5B31 B;  3B0C W;  1Q9C A;  2RVQ D;  3B6G B;  3C1B B;  4QLC A;  3REJ A;  1P34 B;  4G91 C;  1F66 C;  4H9N B;  1P3B D;  3VH5 T;  3AZL C;  1M19 B;  1EQZ D;  3B6F A;  3WAA B;  3O62 B;  3REI C;  4E44 A;  3LZ1 B;  3AZL A;  4Z5T C;  1ULY A;  5GXQ B;  4J8W C;  1H3O B;  1A7W A;  5AV6 A;  4XZQ D;  4WU8 C;  4AWL C;  4XUJ A;  5B0Y C;  5GT3 D;  3B6F D;  3B0C T;  5BNX A;  5JA4 B;  3X1U C;  1JFI B;  3X1V A;  5DNM C;  3VH6 A;  1M1A B;  1P3I B;  3AZH D;  2BYM B;  1P34 A;  3LEL A;  4J8V A;  3REH A;  5AVB B;  3AZI A;  4WNN A;  3TU4 C;  1ID3 D;  5CPI C;  4ZUX A;  3UTA D;  2F8N A;  3KWQ B;  5CP6 D;  3C1B A;  1HQ3 A;  5BT1 D;  4CSR B;  2PYO A;  3WA9 A;  1TZY B;  4X23 B;  2F8N G;  2NQB C;  4YS3 A;  1P3O C;  4YM6 C;  4H9S C;  5CP6 C;  3AV1 D;  1TZY D;  5B31 G;  4X23 D;  5AV8 A;  3B6G D;  3UTA C;  3AZN D;  5B2I B;  5B1M B;  3MGQ D;  3W98 C;  4LD9 B;  1ZLA C;  5BNV B;  4H9R B;  3REL B;  5B24 A;  2F8N B;  3WTP D;  1KX3 B;  5AV5 D;  4H9P A;  5JRG C;  5F99 B;  3AZN C;  3REK C;  1P3B B;  3A6N D;  4XZQ C;  3MNN C;  3KWQ A;  5GT0 A;  5B40 C;  5GT3 C;  4Z66 D;  5B32 A;  3MGQ A;  3X1V D;  5B31 A;  3B0D C;  1P3F C;  3AV2 D;  5B1L C;  3AZG A;  5B24 D;  4WU9 B;  3KXB A;  5CPI A;  4Z66 C;  4J8X A;  3MGS D;  1S32 D;  3O62 A;  3AZH B;  2F8N K;  3AZK B;  2F8N D;  1P3A B;  2IO5 C;  3AZI B;  3AV2 A;  1P3B A;  3AFA C;  4KUD C;  1M19 A;  5B31 D;  3KUY C;  4G92 C;  1KX5 B;  3AZM B;  2ARO B;  5AVC B;  1AOI A;  5AY8 A;  1KU5 A;  3REJ C;  3X1T C;  3X1V B;  1KX5 D;  4CSR A;  5AV6 B;  4YS3 B;  5C3I B;  4Z5T D;  3AN2 D;  5B1L D;  3AZJ D;  4HGA C;  1M1A A;  3MGS C;  5B1M A;  3C1B D;  3AZH A;  4JJN D;  1M18 C;  1F66 A;  1WWI A;  4LD9 D;  4QLC C;  5B40 D;  3REH B;  1P3L A;  3AZF C;  4XUJ C;  5B0Y A;  1KX4 B;  5DNN B;  1P3M B;  5F99 A;  3MGP A;  4J8U A;  1U35 B;  4J8W A;  4QLC D;  5AV8 B;  2PYO D;  3W97 B;  1M1A D;  4UUZ B;  3AZE C;  3B6F C;  1BH9 B;  5B0Y D;  3AV1 C;  1P3F A;  3W96 B;  5B24 B;  4WU9 D;  1ID3 B;  5BS7 A;  3LZ0 C;  3X1S A;  2JSS A;  3NQU B;  1EQZ C;  1N1J B;  1M19 D;  1EQZ B;  5BNV A;  4KUD A;  2CV5 A;  3W96 C;  1KX5 A;  2HIO D;  4KHA A;  5DNM D;  3REL D;  4NE6 A;  5B0Z B;  3AZE D;  5B2J D;  4YM6 A;  5AY8 C;  1BH8 A;  3AZE B;  3UTB B;  3R45 A;  5B2I D;  3W97 C;  5B40 A;  5AV8 C;  4DRB A;  3AFA A;  1P3A A;  3WAA D;  1P3M C;  3AZJ B;  4JJN A;  1AOI C;  2HIO A;  3AZF B;  5GSU A;  2YFV A;  2NZD C;  4QLC B;  5FUG B;  5JRG A;  3A6N C;  3WA9 C;  4WZS B;  2FJ7 A;  1HTA A;  4WV4 B;  4HGA B;  3WKJ D;  3MGP B;  3LEL D;  4J8U B;  1U35 A;  1AOI D;  4J8X C;  1P3A D;  3WAA A;  3MGQ C;  5C3I C;  1P3F D;  3AFA D;  5AV6 C;  1P3P B;  3WKJ C;  3WA9 D;  3AZG C;  3MGR B;  3X1V C;  3X1T B;  1P3I D;  3REJ B;  3UT9 C;  3AZM C;  5BNX B;  1JFI A;  1P3L B;  5GSU B;  1HQ3 D;  1F1E A;  2IO5 B;  3AZI C;  3KXB D;  4ZUX C;  1H3O A;  5AVB A;  3MNN D;  3AZG D;  2CV5 C;  1P3I A;  1TZY A;  4X23 A;  1EQZ A;  1P3L D;  3W99 B;  4KGC B;  3WTP E;  1KX4 A;  5B2J C;  4Z66 B;  5DNN A;  4J8V C;  3MGR D;  3W98 A;  4WU9 C;  3AYW D;  5B1L B;  5JA4 A;  3WTP B;  3W96 A;  3LZ0 A;  3X1S C;  4KHA B;  1P3F B;  1P3P D;  1KX3 D;  3B0D B;  3X1S B;  3WTP C;  1P3O A;  4J8V B;  5CPJ D;  1B67 A;  3UTB A;  5B2J B;  1BFM A;  4KGC C;  5B40 B;  3REH D;  5E5A D;  5GSU D;  4J8V D;  5KDM B;  2NQB A;  3W99 C;  5F99 C;  3AZN B;  5B33 D;  4ZUX B;  2CV5 B;  3X1S D;  1KX3 C;  1M18 A;  2YFV B;  3NQU A;  1ZLA B;  5GSU C;  2NZD A;  4LD9 C;  4NE3 A;  3AV1 A;  1P3L C;  3UT9 B;  4LD9 A;  5B1M C;  4YS3 D;  4H9O A;  1F66 D;  5BT1 C;  4H9R A;  3MGR C;  3REL A;  5B33 A;  2YFW B;  3UTA B;  3AZG B;  3WKJ B;  3MGS A;  2NQB D;  1P3P C;  5E5A A;  3MGQ B;  4J8X B;  4YM6 B;  1P3O B;  3V9R A;  4WU8 A;  3MGP C;  5G49 A;  4J8U C;  5KDM A;  3AZF D;  1M18 D;  3A6N B;  4H9P B;  5CPI B;  1P3G A;  3WA9 B;  5B32 D;  5DNN D;  4Z2M G;  4WU9 A;  5GT0 D;  2NZD B;  5AVB C;  3KWQ D;  5AVC A;  1AOI B;  1KX4 D;  3AZJ C;  5JRG D;  4H9O B;  1P3I C;  2CWE A;  1M1A C;  5DNM B;  3X1T A;  3UTB C;  3LZ1 D;  3AZK A;  1R4V A;  1S32 A;  5AY8 B;  3KUY D;  5AV9 A;  5B0Z C;  4WU8 B;  2LY8 A;  5AV8 D;  3B6G A;  1TAF B;  4R8P A;  3W99 A;  5B2J A;  4YM6 D;  3LZ1 C;  3REI B;  5CHL B;  4KGC A;  3WAA C;  2L5A A;  3LZ1 A;  3REK D;  3AZL B;  3C1C A;  2ARO A;  1F66 B;  5GXQ A;  3W97 A;  3WTP A;  3LZ0 B;  1ZLA A;  1ID3 C;  5B24 C;  3MVD B;  2FJ7 C;  3AV1 B;  1P34 D;  5AY8 D;  4KGC D;  3W98 D;  3VH5 W;  2BYK B;  1U35 D;  1P3K C;  3B6F B;  3W99 D;  1P3G C;  5B32 G;  4R8P D;  1HQ3 B;  1U35 C;  1P3K D;  5GXQ D;  5DNN C;  4H9Q A;  3AYW C;  1KX4 C;  4XUJ B;  3O62 D;  3REH C;  5CPI D;  4J8W D;  5F99 D;  3AN2 B;  1M18 B;  5B2I A;  3MGS B;  4H9S A;  3LEL B;  5CPK C;  3UT9 A;  5G49 B;  2PYO C;  4Z2M H;  4YS3 C;  4WNN B;  5B0Z A;  4M6B A;  3A6N A;  5AV5 A;  5AVC C;  3V9R B;  2ARO C;  4WU8 D;  4H9Q B;  3LJA C;  4DRA A;  4G92 B;  1KX5 C;  3KUY B;  3TU4 A;  4KUD B;  3AFA B;  3REK A;  3LZ0 D;  1KX3 A;  1P3A C;  5E5A C;  3AZK C;  5B33 C;  3AZF A;  3AZH C;  3AZL D;  3C1C B;  3AZM D;  4NE5 A;  5GT0 B;  2NZD D;  2HIO B;  5B32 B;  3AZE A;  5DNM A;  3AZK D;  3X1T D;  3B0B A;  3MVD D;  3TU4 D;  5AV5 B;  1P3K A;  3REI A;  5AV9 B;  3AZM A;  4Z5T A;  5GT3 B;  3MNN B;  4XZQ B;  2F8N H;  1TAF A;  3REK B;  1P3B C;  2RVQ C;  5JRG B;  4EO5 C;  3AV2 B;  1P3P A;  3W96 D;  5B1M D; 
#chains in the Genus database with same CATH topology
 3MGR A;  4Z66 A;  3REL C;  3UT9 D;  3W98 B;  3KSY A;  4CAY B;  3AN2 A;  5CPJ A;  1B6W A;  1ZLA D;  3VH6 W;  5B2I C;  3NQJ B;  3W97 D;  4EO5 B;  3AV2 C;  3MVD A;  3X1U A;  1P3M D;  2DF4 C;  5BO0 A;  5CP6 B;  4J8X D;  3LJA D;  5AV9 C;  2BYK A;  3MGP D;  1TZY C;  5AV5 C;  4X23 C;  4J8U D;  2NQB B;  4NFT A;  5AVB D;  3MNN A;  1WWS A;  4E45 A;  3KWQ C;  4UUZ A;  3H0R C;  5B32 C;  3KUY A;  3TU4 B;  2HIO C;  4KUD D;  5CPK A;  5GT0 C;  1P3M A;  4H9N A;  3C1C C;  5B33 B;  4ZUX D;  3UTA A;  5B1L A;  1ID3 A;  2FJ7 D;  3NQJ A;  5E5A B;  1P3O D;  2BYM A;  3X1U B;  2ARO D;  3C1C D;  2F2A C;  3LJA B;  3AYW A;  1P3G D;  5CPK D;  5B0Y B;  4AWL B;  3WKJ A;  1BH9 A;  3AZN A;  4J8W B;  2J8P A;  5GXQ C;  2YFW A;  4Z5T B;  5GT3 A;  2PYO B;  4XUJ D;  5CPK B;  3O62 C;  4XZQ A;  5AV6 D;  3LEL C;  1M19 C;  2Y2K A;  3KFU G;  5BS7 C;  4G91 B;  1N1J A;  3R45 B;  3X1U D;  1P34 C;  2ZY5 A;  3C1B C;  3AN2 C;  3B6G C;  5B31 C;  3VH5 A;  4R8P C;  4JJN B;  5CPJ C;  3AZI D;  5AV9 D;  3REJ D;  3KXB C;  3LJA A;  3AYW B;  4ZBJ C;  2Y2M A;  2HUE B;  5FUG A;  1HQ3 C;  5BO0 B;  5CP6 A;  1S32 B;  1S32 C;  2ZY4 A;  3AZJ A;  3UTB D;  1P3G B;  2HUE C;  2CV5 D;  1P3K B;  4ZBJ B;  3KXB B;  3REI D;  5AVC D;  3VH6 T;  4CAY A;  5B0Z D;  4JJN C;  4R8P B;  5CPJ B;  1BH8 B;  2FJ7 B;  3MVD C;  5B31 B;  3B0C W;  1Q9C A;  2RVQ D;  3B6G B;  2XD5 A;  3C1B B;  4QLC A;  3REJ A;  1P34 B;  4G91 C;  1F66 C;  1Z2C B;  4H9N B;  1P3B D;  3VH5 T;  3AZL C;  1M19 B;  2JE5 A;  1EQZ D;  3B6F A;  3O62 B;  3REI C;  3WAA B;  4E44 A;  3LZ1 B;  3AZL A;  4Z5T C;  1ULY A;  5GXQ B;  4J8W C;  1H3O B;  1A7W A;  5AV6 A;  4XZQ D;  4WU8 C;  4AWL C;  2W8S A;  4XUJ A;  5B0Y C;  4UPK A;  5GT3 D;  3B6F D;  3B0C T;  5BNX A;  5JA4 B;  3X1U C;  1JFI B;  3X1V A;  5DNM C;  3VH6 A;  1M1A B;  1P3I B;  3AZH D;  2BYM B;  3EPK A;  1P34 A;  3LEL A;  4J8V A;  3REH A;  5AVB B;  3AZI A;  2Y2O A;  4WNN A;  3TU4 C;  1ID3 D;  5CPI C;  4ZUX A;  2FFF B;  3UTA D;  2F8N A;  3KWQ B;  5CP6 D;  3C1B A;  1HQ3 A;  5BT1 D;  2G5I C;  4CSR B;  2PYO A;  3WA9 A;  1TZY B;  4X23 B;  2F8N G;  2NQB C;  4YS3 A;  4WJ3 C;  1P3O C;  4YM6 C;  4H9S C;  5CP6 C;  3AV1 D;  1TZY D;  5B31 G;  4X23 D;  5AV8 A;  3B6G D;  3UTA C;  3AZN D;  3EPH A;  5B2I B;  2BG1 A;  2DQN C;  5B1M B;  3MGQ D;  3W98 C;  4LD9 B;  1ZLA C;  5BNV B;  4H9R B;  3REL B;  5B24 A;  2UWX A;  3WTP D;  1KX3 B;  5AV5 D;  4H9P A;  5JRG C;  5F99 B;  3AZN C;  3REK C;  1P3B B;  3A6N D;  4XZQ C;  3MNN C;  3KWQ A;  5GT0 A;  5B40 C;  5GT3 C;  4Z66 D;  5B32 A;  3MGQ A;  3X1V D;  5B31 A;  3B0D C;  3EPL A;  1P3F C;  3AV2 D;  5B1L C;  2Y2P A;  5B24 D;  3AZG A;  4WU9 B;  2ZY2 A;  3KXB A;  2Y2L A;  4Z66 C;  5CPI A;  4J8X A;  3MGS D;  1S32 D;  3O62 A;  2XD1 A;  3AZH B;  2F8N K;  3AZK B;  2F8N D;  1P3A B;  2IO5 C;  3AZI B;  3AV2 A;  1P3B A;  3AFA C;  4KUD C;  1M19 A;  5B31 D;  3KUY C;  2F8N B;  4G92 C;  1KX5 B;  3AZM B;  2ARO B;  5AVC B;  1AOI A;  5AY8 A;  1KU5 A;  3REJ C;  3X1T C;  3X1V B;  1KX5 D;  4CSR A;  5AV6 B;  4YS3 B;  5C3I B;  4Z5T D;  3AN2 D;  5B1L D;  1PZR A;  3AZJ D;  4HGA C;  1M1A A;  3MGS C;  5B1M A;  3C1B D;  3H0L C;  3AZH A;  4JJN D;  1M18 C;  1F66 A;  1WWI A;  4LD9 D;  4QLC C;  5B40 D;  3REH B;  1P3L A;  3AZF C;  4XUJ C;  5B0Y A;  1KX4 B;  5DNN B;  1P3M B;  5F99 A;  3MGP A;  4J8U A;  1U35 B;  4J8W A;  4QLC D;  5AV8 B;  2PYO D;  3W97 B;  1M1A D;  4UUZ B;  3AZE C;  3B6F C;  1BH9 B;  3IP4 C;  5B0Y D;  3AV1 C;  1P3F A;  3W96 B;  5B24 B;  4WU9 D;  1ID3 B;  5BS7 A;  3X1S A;  3LZ0 C;  2JSS A;  3NQU B;  1EQZ C;  1N1J B;  1M19 D;  1EQZ B;  5BNV A;  4KUD A;  2CV5 A;  2Y2G A;  3W96 C;  1KX5 A;  2HIO D;  4KHA A;  5DNM D;  3REL D;  4NE6 A;  5B0Z B;  3AZE D;  5B2J D;  4YM6 A;  5AY8 C;  1BH8 A;  3EPJ A;  3AZE B;  3UTB B;  3R45 A;  5B2I D;  3W97 C;  5B40 A;  5AV8 C;  4DRB A;  3AFA A;  1P3A A;  3WAA D;  1P3M C;  3AZJ B;  4JJN A;  1AOI C;  2HIO A;  3AZF B;  5GSU A;  2YFV A;  2NZD C;  4QLC B;  5FUG B;  5JRG A;  3A6N C;  3WA9 C;  4WZS B;  2FJ7 A;  1HTA A;  4WV4 B;  4HGA B;  3WKJ D;  3MGP B;  3LEL D;  4J8U B;  1U35 A;  1AOI D;  4J8X C;  1P3A D;  3WAA A;  3MGQ C;  5C3I C;  1P3F D;  3AFA D;  5AV6 C;  1P3P B;  3WKJ C;  3WA9 D;  3AZG C;  3MGR B;  3X1V C;  3X1T B;  1P3I D;  3REJ B;  3EG5 B;  3UT9 C;  3AZM C;  5BNX B;  1JFI A;  1P3L B;  3F6T A;  5GSU B;  1HQ3 D;  1F1E A;  2IO5 B;  2Y2Q A;  3AZI C;  3KXB D;  4ZUX C;  1H3O A;  5AVB A;  3MNN D;  3AZG D;  2CV5 C;  1P3I A;  1TZY A;  4X23 A;  1EQZ A;  1P3L D;  3W99 B;  2Y2N A;  4KGC B;  3WTP E;  1KX4 A;  5B2J C;  4Z66 B;  5DNN A;  4J8V C;  3MGR D;  3W98 A;  2JCH A;  4WU9 C;  3AYW D;  5B1L B;  5JA4 A;  3WTP B;  3W96 A;  3LZ0 A;  3X1S C;  4KHA B;  1P3F B;  1P3P D;  1KX3 D;  3B0D B;  3X1S B;  3WTP C;  1P3O A;  4J8V B;  5CPJ D;  1B67 A;  3UTB A;  5B2J B;  1BFM A;  4KGC C;  5B40 B;  3REH D;  5E5A D;  5GSU D;  3H0M C;  5KDM B;  4J8V D;  2NQB A;  3W99 C;  5F99 C;  3AZN B;  5B33 D;  4ZUX B;  2CV5 B;  3X1S D;  1KX3 C;  1M18 A;  3A1K A;  2YFV B;  3NQU A;  1ZLA B;  5GSU C;  2NZD A;  4LD9 C;  4NE3 A;  3AV1 A;  1P3L C;  3UT9 B;  4LD9 A;  5B1M C;  4YS3 D;  4H9O A;  1F66 D;  5BT1 C;  4H9R A;  3MGR C;  3REL A;  5B33 A;  2YFW B;  3UTA B;  3AZG B;  3WKJ B;  3MGS A;  2NQB D;  1P3P C;  5E5A A;  3MGQ B;  2RIQ A;  4J8X B;  4YM6 B;  1P3O B;  3V9R A;  4WU8 A;  3MGP C;  5G49 A;  4J8U C;  5KDM A;  3AZF D;  1M18 D;  3A1I A;  3A6N B;  4H9P B;  5CPI B;  1P3G A;  3WA9 B;  5B32 D;  5DNN D;  4Z2M G;  4WU9 A;  5GT0 D;  2NZD B;  5AVB C;  3KWQ D;  5AVC A;  1AOI B;  1KX4 D;  3AZJ C;  5JRG D;  2VQR A;  4H9O B;  1P3I C;  2CWE A;  2Y2I A;  1M1A C;  5DNM B;  3X1T A;  3UTB C;  3LZ1 D;  3AZK A;  1R4V A;  1S32 A;  5AY8 B;  3KUY D;  5AV9 A;  5B0Z C;  4WU8 B;  2LY8 A;  5AV8 D;  3B6G A;  1TAF B;  4R8P A;  3W99 A;  5B2J A;  4YM6 D;  3LZ1 C;  3REI B;  5CHL B;  4KGC A;  3WAA C;  2L5A A;  3LZ1 A;  3REK D;  3AZL B;  3C1C A;  2ARO A;  1F66 B;  5GXQ A;  2ZY3 A;  3W97 A;  3WTP A;  3LZ0 B;  1ZLA A;  1ID3 C;  5B24 C;  3MVD B;  2FJ7 C;  3AV1 B;  1P34 D;  5AY8 D;  4KGC D;  3W98 D;  3VH5 W;  2BYK B;  1U35 D;  1P3K C;  3B6F B;  3W99 D;  1P3G C;  5B32 G;  4R8P D;  2Y2J A;  1HQ3 B;  2G5H C;  1U35 C;  1P3K D;  5GXQ D;  5DNN C;  4H9Q A;  3AYW C;  1KX4 C;  2Y2H A;  4XUJ B;  3O62 D;  1T3U A;  3REH C;  5CPI D;  4J8W D;  5F99 D;  3AN2 B;  1M18 B;  5B2I A;  3MGS B;  4H9S A;  3LEL B;  3FDD A;  5CPK C;  3UT9 A;  5G49 B;  2PYO C;  4Z2M H;  4YS3 C;  4WNN B;  5B0Z A;  4M6B A;  3A6N A;  5AV5 A;  5AVC C;  3V9R B;  2ARO C;  4WU8 D;  4H9Q B;  3LJA C;  4DRA A;  4G92 B;  1KX5 C;  3KUY B;  3TU4 A;  4KUD B;  3AFA B;  3REK A;  3LZ0 D;  1KX3 A;  1P3A C;  5E5A C;  3AZK C;  5B33 C;  3AZF A;  3AZH C;  3AZL D;  3C1C B;  3AZM D;  4NE5 A;  5GT0 B;  2NZD D;  2HIO B;  2ZM5 A;  5B32 B;  3AZE A;  5DNM A;  3AZK D;  3X1T D;  3B0B A;  3MVD D;  3TU4 D;  5AV5 B;  4DQY B;  1P3K A;  3REI A;  5AV9 B;  3AZM A;  4Z5T A;  5GT3 B;  3P5J B;  3MNN B;  4XZQ B;  2F8N H;  1TAF A;  3REK B;  1P3B C;  2RVQ C;  5JRG B;  4EO5 C;  3AV2 B;  1P3P A;  3W96 D;  1W2E A;  3AL0 C;  5B1M D; 
#chains in the Genus database with same CATH homology
 3MGR A;  4Z66 A;  3REL C;  3UT9 D;  3W98 B;  3KSY A;  4CAY B;  3AN2 A;  5CPJ A;  1B6W A;  1ZLA D;  3VH6 W;  5B2I C;  3NQJ B;  3W97 D;  4EO5 B;  3AV2 C;  3MVD A;  3X1U A;  1P3M D;  2DF4 C;  5BO0 A;  5CP6 B;  4J8X D;  3LJA D;  5AV9 C;  2BYK A;  3MGP D;  1TZY C;  5AV5 C;  4X23 C;  4J8U D;  2NQB B;  4NFT A;  5AVB D;  3MNN A;  1WWS A;  4E45 A;  3KWQ C;  4UUZ A;  3H0R C;  5B32 C;  3KUY A;  3TU4 B;  2HIO C;  4KUD D;  5CPK A;  5GT0 C;  1P3M A;  4H9N A;  3C1C C;  5B33 B;  4ZUX D;  3UTA A;  5B1L A;  1ID3 A;  2FJ7 D;  3NQJ A;  5E5A B;  1P3O D;  2BYM A;  3X1U B;  2ARO D;  3C1C D;  2F2A C;  3LJA B;  3AYW A;  1P3G D;  5CPK D;  5B0Y B;  4AWL B;  3WKJ A;  1BH9 A;  3AZN A;  4J8W B;  2J8P A;  5GXQ C;  2YFW A;  4Z5T B;  5GT3 A;  2PYO B;  4XUJ D;  5CPK B;  3O62 C;  4XZQ A;  5AV6 D;  3LEL C;  1M19 C;  2Y2K A;  3KFU G;  5BS7 C;  4G91 B;  1N1J A;  3R45 B;  3X1U D;  1P34 C;  2ZY5 A;  3C1B C;  3AN2 C;  3B6G C;  5B31 C;  3VH5 A;  4R8P C;  4JJN B;  5CPJ C;  3AZI D;  5AV9 D;  3REJ D;  3KXB C;  3LJA A;  3AYW B;  4ZBJ C;  2Y2M A;  2HUE B;  5FUG A;  1HQ3 C;  5BO0 B;  5CP6 A;  1S32 B;  1S32 C;  2ZY4 A;  3AZJ A;  3UTB D;  1P3G B;  2HUE C;  2CV5 D;  1P3K B;  4ZBJ B;  3KXB B;  3REI D;  5AVC D;  3VH6 T;  4CAY A;  5B0Z D;  4JJN C;  4R8P B;  5CPJ B;  1BH8 B;  2FJ7 B;  3MVD C;  5B31 B;  3B0C W;  1Q9C A;  2RVQ D;  3B6G B;  2XD5 A;  3C1B B;  4QLC A;  3REJ A;  1P34 B;  4G91 C;  1F66 C;  1Z2C B;  4H9N B;  1P3B D;  3VH5 T;  3AZL C;  1M19 B;  2JE5 A;  1EQZ D;  3B6F A;  3O62 B;  3REI C;  3WAA B;  4E44 A;  3LZ1 B;  3AZL A;  4Z5T C;  1ULY A;  5GXQ B;  4J8W C;  1H3O B;  1A7W A;  5AV6 A;  4XZQ D;  4WU8 C;  4AWL C;  2W8S A;  4XUJ A;  5B0Y C;  4UPK A;  5GT3 D;  3B6F D;  3B0C T;  5BNX A;  5JA4 B;  3X1U C;  1JFI B;  3X1V A;  5DNM C;  3VH6 A;  1M1A B;  1P3I B;  3AZH D;  2BYM B;  3EPK A;  1P34 A;  3LEL A;  4J8V A;  3REH A;  5AVB B;  3AZI A;  2Y2O A;  4WNN A;  3TU4 C;  1ID3 D;  5CPI C;  4ZUX A;  2FFF B;  3UTA D;  2F8N A;  3KWQ B;  5CP6 D;  3C1B A;  1HQ3 A;  5BT1 D;  2G5I C;  4CSR B;  2PYO A;  3WA9 A;  1TZY B;  4X23 B;  2F8N G;  2NQB C;  4YS3 A;  4WJ3 C;  1P3O C;  4YM6 C;  4H9S C;  5CP6 C;  3AV1 D;  1TZY D;  5B31 G;  4X23 D;  5AV8 A;  3B6G D;  3UTA C;  3AZN D;  3EPH A;  5B2I B;  2BG1 A;  2DQN C;  5B1M B;  3MGQ D;  3W98 C;  4LD9 B;  1ZLA C;  5BNV B;  4H9R B;  3REL B;  5B24 A;  2UWX A;  3WTP D;  1KX3 B;  5AV5 D;  4H9P A;  5JRG C;  5F99 B;  3AZN C;  3REK C;  1P3B B;  3A6N D;  4XZQ C;  3MNN C;  3KWQ A;  5GT0 A;  5B40 C;  5GT3 C;  4Z66 D;  5B32 A;  3MGQ A;  3X1V D;  5B31 A;  3B0D C;  3EPL A;  1P3F C;  3AV2 D;  5B1L C;  2Y2P A;  5B24 D;  3AZG A;  4WU9 B;  2ZY2 A;  3KXB A;  2Y2L A;  4Z66 C;  5CPI A;  4J8X A;  3MGS D;  1S32 D;  3O62 A;  2XD1 A;  3AZH B;  2F8N K;  3AZK B;  2F8N D;  1P3A B;  2IO5 C;  3AZI B;  3AV2 A;  1P3B A;  3AFA C;  4KUD C;  1M19 A;  5B31 D;  3KUY C;  2F8N B;  4G92 C;  1KX5 B;  3AZM B;  2ARO B;  5AVC B;  1AOI A;  5AY8 A;  1KU5 A;  3REJ C;  3X1T C;  3X1V B;  1KX5 D;  4CSR A;  5AV6 B;  4YS3 B;  5C3I B;  4Z5T D;  3AN2 D;  5B1L D;  1PZR A;  3AZJ D;  4HGA C;  1M1A A;  3MGS C;  5B1M A;  3C1B D;  3H0L C;  3AZH A;  4JJN D;  1M18 C;  1F66 A;  1WWI A;  4LD9 D;  4QLC C;  5B40 D;  3REH B;  1P3L A;  3AZF C;  4XUJ C;  5B0Y A;  1KX4 B;  5DNN B;  1P3M B;  5F99 A;  3MGP A;  4J8U A;  1U35 B;  4J8W A;  4QLC D;  5AV8 B;  2PYO D;  3W97 B;  1M1A D;  4UUZ B;  3AZE C;  3B6F C;  1BH9 B;  3IP4 C;  5B0Y D;  3AV1 C;  1P3F A;  3W96 B;  5B24 B;  4WU9 D;  1ID3 B;  5BS7 A;  3X1S A;  3LZ0 C;  2JSS A;  3NQU B;  1EQZ C;  1N1J B;  1M19 D;  1EQZ B;  5BNV A;  4KUD A;  2CV5 A;  2Y2G A;  3W96 C;  1KX5 A;  2HIO D;  4KHA A;  5DNM D;  3REL D;  4NE6 A;  5B0Z B;  3AZE D;  5B2J D;  4YM6 A;  5AY8 C;  1BH8 A;  3EPJ A;  3AZE B;  3UTB B;  3R45 A;  5B2I D;  3W97 C;  5B40 A;  5AV8 C;  4DRB A;  3AFA A;  1P3A A;  3WAA D;  1P3M C;  3AZJ B;  4JJN A;  1AOI C;  2HIO A;  3AZF B;  5GSU A;  2YFV A;  2NZD C;  4QLC B;  5FUG B;  5JRG A;  3A6N C;  3WA9 C;  4WZS B;  2FJ7 A;  1HTA A;  4WV4 B;  4HGA B;  3WKJ D;  3MGP B;  3LEL D;  4J8U B;  1U35 A;  1AOI D;  4J8X C;  1P3A D;  3WAA A;  3MGQ C;  5C3I C;  1P3F D;  3AFA D;  5AV6 C;  1P3P B;  3WKJ C;  3WA9 D;  3AZG C;  3MGR B;  3X1V C;  3X1T B;  1P3I D;  3REJ B;  3EG5 B;  3UT9 C;  3AZM C;  5BNX B;  1JFI A;  1P3L B;  3F6T A;  5GSU B;  1HQ3 D;  1F1E A;  2IO5 B;  2Y2Q A;  3AZI C;  3KXB D;  4ZUX C;  1H3O A;  5AVB A;  3MNN D;  3AZG D;  2CV5 C;  1P3I A;  1TZY A;  4X23 A;  1EQZ A;  1P3L D;  3W99 B;  2Y2N A;  4KGC B;  3WTP E;  1KX4 A;  5B2J C;  4Z66 B;  5DNN A;  4J8V C;  3MGR D;  3W98 A;  2JCH A;  4WU9 C;  3AYW D;  5B1L B;  5JA4 A;  3WTP B;  3W96 A;  3LZ0 A;  3X1S C;  4KHA B;  1P3F B;  1P3P D;  1KX3 D;  3B0D B;  3X1S B;  3WTP C;  1P3O A;  4J8V B;  5CPJ D;  1B67 A;  3UTB A;  5B2J B;  1BFM A;  4KGC C;  5B40 B;  3REH D;  5E5A D;  5GSU D;  3H0M C;  5KDM B;  4J8V D;  2NQB A;  3W99 C;  5F99 C;  3AZN B;  5B33 D;  4ZUX B;  2CV5 B;  3X1S D;  1KX3 C;  1M18 A;  3A1K A;  2YFV B;  3NQU A;  1ZLA B;  5GSU C;  2NZD A;  4LD9 C;  4NE3 A;  3AV1 A;  1P3L C;  3UT9 B;  4LD9 A;  5B1M C;  4YS3 D;  4H9O A;  1F66 D;  5BT1 C;  4H9R A;  3MGR C;  3REL A;  5B33 A;  2YFW B;  3UTA B;  3AZG B;  3WKJ B;  3MGS A;  2NQB D;  1P3P C;  5E5A A;  3MGQ B;  2RIQ A;  4J8X B;  4YM6 B;  1P3O B;  3V9R A;  4WU8 A;  3MGP C;  5G49 A;  4J8U C;  5KDM A;  3AZF D;  1M18 D;  3A1I A;  3A6N B;  4H9P B;  5CPI B;  1P3G A;  3WA9 B;  5B32 D;  5DNN D;  4Z2M G;  4WU9 A;  5GT0 D;  2NZD B;  5AVB C;  3KWQ D;  5AVC A;  1AOI B;  1KX4 D;  3AZJ C;  5JRG D;  2VQR A;  4H9O B;  1P3I C;  2CWE A;  2Y2I A;  1M1A C;  5DNM B;  3X1T A;  3UTB C;  3LZ1 D;  3AZK A;  1R4V A;  1S32 A;  5AY8 B;  3KUY D;  5AV9 A;  5B0Z C;  4WU8 B;  2LY8 A;  5AV8 D;  3B6G A;  1TAF B;  4R8P A;  3W99 A;  5B2J A;  4YM6 D;  3LZ1 C;  3REI B;  5CHL B;  4KGC A;  3WAA C;  2L5A A;  3LZ1 A;  3REK D;  3AZL B;  3C1C A;  2ARO A;  1F66 B;  5GXQ A;  2ZY3 A;  3W97 A;  3WTP A;  3LZ0 B;  1ZLA A;  1ID3 C;  5B24 C;  3MVD B;  2FJ7 C;  3AV1 B;  1P34 D;  5AY8 D;  4KGC D;  3W98 D;  3VH5 W;  2BYK B;  1U35 D;  1P3K C;  3B6F B;  3W99 D;  1P3G C;  5B32 G;  4R8P D;  2Y2J A;  1HQ3 B;  2G5H C;  1U35 C;  1P3K D;  5GXQ D;  5DNN C;  4H9Q A;  3AYW C;  1KX4 C;  2Y2H A;  4XUJ B;  3O62 D;  1T3U A;  3REH C;  5CPI D;  4J8W D;  5F99 D;  3AN2 B;  1M18 B;  5B2I A;  3MGS B;  4H9S A;  3LEL B;  3FDD A;  5CPK C;  3UT9 A;  5G49 B;  2PYO C;  4Z2M H;  4YS3 C;  4WNN B;  5B0Z A;  4M6B A;  3A6N A;  5AV5 A;  5AVC C;  3V9R B;  2ARO C;  4WU8 D;  4H9Q B;  3LJA C;  4DRA A;  4G92 B;  1KX5 C;  3KUY B;  3TU4 A;  4KUD B;  3AFA B;  3REK A;  3LZ0 D;  1KX3 A;  1P3A C;  5E5A C;  3AZK C;  5B33 C;  3AZF A;  3AZH C;  3AZL D;  3C1C B;  3AZM D;  4NE5 A;  5GT0 B;  2NZD D;  2HIO B;  2ZM5 A;  5B32 B;  3AZE A;  5DNM A;  3AZK D;  3X1T D;  3B0B A;  3MVD D;  3TU4 D;  5AV5 B;  4DQY B;  1P3K A;  3REI A;  5AV9 B;  3AZM A;  4Z5T A;  5GT3 B;  3P5J B;  3MNN B;  4XZQ B;  2F8N H;  1TAF A;  3REK B;  1P3B C;  2RVQ C;  5JRG B;  4EO5 C;  3AV2 B;  1P3P A;  3W96 D;  1W2E A;  3AL0 C;  5B1M D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...