1P3GC

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
104
structure length
104
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein/dna
molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 104
sequence length 104
chains with identical sequence G
ec nomenclature
pdb deposition date 2003-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3gC00
5AV5B 1P3LD 4XZQD 4ZUXC 3AZEC 4KUDB 3LELC 4WNNB 2YFWB 4UUZB 3X1SD 5CPIA 5E5AD 1P3LB 3W96C 5B24A 4H9QA 3AZFD 1JFIA 5JRGD 3VH6T 3UTBD 3X1SB 5AV5C 3LZ0D 3AZFB 3WTPC 1P34A 1KX3B 5C3IB 1U35D 1KU5A 3RELC 5G49B 3AV2D 5AV9B 4J8WB 4JJNC 3REHA 1U35B 4Z5TD 3MGPC 5FUGB 3B6FA 1KX4D 5DNNC 5B32G 3C1BA 1KX3C 2LY8A 4Z5TB 3B6GA 1KX4B 4R8PB 3B0DB 3C1CA 3MNNA 3AZID 5AV9C 4J8WC 1WWSA 3AZIB 4ZUXA 5B31A 3LELA 3AZNB 5GT3D 2NZDC 5AY8D 4G91B 4R8PC 1EQZA 1P3GD 2HIOA 5AY8B 3B0CT 5AVCA 3AZNC 3KXBA 1AOIC 3MVDD 1P3AA 2YFVA 4E44A 5BNVB 5B0YC 4J8VD 3AZGD 3AV1D 5GSUA 3W99A 4X23D 4LD9A 4CAYA 5B2IA 3V9RB 3KUYA 4XUJA 3AYWB 3X1TD 3X1UA 2NQBC 5B1MA 3AV1B 5BNXB 3AZJC 5AV8C 4X23B 3X1TB 5B0ZD 5CPJD 1P3KB 1HQ3D 4DRAA 4YM6A 1M18C 3X1VC 5AVBD 3AYWC 5B0ZB 4H9RB 3WKJD 1P3BD 1HQ3B 3B0BA 3LJAD 1H3OB 3REKD 3WAAD 1KX5B 3WA9A 5B32C 1P3MC 1P3FD 3WKJB 1BH8A 1P3KC 3UT9A 3REKB 1BH9A 3WAAB 3W98D 2HUEB 4NE6A 4Z66A 5CP6A 2JSSA 3TU4C 1WWIA 1KX5C 1M1AA 3VH5W 3KSYA 5B31G 1ZLAD 3AZLD 5CPIB 3O62A 5B24B 1P3PD 5F99A 4NFTA 4J8XA 4H9PA 1P3PB 3AZJA 4YS3A 4J8UA 1F66A 3MGRD 5CPIC 3AN2C 3A6ND 5B24C 5AV6D 3MGRB 1P3ID 1M19A 3R45B 5B1LA 4HGAC 5B2JD 5AV6B 1P3OD 1P3MA 1P34C 5B2JB 3KWQC 1P3OB 5BT1C 3C1CB 3AZED 3LELD 3REHC 4KGCA 1ID3C 3B6FC 4ZUXB 3AZEB 5B31B 3LELB 3C1BC 3W96D 3AZHA 3NQJA 3B6GC 5AV5D 2PYOA 3C1CC 3MNNC 2HIOB 3WTPD 2AROA 4H9OB 5B31C 3KXBB 3WTPB 3NQUA 3RELD 1P3AB 3AN2A 3REIA 1EQZC 4JJND 5CPKA 3MGPD 4CSRA 5GSUB 3RELB 2HIOC 4M6BA 4CAYB 5DNND 3KUYB 4XUJB 1KX3D 5AVCC 3X1UB 4JJNB 3MGPB 3KXBC 1TZYA 5DNNB 1P3AC 5AV9D 2CV5A 1S32A 3KWQA 1B67A 4J8WD 2FJ7C 4YM6B 5GSUC 3WTPE 3W99C 4LD9C 4QLCA 4KHAB 5B2IC 4XUJC 3KUYC 2NZDD 3X1UC 5B1MC 5GT0A 1ID3A 4R8PD 3MGQA 3WA9B 2NZDB 4H9NB 2RVQC 5BO0B 4YM6C 1BH9B 4NE3A 4WV4B 3AZND 4Z66B 3MGSA 1AOID 4WU9A 5B0YD 1M1AB 3WA9C 3UTAA 1AOIB 3AFAA 5JA4A 3UT9C 2NQBD 5B0YB 2CWEA 4Z66C 5AV8D 3AZKA 5CP6C 5B40C 5DNMA 2NQBB 4AWLC 1M1AC 4H9PB 3AZJB 5AV8B 1M18D 4J8UB 3X1VD 3AYWD 2FJ7A 3O62C 1M18B 5F99C 3AZMA 3W97A 3X1VB 3REJA 5B32D 1P3MD 4J8XC 1M19B 3LZ1A 1P3KD 2BYKA 5GXQA 4YS3C 4J8UC 4ZBJC 5B32B 1F66C 1P3MB 5B33A 3TU4D 2BYMB 1KX5D 5KDMB 4KUDA 1M19C 4WNNA 5B1LC 3TU4B 4KGCB 1P3LA 4XZQA 3AZHB 3VH5A 3X1SA 5E5AA 3AZFA 5JRGA 3UTBA 1TAFA 5B40A 4EO5C 5CPID 4KGCC 3LZ0A 3AN2D 5B24D 3AZHC 3NQUB 1Q9CA 5G49A 2PYOC 3AN2B 4H9QB 1JFIB 5CPKB 1U35A 4CSRB 3AV2A 1P34D 2AROC 4HGAB 3KWQD 4Z5TA 5BT1D 1B6WA 4DRBA 1KX4A 1TZYB 1P34B 3VH6W 5BS7A 3REIC 4NE5A 3KWQB 3REHD 5CPKC 4Z2MH 1ID3D 3B6FD 3C1BD 3REHB 3B6GD 2F8NG 1ID3B 3LJAC 3B6FB 3C1CD 1TZYC 3MNND 3C1BB 5GT3A 1F1EA 2CV5C 1S32C 5AY8A 3B6GB 3MNNB 4ZUXD 5B31D 4QLCC 3W98C 2F8NH 1P3GA 5GT0C 4H9SA 1EQZD 3MGQC 2HIOD 3MVDA 5JA4B 1EQZB 5AVCD 3AZGA 4J8VA 3KXBD 5BNXA 3MGSC 4X23A 1P3AD 4WU9C 5AVCB 3X1TA 4WU8C 5GSUD 3UTAC 3W99D 4LD9D 5CHLB 5B2ID 3KUYD 4XUJD 2YFVB 3AFAC 5B0ZA 3X1UD 5CPJA 2FJ7B 1HQ3A 3B0CW 5B1MD 3W99B 4LD9B 3W97B 3AZKC 5B2IB 3REJB 5AVBA 5DNMC 3WKJA 1P3BA 5B1MB 2RVQD 2BYKB 3LJAA 4YM6D 3VH5T 4WZSB 3REKA 3WAAA 1A7WA 1P3FA 3AZMC 3W97C 3REJC 3W98A 3WA9D 3LZ1C 5GXQC 3UT9D 4XZQB 1ZLAA 4Z66D 5B33C 1BH8B 3AZLA 5CP6D 5B40D 3UT9B 5E5AB 1M1AD 1P3PA 5JRGB 4KUDC 5CP6B 1TAFB 3UTBB 5B40B 4E45A 4WU8A 4XZQC 3LZ0B 4AWLB 1P3LC 3O62D 5F99D 1N1JA 3MGRA 3X1SC 5E5AC 4J8XD 3R45A 3O62B 3A6NA 3AZFC 3AZJD 5F99B 4YS3D 5AV6A 5JRGC 3UTBC 4J8UD 1P3IA 3AV2B 1F66D 4J8XB 3LZ0C 5C3IC 5B2JA 4YS3B 1P3OA 4ZBJB 1F66B 1M19D 5B1LD 1U35C 3AV2C 3AZEA 5B1LB 2F8NA 4Z5TC 1KX4C 3B0DC 3W96A 5BS7C 5GT3B 5AV5A 4KGCD 4H9OA 3AZIC 3AZHD 1P3GB 2YFWA 4UUZA 3WTPA 4EO5B 2PYOD 4G91C 5GT3C 3NQJB 5AY8C 3RELA 3MVDB 2PYOB 2AROD 4JJNA 3AZGB 4J8VB 3MGPA 1P3GC 1ULYA 2AROB 5DNNA 1KX3A 3REID 4H9SC 5CPKD 4G92B 3MVDC 3REIB 5AV9A 4KHAA 3VH6A 5CPJB 4J8WA 3AZGC 4J8VC 3AV1C 5FUGA 4X23C 1TZYD 4Z2MG 5AVBB 2NZDA 3X1TC 2CV5D 1S32D 4H9NA 1P3BB 5BO0A 3LJAB 4R8PA 4G92C 4QLCD 2CV5B 1S32B 1P3FB 5B0ZC 5CPJC 1BFMA 1HQ3C 5GT0D 3AZIA 4QLCB 3AZNA 5AVBC 3MGQD 3W98B 3WKJC 1P3BC 5GT0B 1AOIA 3REKC 3WAAC 3MGQB 1ZLAB 5B0YA 2HUEC 1P3FC 3MGSD 3AZLB 4WU9D 2NQBA 4WU8D 3MGSB 5AV8A 3UTAD 4WU9B 3AFAD 2IO5B 4WU8B 5BNVA 1ZLAC 3UTAB 1M18A 2L5AA 3AZKD 3AZLC 3X1VA 1N1JB 3AYWA 3V9RA 3AFAB 5DNMD 3A6NB 3AV1A 1P3PC 3AZKB 1P3IB 5DNMB 5B32A 2IO5C 2FJ7D 1P3KA 3AZMD 3W97D 3REJD 2BYMA 3MGRC 5KDMA 1HTAA 4H9RA 3LZ1D 3A6NC 3TU4A 5GXQD 2F8ND 5AV6C 3AZMB 1H3OA 1KX5A 1P3IC 5B33D 3LZ1B 2F8NK 5GXQB 2F8NB 5B2JC 1P3OC 1R4VA 3W96B 5B33B 4KUDD
chains in the Genus database with same CATH superfamily
2XD1A 5AV5B 1P3LD 4XZQD 2VQRA 4ZUXC 3AZEC 4KUDB 3LELC 4WNNB 2YFWB 4UUZB 3X1SD 5CPIA 5E5AD 1P3LB 3KFUG 3W96C 5B24A 4H9QA 3AZFD 1JFIA 3A1KA 5JRGD 3VH6T 3UTBD 3X1SB 5AV5C 3LZ0D 3AZFB 3WTPC 2UWXA 3EG5B 1P34A 1KX3B 5C3IB 2Y2JA 1U35D 1KU5A 3RELC 5G49B 3AV2D 5AV9B 4J8WB 4JJNC 3REHA 1U35B 4Z5TD 3MGPC 3AL0C 5FUGB 3B6FA 1KX4D 5DNNC 5B32G 3C1BA 1KX3C 2LY8A 4Z5TB 3B6GA 1KX4B 4R8PB 3B0DB 3C1CA 3MNNA 3AZID 5AV9C 4J8WC 1WWSA 3AZIB 4ZUXA 5B31A 3LELA 3AZNB 5GT3D 2NZDC 5AY8D 4G91B 4R8PC 1EQZA 1P3GD 2HIOA 5AY8B 3B0CT 5AVCA 2ZY2A 3AZNC 3KXBA 3F6TA 1AOIC 3MVDD 1P3AA 2Y2LA 2YFVA 4E44A 5BNVB 5B0YC 4J8VD 3AZGD 3AV1D 5GSUA 3W99A 4X23D 4LD9A 4CAYA 5B2IA 3V9RB 3KUYA 4XUJA 3AYWB 2BG1A 3X1UA 3X1TD 2NQBC 5B1MA 3AV1B 5BNXB 3AZJC 5AV8C 4X23B 3X1TB 5B0ZD 5CPJD 1P3KB 1HQ3D 4DRAA 4YM6A 1M18C 3X1VC 5AVBD 3AYWC 5B0ZB 4H9RB 3WKJD 1P3BD 1HQ3B 3B0BA 3LJAD 1H3OB 3REKD 3WAAD 1KX5B 3WA9A 5B32C 1P3MC 1P3FD 3WKJB 1BH8A 1P3KC 3UT9A 3REKB 1BH9A 3WAAB 3W98D 2HUEB 4NE6A 4Z66A 2J8PA 5CP6A 2JSSA 3TU4C 2G5HC 1WWIA 1KX5C 1M1AA 3VH5W 3KSYA 5B31G 1ZLAD 3AZLD 5CPIB 3O62A 5B24B 1P3PD 5F99A 4NFTA 4J8XA 4H9PA 1P3PB 3AZJA 4YS3A 4J8UA 1F66A 3MGRD 5CPIC 3AN2C 2Y2PA 3A6ND 5B24C 5AV6D 3MGRB 1P3ID 1M19A 3R45B 5B1LA 4HGAC 5B2JD 5AV6B 1P3OD 1P3MA 1P34C 5B2JB 3KWQC 1P3OB 5BT1C 3H0MC 3C1CB 3AZED 3LELD 3REHC 4KGCA 1ID3C 3B6FC 4ZUXB 3AZEB 5B31B 3LELB 3C1BC 3W96D 3AZHA 2ZY4A 3NQJA 3B6GC 5AV5D 2PYOA 3C1CC 3MNNC 2HIOB 3WTPD 2AROA 4H9OB 5B31C 3KXBB 3WTPB 3NQUA 3RELD 1P3AB 3AN2A 3REIA 1EQZC 4JJND 5CPKA 3MGPD 4CSRA 5GSUB 3RELB 2HIOC 4M6BA 3IP4C 2ZM5A 4CAYB 5DNND 3KUYB 4XUJB 1KX3D 5AVCC 3X1UB 4JJNB 3MGPB 3KXBC 1TZYA 5DNNB 1P3AC 5AV9D 2DF4C 2CV5A 1S32A 3KWQA 1B67A 4J8WD 2FJ7C 4YM6B 5GSUC 3WTPE 3W99C 4LD9C 3EPJA 4QLCA 4KHAB 5B2IC 4XUJC 3KUYC 2NZDD 3X1UC 5B1MC 5GT0A 1ID3A 4R8PD 3MGQA 3A1IA 3WA9B 2NZDB 4H9NB 2RVQC 5BO0B 4YM6C 1BH9B 4NE3A 4WV4B 3AZND 4Z66B 3MGSA 1AOID 4WU9A 5B0YD 1M1AB 3WA9C 3UTAA 1AOIB 3AFAA 2ZY5A 5JA4A 3UT9C 2NQBD 5B0YB 2CWEA 4Z66C 5AV8D 3AZKA 5CP6C 5B40C 5DNMA 2NQBB 4AWLC 1M1AC 4H9PB 3AZJB 5AV8B 1M18D 4J8UB 3X1VD 3AYWD 2FJ7A 3O62C 1M18B 5F99C 3AZMA 3W97A 3X1VB 3REJA 5B32D 1P3MD 4J8XC 1M19B 3LZ1A 1P3KD 2BYKA 5GXQA 4YS3C 4J8UC 4ZBJC 5B32B 1F66C 1P3MB 5B33A 3TU4D 2BYMB 1KX5D 5KDMB 1W2EA 4KUDA 1M19C 4WNNA 5B1LC 3TU4B 4KGCB 1P3LA 4XZQA 3AZHB 3VH5A 3X1SA 5E5AA 3AZFA 5JRGA 3UTBA 1TAFA 5B40A 4EO5C 5CPID 4KGCC 3LZ0A 3AN2D 5B24D 3AZHC 3NQUB 2W8SA 1Q9CA 5G49A 2PYOC 1Z2CB 3AN2B 4H9QB 1JFIB 5CPKB 1U35A 4CSRB 3AV2A 1P34D 2AROC 4HGAB 3KWQD 4Z5TA 5BT1D 1T3UA 1B6WA 4DRBA 1KX4A 1TZYB 1P34B 3VH6W 5BS7A 3REIC 4NE5A 3KWQB 3REHD 3EPHA 5CPKC 4Z2MH 1ID3D 3B6FD 3C1BD 3REHB 3B6GD 2F8NG 1ID3B 3LJAC 3B6FB 3C1CD 1TZYC 3MNND 3C1BB 5GT3A 1F1EA 2CV5C 1S32C 5AY8A 2Y2MA 3B6GB 3P5JB 3MNNB 4ZUXD 5B31D 4QLCC 3W98C 2F8NH 1P3GA 5GT0C 2Y2QA 4H9SA 1EQZD 3MGQC 2HIOD 3MVDA 5JA4B 1EQZB 5AVCD 3AZGA 4J8VA 3KXBD 5BNXA 3MGSC 4X23A 1P3AD 4WU9C 5AVCB 3X1TA 4WU8C 5GSUD 3UTAC 3W99D 4LD9D 5CHLB 5B2ID 3KUYD 4XUJD 2YFVB 3AFAC 5B0ZA 3X1UD 5CPJA 2FJ7B 1HQ3A 3B0CW 5B1MD 3W99B 4LD9B 3W97B 3AZKC 5B2IB 3REJB 5AVBA 5DNMC 3WKJA 1P3BA 5B1MB 2RVQD 2BYKB 3LJAA 4YM6D 3VH5T 4WZSB 3REKA 3WAAA 1A7WA 1P3FA 3AZMC 3W97C 3REJC 3W98A 3WA9D 3LZ1C 5GXQC 3UT9D 4XZQB 1ZLAA 4Z66D 5B33C 1BH8B 3AZLA 5CP6D 5B40D 3UT9B 5E5AB 1M1AD 1P3PA 5JRGB 4KUDC 5CP6B 1TAFB 3UTBB 5B40B 4E45A 4WU8A 4XZQC 3LZ0B 4AWLB 1P3LC 3O62D 5F99D 2Y2IA 1N1JA 3MGRA 3X1SC 5E5AC 4J8XD 3R45A 3O62B 3A6NA 3AZFC 3AZJD 5AV6A 5JRGC 5F99B 4YS3D 3UTBC 4J8UD 1P3IA 3AV2B 1F66D 4J8XB 3LZ0C 2JE5A 5C3IC 5B2JA 4YS3B 2XD5A 1P3OA 2Y2NA 4ZBJB 1F66B 4UPKA 3EPKA 1M19D 5B1LD 1U35C 3AV2C 3AZEA 3H0LC 5B1LB 4DQYB 2F8NA 2Y2GA 4Z5TC 1KX4C 3B0DC 3W96A 5BS7C 5GT3B 2F2AC 2Y2KA 5AV5A 4KGCD 4H9OA 3AZIC 3AZHD 1P3GB 2YFWA 4UUZA 3WTPA 4EO5B 2PYOD 2ZY3A 4G91C 4WJ3C 5GT3C 3NQJB 5AY8C 3RELA 3MVDB 2PYOB 2AROD 4JJNA 3AZGB 4J8VB 3MGPA 2FFFB 1P3GC 1ULYA 2AROB 5DNNA 1KX3A 3REID 4H9SC 5CPKD 2G5IC 4G92B 3MVDC 3REIB 5AV9A 4KHAA 3VH6A 5CPJB 4J8WA 3AZGC 2JCHA 4J8VC 3AV1C 5FUGA 3H0RC 4X23C 1TZYD 4Z2MG 5AVBB 2NZDA 3X1TC 2CV5D 1S32D 4H9NA 1P3BB 5BO0A 3LJAB 4R8PA 4G92C 2Y2HA 4QLCD 2CV5B 1S32B 1P3FB 5B0ZC 5CPJC 1BFMA 1HQ3C 5GT0D 3AZIA 4QLCB 3AZNA 5AVBC 3MGQD 3W98B 3WKJC 1P3BC 5GT0B 1AOIA 2Y2OA 2DQNC 3REKC 3WAAC 3MGQB 1ZLAB 5B0YA 2HUEC 1P3FC 3MGSD 3AZLB 1PZRA 4WU9D 2NQBA 4WU8D 3MGSB 5AV8A 3UTAD 4WU9B 3AFAD 2IO5B 4WU8B 5BNVA 1ZLAC 3UTAB 1M18A 2L5AA 3AZKD 3AZLC 3X1VA 1N1JB 3AYWA 3V9RA 3AFAB 5DNMD 3A6NB 3AV1A 2RIQA 1P3PC 3FDDA 3AZKB 1P3IB 5DNMB 5B32A 2IO5C 2FJ7D 1P3KA 3AZMD 3W97D 3REJD 2BYMA 3MGRC 5KDMA 1HTAA 4H9RA 3LZ1D 3A6NC 3EPLA 5GXQD 3TU4A 2F8ND 5AV6C 3AZMB 1H3OA 1KX5A 1P3IC 5B33D 3LZ1B 2F8NK 5GXQB 2F8NB 5B2JC 1P3OC 1R4VA 3W96B 5B33B 4KUDD
chains in the Genus database with same CATH topology
2XD1A 5AV5B 1P3LD 4XZQD 2VQRA 4ZUXC 3AZEC 4KUDB 3LELC 4WNNB 2YFWB 4UUZB 3X1SD 5CPIA 5E5AD 1P3LB 3KFUG 3W96C 5B24A 4H9QA 3AZFD 1JFIA 3A1KA 5JRGD 3VH6T 3UTBD 3X1SB 5AV5C 3LZ0D 3AZFB 3WTPC 2UWXA 3EG5B 1P34A 1KX3B 5C3IB 2Y2JA 1U35D 1KU5A 3RELC 5G49B 3AV2D 5AV9B 4J8WB 4JJNC 3REHA 1U35B 4Z5TD 3MGPC 3AL0C 5FUGB 3B6FA 1KX4D 5DNNC 5B32G 3C1BA 1KX3C 2LY8A 4Z5TB 3B6GA 1KX4B 4R8PB 3B0DB 3C1CA 3MNNA 3AZID 5AV9C 4J8WC 1WWSA 3AZIB 4ZUXA 5B31A 3LELA 3AZNB 5GT3D 2NZDC 5AY8D 4G91B 4R8PC 1EQZA 1P3GD 2HIOA 5AY8B 3B0CT 5AVCA 2ZY2A 3AZNC 3KXBA 3F6TA 1AOIC 3MVDD 1P3AA 2Y2LA 2YFVA 4E44A 5BNVB 5B0YC 4J8VD 3AZGD 3AV1D 5GSUA 3W99A 4X23D 4LD9A 4CAYA 5B2IA 3V9RB 3KUYA 4XUJA 3AYWB 2BG1A 3X1UA 3X1TD 2NQBC 5B1MA 3AV1B 5BNXB 3AZJC 5AV8C 4X23B 3X1TB 5B0ZD 5CPJD 1P3KB 1HQ3D 4DRAA 4YM6A 1M18C 3X1VC 5AVBD 3AYWC 5B0ZB 4H9RB 3WKJD 1P3BD 1HQ3B 3B0BA 3LJAD 1H3OB 3REKD 3WAAD 1KX5B 3WA9A 5B32C 1P3MC 1P3FD 3WKJB 1BH8A 1P3KC 3UT9A 3REKB 1BH9A 3WAAB 3W98D 2HUEB 4NE6A 4Z66A 2J8PA 5CP6A 2JSSA 3TU4C 2G5HC 1WWIA 1KX5C 1M1AA 3VH5W 3KSYA 5B31G 1ZLAD 3AZLD 5CPIB 3O62A 5B24B 1P3PD 5F99A 4NFTA 4J8XA 4H9PA 1P3PB 3AZJA 4YS3A 4J8UA 1F66A 3MGRD 5CPIC 3AN2C 2Y2PA 3A6ND 5B24C 5AV6D 3MGRB 1P3ID 1M19A 3R45B 5B1LA 4HGAC 5B2JD 5AV6B 1P3OD 1P3MA 1P34C 5B2JB 3KWQC 1P3OB 5BT1C 3H0MC 3C1CB 3AZED 3LELD 3REHC 4KGCA 1ID3C 3B6FC 4ZUXB 3AZEB 5B31B 3LELB 3C1BC 3W96D 3AZHA 2ZY4A 3NQJA 3B6GC 5AV5D 2PYOA 3C1CC 3MNNC 2HIOB 3WTPD 2AROA 4H9OB 5B31C 3KXBB 3WTPB 3NQUA 3RELD 1P3AB 3AN2A 3REIA 1EQZC 4JJND 5CPKA 3MGPD 4CSRA 5GSUB 3RELB 2HIOC 4M6BA 3IP4C 2ZM5A 4CAYB 5DNND 3KUYB 4XUJB 1KX3D 5AVCC 3X1UB 4JJNB 3MGPB 3KXBC 1TZYA 5DNNB 1P3AC 5AV9D 2DF4C 2CV5A 1S32A 3KWQA 1B67A 4J8WD 2FJ7C 4YM6B 5GSUC 3WTPE 3W99C 4LD9C 3EPJA 4QLCA 4KHAB 5B2IC 4XUJC 3KUYC 2NZDD 3X1UC 5B1MC 5GT0A 1ID3A 4R8PD 3MGQA 3A1IA 3WA9B 2NZDB 4H9NB 2RVQC 5BO0B 4YM6C 1BH9B 4NE3A 4WV4B 3AZND 4Z66B 3MGSA 1AOID 4WU9A 5B0YD 1M1AB 3WA9C 3UTAA 1AOIB 3AFAA 2ZY5A 5JA4A 3UT9C 2NQBD 5B0YB 2CWEA 4Z66C 5AV8D 3AZKA 5CP6C 5B40C 5DNMA 2NQBB 4AWLC 1M1AC 4H9PB 3AZJB 5AV8B 1M18D 4J8UB 3X1VD 3AYWD 2FJ7A 3O62C 1M18B 5F99C 3AZMA 3W97A 3X1VB 3REJA 5B32D 1P3MD 4J8XC 1M19B 3LZ1A 1P3KD 2BYKA 5GXQA 4YS3C 4J8UC 4ZBJC 5B32B 1F66C 1P3MB 5B33A 3TU4D 2BYMB 1KX5D 5KDMB 1W2EA 4KUDA 1M19C 4WNNA 5B1LC 3TU4B 4KGCB 1P3LA 4XZQA 3AZHB 3VH5A 3X1SA 5E5AA 3AZFA 5JRGA 3UTBA 1TAFA 5B40A 4EO5C 5CPID 4KGCC 3LZ0A 3AN2D 5B24D 3AZHC 3NQUB 2W8SA 1Q9CA 5G49A 2PYOC 1Z2CB 3AN2B 4H9QB 1JFIB 5CPKB 1U35A 4CSRB 3AV2A 1P34D 2AROC 4HGAB 3KWQD 4Z5TA 5BT1D 1T3UA 1B6WA 4DRBA 1KX4A 1TZYB 1P34B 3VH6W 5BS7A 3REIC 4NE5A 3KWQB 3REHD 3EPHA 5CPKC 4Z2MH 1ID3D 3B6FD 3C1BD 3REHB 3B6GD 2F8NG 1ID3B 3LJAC 3B6FB 3C1CD 1TZYC 3MNND 3C1BB 5GT3A 1F1EA 2CV5C 1S32C 5AY8A 2Y2MA 3B6GB 3P5JB 3MNNB 4ZUXD 5B31D 4QLCC 3W98C 2F8NH 1P3GA 5GT0C 2Y2QA 4H9SA 1EQZD 3MGQC 2HIOD 3MVDA 5JA4B 1EQZB 5AVCD 3AZGA 4J8VA 3KXBD 5BNXA 3MGSC 4X23A 1P3AD 4WU9C 5AVCB 3X1TA 4WU8C 5GSUD 3UTAC 3W99D 4LD9D 5CHLB 5B2ID 3KUYD 4XUJD 2YFVB 3AFAC 5B0ZA 3X1UD 5CPJA 2FJ7B 1HQ3A 3B0CW 5B1MD 3W99B 4LD9B 3W97B 3AZKC 5B2IB 3REJB 5AVBA 5DNMC 3WKJA 1P3BA 5B1MB 2RVQD 2BYKB 3LJAA 4YM6D 3VH5T 4WZSB 3REKA 3WAAA 1A7WA 1P3FA 3AZMC 3W97C 3REJC 3W98A 3WA9D 3LZ1C 5GXQC 3UT9D 4XZQB 1ZLAA 4Z66D 5B33C 1BH8B 3AZLA 5CP6D 5B40D 3UT9B 5E5AB 1M1AD 1P3PA 5JRGB 4KUDC 5CP6B 1TAFB 3UTBB 5B40B 4E45A 4WU8A 4XZQC 3LZ0B 4AWLB 1P3LC 3O62D 5F99D 2Y2IA 1N1JA 3MGRA 3X1SC 5E5AC 4J8XD 3R45A 3O62B 3A6NA 3AZFC 3AZJD 5AV6A 5JRGC 5F99B 4YS3D 3UTBC 4J8UD 1P3IA 3AV2B 1F66D 4J8XB 3LZ0C 2JE5A 5C3IC 5B2JA 4YS3B 2XD5A 1P3OA 2Y2NA 4ZBJB 1F66B 4UPKA 3EPKA 1M19D 5B1LD 1U35C 3AV2C 3AZEA 3H0LC 5B1LB 4DQYB 2F8NA 2Y2GA 4Z5TC 1KX4C 3B0DC 3W96A 5BS7C 5GT3B 2F2AC 2Y2KA 5AV5A 4KGCD 4H9OA 3AZIC 3AZHD 1P3GB 2YFWA 4UUZA 3WTPA 4EO5B 2PYOD 2ZY3A 4G91C 4WJ3C 5GT3C 3NQJB 5AY8C 3RELA 3MVDB 2PYOB 2AROD 4JJNA 3AZGB 4J8VB 3MGPA 2FFFB 1P3GC 1ULYA 2AROB 5DNNA 1KX3A 3REID 4H9SC 5CPKD 2G5IC 4G92B 3MVDC 3REIB 5AV9A 4KHAA 3VH6A 5CPJB 4J8WA 3AZGC 2JCHA 4J8VC 3AV1C 5FUGA 3H0RC 4X23C 1TZYD 4Z2MG 5AVBB 2NZDA 3X1TC 2CV5D 1S32D 4H9NA 1P3BB 5BO0A 3LJAB 4R8PA 4G92C 2Y2HA 4QLCD 2CV5B 1S32B 1P3FB 5B0ZC 5CPJC 1BFMA 1HQ3C 5GT0D 3AZIA 4QLCB 3AZNA 5AVBC 3MGQD 3W98B 3WKJC 1P3BC 5GT0B 1AOIA 2Y2OA 2DQNC 3REKC 3WAAC 3MGQB 1ZLAB 5B0YA 2HUEC 1P3FC 3MGSD 3AZLB 1PZRA 4WU9D 2NQBA 4WU8D 3MGSB 5AV8A 3UTAD 4WU9B 3AFAD 2IO5B 4WU8B 5BNVA 1ZLAC 3UTAB 1M18A 2L5AA 3AZKD 3AZLC 3X1VA 1N1JB 3AYWA 3V9RA 3AFAB 5DNMD 3A6NB 3AV1A 2RIQA 1P3PC 3FDDA 3AZKB 1P3IB 5DNMB 5B32A 2IO5C 2FJ7D 1P3KA 3AZMD 3W97D 3REJD 2BYMA 3MGRC 5KDMA 1HTAA 4H9RA 3LZ1D 3A6NC 3EPLA 5GXQD 3TU4A 2F8ND 5AV6C 3AZMB 1H3OA 1KX5A 1P3IC 5B33D 3LZ1B 2F8NK 5GXQB 2F8NB 5B2JC 1P3OC 1R4VA 3W96B 5B33B 4KUDD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AV5 B;  1P3L D;  4XZQ D;  4ZUX C;  3AZE C;  4KUD B;  3LEL C;  4WNN B;  2YFW B;  4UUZ B;  3X1S D;  5CPI A;  5E5A D;  1P3L B;  3W96 C;  5B24 A;  4H9Q A;  3AZF D;  1JFI A;  5JRG D;  3VH6 T;  3UTB D;  3X1S B;  5AV5 C;  3LZ0 D;  3AZF B;  3WTP C;  1P34 A;  1KX3 B;  5C3I B;  1U35 D;  1KU5 A;  3REL C;  5G49 B;  3AV2 D;  5AV9 B;  4J8W B;  4JJN C;  3REH A;  1U35 B;  4Z5T D;  3MGP C;  5FUG B;  3B6F A;  1KX4 D;  5DNN C;  5B32 G;  3C1B A;  1KX3 C;  2LY8 A;  4Z5T B;  3B6G A;  1KX4 B;  4R8P B;  3B0D B;  3C1C A;  3MNN A;  3AZI D;  5AV9 C;  4J8W C;  1WWS A;  3AZI B;  4ZUX A;  5B31 A;  3LEL A;  3AZN B;  5GT3 D;  2NZD C;  5AY8 D;  4G91 B;  4R8P C;  1EQZ A;  1P3G D;  2HIO A;  5AY8 B;  3B0C T;  5AVC A;  3AZN C;  3KXB A;  1AOI C;  3MVD D;  1P3A A;  2YFV A;  4E44 A;  5BNV B;  5B0Y C;  4J8V D;  3AZG D;  3AV1 D;  5GSU A;  3W99 A;  4X23 D;  4LD9 A;  4CAY A;  5B2I A;  3V9R B;  3KUY A;  4XUJ A;  3AYW B;  3X1T D;  3X1U A;  2NQB C;  5B1M A;  3AV1 B;  5BNX B;  3AZJ C;  5AV8 C;  4X23 B;  3X1T B;  5B0Z D;  5CPJ D;  1P3K B;  1HQ3 D;  4DRA A;  4YM6 A;  1M18 C;  3X1V C;  5AVB D;  3AYW C;  5B0Z B;  4H9R B;  3WKJ D;  1P3B D;  1HQ3 B;  3B0B A;  3LJA D;  1H3O B;  3REK D;  3WAA D;  1KX5 B;  3WA9 A;  5B32 C;  1P3M C;  1P3F D;  3WKJ B;  1BH8 A;  1P3K C;  3UT9 A;  3REK B;  1BH9 A;  3WAA B;  3W98 D;  2HUE B;  4NE6 A;  4Z66 A;  5CP6 A;  2JSS A;  3TU4 C;  1WWI A;  1KX5 C;  1M1A A;  3VH5 W;  3KSY A;  5B31 G;  1ZLA D;  3AZL D;  5CPI B;  3O62 A;  5B24 B;  1P3P D;  5F99 A;  4NFT A;  4J8X A;  4H9P A;  1P3P B;  3AZJ A;  4YS3 A;  4J8U A;  1F66 A;  3MGR D;  5CPI C;  3AN2 C;  3A6N D;  5B24 C;  5AV6 D;  3MGR B;  1P3I D;  1M19 A;  3R45 B;  5B1L A;  4HGA C;  5B2J D;  5AV6 B;  1P3O D;  1P3M A;  1P34 C;  5B2J B;  3KWQ C;  1P3O B;  5BT1 C;  3C1C B;  3AZE D;  3LEL D;  3REH C;  4KGC A;  1ID3 C;  3B6F C;  4ZUX B;  3AZE B;  5B31 B;  3LEL B;  3C1B C;  3W96 D;  3AZH A;  3NQJ A;  3B6G C;  5AV5 D;  2PYO A;  3C1C C;  3MNN C;  2HIO B;  3WTP D;  2ARO A;  4H9O B;  5B31 C;  3KXB B;  3WTP B;  3NQU A;  3REL D;  1P3A B;  3AN2 A;  3REI A;  1EQZ C;  4JJN D;  5CPK A;  3MGP D;  4CSR A;  5GSU B;  3REL B;  2HIO C;  4M6B A;  4CAY B;  5DNN D;  3KUY B;  4XUJ B;  1KX3 D;  5AVC C;  3X1U B;  4JJN B;  3MGP B;  3KXB C;  1TZY A;  5DNN B;  1P3A C;  5AV9 D;  2CV5 A;  1S32 A;  3KWQ A;  1B67 A;  4J8W D;  2FJ7 C;  4YM6 B;  5GSU C;  3WTP E;  3W99 C;  4LD9 C;  4QLC A;  4KHA B;  5B2I C;  4XUJ C;  3KUY C;  2NZD D;  3X1U C;  5B1M C;  5GT0 A;  1ID3 A;  4R8P D;  3MGQ A;  3WA9 B;  2NZD B;  4H9N B;  2RVQ C;  5BO0 B;  4YM6 C;  1BH9 B;  4NE3 A;  4WV4 B;  3AZN D;  4Z66 B;  3MGS A;  1AOI D;  4WU9 A;  5B0Y D;  1M1A B;  3WA9 C;  3UTA A;  1AOI B;  3AFA A;  5JA4 A;  3UT9 C;  2NQB D;  5B0Y B;  2CWE A;  4Z66 C;  5AV8 D;  3AZK A;  5CP6 C;  5B40 C;  5DNM A;  2NQB B;  4AWL C;  1M1A C;  4H9P B;  3AZJ B;  5AV8 B;  1M18 D;  4J8U B;  3X1V D;  3AYW D;  2FJ7 A;  3O62 C;  1M18 B;  5F99 C;  3AZM A;  3W97 A;  3X1V B;  3REJ A;  5B32 D;  1P3M D;  4J8X C;  1M19 B;  3LZ1 A;  1P3K D;  2BYK A;  5GXQ A;  4YS3 C;  4J8U C;  4ZBJ C;  5B32 B;  1F66 C;  1P3M B;  5B33 A;  3TU4 D;  2BYM B;  1KX5 D;  5KDM B;  4KUD A;  1M19 C;  4WNN A;  5B1L C;  3TU4 B;  4KGC B;  1P3L A;  4XZQ A;  3AZH B;  3VH5 A;  3X1S A;  5E5A A;  3AZF A;  5JRG A;  3UTB A;  1TAF A;  5B40 A;  4EO5 C;  5CPI D;  4KGC C;  3LZ0 A;  3AN2 D;  5B24 D;  3AZH C;  3NQU B;  1Q9C A;  5G49 A;  2PYO C;  3AN2 B;  4H9Q B;  1JFI B;  5CPK B;  1U35 A;  4CSR B;  3AV2 A;  1P34 D;  2ARO C;  4HGA B;  3KWQ D;  4Z5T A;  5BT1 D;  1B6W A;  4DRB A;  1KX4 A;  1TZY B;  1P34 B;  3VH6 W;  5BS7 A;  3REI C;  4NE5 A;  3KWQ B;  3REH D;  5CPK C;  4Z2M H;  1ID3 D;  3B6F D;  3C1B D;  3REH B;  3B6G D;  2F8N G;  1ID3 B;  3LJA C;  3B6F B;  3C1C D;  1TZY C;  3MNN D;  3C1B B;  5GT3 A;  1F1E A;  2CV5 C;  1S32 C;  5AY8 A;  3B6G B;  3MNN B;  4ZUX D;  5B31 D;  4QLC C;  3W98 C;  2F8N H;  1P3G A;  5GT0 C;  4H9S A;  1EQZ D;  3MGQ C;  2HIO D;  3MVD A;  5JA4 B;  1EQZ B;  5AVC D;  3AZG A;  4J8V A;  3KXB D;  5BNX A;  3MGS C;  4X23 A;  1P3A D;  4WU9 C;  5AVC B;  3X1T A;  4WU8 C;  5GSU D;  3UTA C;  3W99 D;  4LD9 D;  5CHL B;  5B2I D;  3KUY D;  4XUJ D;  2YFV B;  3AFA C;  5B0Z A;  3X1U D;  5CPJ A;  2FJ7 B;  1HQ3 A;  3B0C W;  5B1M D;  3W99 B;  4LD9 B;  3W97 B;  3AZK C;  5B2I B;  3REJ B;  5AVB A;  5DNM C;  3WKJ A;  1P3B A;  5B1M B;  2RVQ D;  2BYK B;  3LJA A;  4YM6 D;  3VH5 T;  4WZS B;  3REK A;  3WAA A;  1A7W A;  1P3F A;  3AZM C;  3W97 C;  3REJ C;  3W98 A;  3WA9 D;  3LZ1 C;  5GXQ C;  3UT9 D;  4XZQ B;  1ZLA A;  4Z66 D;  5B33 C;  1BH8 B;  3AZL A;  5CP6 D;  5B40 D;  3UT9 B;  5E5A B;  1M1A D;  1P3P A;  5JRG B;  4KUD C;  5CP6 B;  1TAF B;  3UTB B;  5B40 B;  4E45 A;  4WU8 A;  4XZQ C;  3LZ0 B;  4AWL B;  1P3L C;  3O62 D;  5F99 D;  1N1J A;  3MGR A;  3X1S C;  5E5A C;  4J8X D;  3R45 A;  3O62 B;  3A6N A;  3AZF C;  3AZJ D;  5F99 B;  4YS3 D;  5AV6 A;  5JRG C;  3UTB C;  4J8U D;  1P3I A;  3AV2 B;  1F66 D;  4J8X B;  3LZ0 C;  5C3I C;  5B2J A;  4YS3 B;  1P3O A;  4ZBJ B;  1F66 B;  1M19 D;  5B1L D;  1U35 C;  3AV2 C;  3AZE A;  5B1L B;  2F8N A;  4Z5T C;  1KX4 C;  3B0D C;  3W96 A;  5BS7 C;  5GT3 B;  5AV5 A;  4KGC D;  4H9O A;  3AZI C;  3AZH D;  1P3G B;  2YFW A;  4UUZ A;  3WTP A;  4EO5 B;  2PYO D;  4G91 C;  5GT3 C;  3NQJ B;  5AY8 C;  3REL A;  3MVD B;  2PYO B;  2ARO D;  4JJN A;  3AZG B;  4J8V B;  3MGP A;  1P3G C;  1ULY A;  2ARO B;  5DNN A;  1KX3 A;  3REI D;  4H9S C;  5CPK D;  4G92 B;  3MVD C;  3REI B;  5AV9 A;  4KHA A;  3VH6 A;  5CPJ B;  4J8W A;  3AZG C;  4J8V C;  3AV1 C;  5FUG A;  4X23 C;  1TZY D;  4Z2M G;  5AVB B;  2NZD A;  3X1T C;  2CV5 D;  1S32 D;  4H9N A;  1P3B B;  5BO0 A;  3LJA B;  4R8P A;  4G92 C;  4QLC D;  2CV5 B;  1S32 B;  1P3F B;  5B0Z C;  5CPJ C;  1BFM A;  1HQ3 C;  5GT0 D;  3AZI A;  4QLC B;  3AZN A;  5AVB C;  3MGQ D;  3W98 B;  3WKJ C;  1P3B C;  5GT0 B;  1AOI A;  3REK C;  3WAA C;  3MGQ B;  1ZLA B;  5B0Y A;  2HUE C;  1P3F C;  3MGS D;  3AZL B;  4WU9 D;  2NQB A;  4WU8 D;  3MGS B;  5AV8 A;  3UTA D;  4WU9 B;  3AFA D;  2IO5 B;  4WU8 B;  5BNV A;  1ZLA C;  3UTA B;  1M18 A;  2L5A A;  3AZK D;  3AZL C;  3X1V A;  1N1J B;  3AYW A;  3V9R A;  3AFA B;  5DNM D;  3A6N B;  3AV1 A;  1P3P C;  3AZK B;  1P3I B;  5DNM B;  5B32 A;  2IO5 C;  2FJ7 D;  1P3K A;  3AZM D;  3W97 D;  3REJ D;  2BYM A;  3MGR C;  5KDM A;  1HTA A;  4H9R A;  3LZ1 D;  3A6N C;  3TU4 A;  5GXQ D;  2F8N D;  5AV6 C;  3AZM B;  1H3O A;  1KX5 A;  1P3I C;  5B33 D;  3LZ1 B;  2F8N K;  5GXQ B;  2F8N B;  5B2J C;  1P3O C;  1R4V A;  3W96 B;  5B33 B;  4KUD D; 
#chains in the Genus database with same CATH topology
 2XD1 A;  5AV5 B;  1P3L D;  4XZQ D;  2VQR A;  4ZUX C;  3AZE C;  4KUD B;  3LEL C;  4WNN B;  2YFW B;  4UUZ B;  3X1S D;  5CPI A;  5E5A D;  1P3L B;  3KFU G;  3W96 C;  5B24 A;  4H9Q A;  3AZF D;  1JFI A;  3A1K A;  5JRG D;  3VH6 T;  3UTB D;  3X1S B;  5AV5 C;  3LZ0 D;  3AZF B;  3WTP C;  2UWX A;  3EG5 B;  1P34 A;  1KX3 B;  5C3I B;  2Y2J A;  1U35 D;  1KU5 A;  3REL C;  5G49 B;  3AV2 D;  5AV9 B;  4J8W B;  4JJN C;  3REH A;  1U35 B;  4Z5T D;  3MGP C;  3AL0 C;  5FUG B;  3B6F A;  1KX4 D;  5DNN C;  5B32 G;  3C1B A;  1KX3 C;  2LY8 A;  4Z5T B;  3B6G A;  1KX4 B;  4R8P B;  3B0D B;  3C1C A;  3MNN A;  3AZI D;  5AV9 C;  4J8W C;  1WWS A;  3AZI B;  4ZUX A;  5B31 A;  3LEL A;  3AZN B;  5GT3 D;  2NZD C;  5AY8 D;  4G91 B;  4R8P C;  1EQZ A;  1P3G D;  2HIO A;  5AY8 B;  3B0C T;  5AVC A;  2ZY2 A;  3AZN C;  3KXB A;  3F6T A;  1AOI C;  3MVD D;  1P3A A;  2Y2L A;  2YFV A;  4E44 A;  5BNV B;  5B0Y C;  4J8V D;  3AZG D;  3AV1 D;  5GSU A;  3W99 A;  4X23 D;  4LD9 A;  4CAY A;  5B2I A;  3V9R B;  3KUY A;  4XUJ A;  3AYW B;  2BG1 A;  3X1U A;  3X1T D;  2NQB C;  5B1M A;  3AV1 B;  5BNX B;  3AZJ C;  5AV8 C;  4X23 B;  3X1T B;  5B0Z D;  5CPJ D;  1P3K B;  1HQ3 D;  4DRA A;  4YM6 A;  1M18 C;  3X1V C;  5AVB D;  3AYW C;  5B0Z B;  4H9R B;  3WKJ D;  1P3B D;  1HQ3 B;  3B0B A;  3LJA D;  1H3O B;  3REK D;  3WAA D;  1KX5 B;  3WA9 A;  5B32 C;  1P3M C;  1P3F D;  3WKJ B;  1BH8 A;  1P3K C;  3UT9 A;  3REK B;  1BH9 A;  3WAA B;  3W98 D;  2HUE B;  4NE6 A;  4Z66 A;  2J8P A;  5CP6 A;  2JSS A;  3TU4 C;  2G5H C;  1WWI A;  1KX5 C;  1M1A A;  3VH5 W;  3KSY A;  5B31 G;  1ZLA D;  3AZL D;  5CPI B;  3O62 A;  5B24 B;  1P3P D;  5F99 A;  4NFT A;  4J8X A;  4H9P A;  1P3P B;  3AZJ A;  4YS3 A;  4J8U A;  1F66 A;  3MGR D;  5CPI C;  3AN2 C;  2Y2P A;  3A6N D;  5B24 C;  5AV6 D;  3MGR B;  1P3I D;  1M19 A;  3R45 B;  5B1L A;  4HGA C;  5B2J D;  5AV6 B;  1P3O D;  1P3M A;  1P34 C;  5B2J B;  3KWQ C;  1P3O B;  5BT1 C;  3H0M C;  3C1C B;  3AZE D;  3LEL D;  3REH C;  4KGC A;  1ID3 C;  3B6F C;  4ZUX B;  3AZE B;  5B31 B;  3LEL B;  3C1B C;  3W96 D;  3AZH A;  2ZY4 A;  3NQJ A;  3B6G C;  5AV5 D;  2PYO A;  3C1C C;  3MNN C;  2HIO B;  3WTP D;  2ARO A;  4H9O B;  5B31 C;  3KXB B;  3WTP B;  3NQU A;  3REL D;  1P3A B;  3AN2 A;  3REI A;  1EQZ C;  4JJN D;  5CPK A;  3MGP D;  4CSR A;  5GSU B;  3REL B;  2HIO C;  4M6B A;  3IP4 C;  2ZM5 A;  4CAY B;  5DNN D;  3KUY B;  4XUJ B;  1KX3 D;  5AVC C;  3X1U B;  4JJN B;  3MGP B;  3KXB C;  1TZY A;  5DNN B;  1P3A C;  5AV9 D;  2DF4 C;  2CV5 A;  1S32 A;  3KWQ A;  1B67 A;  4J8W D;  2FJ7 C;  4YM6 B;  5GSU C;  3WTP E;  3W99 C;  4LD9 C;  3EPJ A;  4QLC A;  4KHA B;  5B2I C;  4XUJ C;  3KUY C;  2NZD D;  3X1U C;  5B1M C;  5GT0 A;  1ID3 A;  4R8P D;  3MGQ A;  3A1I A;  3WA9 B;  2NZD B;  4H9N B;  2RVQ C;  5BO0 B;  4YM6 C;  1BH9 B;  4NE3 A;  4WV4 B;  3AZN D;  4Z66 B;  3MGS A;  1AOI D;  4WU9 A;  5B0Y D;  1M1A B;  3WA9 C;  3UTA A;  1AOI B;  3AFA A;  2ZY5 A;  5JA4 A;  3UT9 C;  2NQB D;  5B0Y B;  2CWE A;  4Z66 C;  5AV8 D;  3AZK A;  5CP6 C;  5B40 C;  5DNM A;  2NQB B;  4AWL C;  1M1A C;  4H9P B;  3AZJ B;  5AV8 B;  1M18 D;  4J8U B;  3X1V D;  3AYW D;  2FJ7 A;  3O62 C;  1M18 B;  5F99 C;  3AZM A;  3W97 A;  3X1V B;  3REJ A;  5B32 D;  1P3M D;  4J8X C;  1M19 B;  3LZ1 A;  1P3K D;  2BYK A;  5GXQ A;  4YS3 C;  4J8U C;  4ZBJ C;  5B32 B;  1F66 C;  1P3M B;  5B33 A;  3TU4 D;  2BYM B;  1KX5 D;  5KDM B;  1W2E A;  4KUD A;  1M19 C;  4WNN A;  5B1L C;  3TU4 B;  4KGC B;  1P3L A;  4XZQ A;  3AZH B;  3VH5 A;  3X1S A;  5E5A A;  3AZF A;  5JRG A;  3UTB A;  1TAF A;  5B40 A;  4EO5 C;  5CPI D;  4KGC C;  3LZ0 A;  3AN2 D;  5B24 D;  3AZH C;  3NQU B;  2W8S A;  1Q9C A;  5G49 A;  2PYO C;  1Z2C B;  3AN2 B;  4H9Q B;  1JFI B;  5CPK B;  1U35 A;  4CSR B;  3AV2 A;  1P34 D;  2ARO C;  4HGA B;  3KWQ D;  4Z5T A;  5BT1 D;  1T3U A;  1B6W A;  4DRB A;  1KX4 A;  1TZY B;  1P34 B;  3VH6 W;  5BS7 A;  3REI C;  4NE5 A;  3KWQ B;  3REH D;  3EPH A;  5CPK C;  4Z2M H;  1ID3 D;  3B6F D;  3C1B D;  3REH B;  3B6G D;  2F8N G;  1ID3 B;  3LJA C;  3B6F B;  3C1C D;  1TZY C;  3MNN D;  3C1B B;  5GT3 A;  1F1E A;  2CV5 C;  1S32 C;  5AY8 A;  2Y2M A;  3B6G B;  3P5J B;  3MNN B;  4ZUX D;  5B31 D;  4QLC C;  3W98 C;  2F8N H;  1P3G A;  5GT0 C;  2Y2Q A;  4H9S A;  1EQZ D;  3MGQ C;  2HIO D;  3MVD A;  5JA4 B;  1EQZ B;  5AVC D;  3AZG A;  4J8V A;  3KXB D;  5BNX A;  3MGS C;  4X23 A;  1P3A D;  4WU9 C;  5AVC B;  3X1T A;  4WU8 C;  5GSU D;  3UTA C;  3W99 D;  4LD9 D;  5CHL B;  5B2I D;  3KUY D;  4XUJ D;  2YFV B;  3AFA C;  5B0Z A;  3X1U D;  5CPJ A;  2FJ7 B;  1HQ3 A;  3B0C W;  5B1M D;  3W99 B;  4LD9 B;  3W97 B;  3AZK C;  5B2I B;  3REJ B;  5AVB A;  5DNM C;  3WKJ A;  1P3B A;  5B1M B;  2RVQ D;  2BYK B;  3LJA A;  4YM6 D;  3VH5 T;  4WZS B;  3REK A;  3WAA A;  1A7W A;  1P3F A;  3AZM C;  3W97 C;  3REJ C;  3W98 A;  3WA9 D;  3LZ1 C;  5GXQ C;  3UT9 D;  4XZQ B;  1ZLA A;  4Z66 D;  5B33 C;  1BH8 B;  3AZL A;  5CP6 D;  5B40 D;  3UT9 B;  5E5A B;  1M1A D;  1P3P A;  5JRG B;  4KUD C;  5CP6 B;  1TAF B;  3UTB B;  5B40 B;  4E45 A;  4WU8 A;  4XZQ C;  3LZ0 B;  4AWL B;  1P3L C;  3O62 D;  5F99 D;  2Y2I A;  1N1J A;  3MGR A;  3X1S C;  5E5A C;  4J8X D;  3R45 A;  3O62 B;  3A6N A;  3AZF C;  3AZJ D;  5AV6 A;  5JRG C;  5F99 B;  4YS3 D;  3UTB C;  4J8U D;  1P3I A;  3AV2 B;  1F66 D;  4J8X B;  3LZ0 C;  2JE5 A;  5C3I C;  5B2J A;  4YS3 B;  2XD5 A;  1P3O A;  2Y2N A;  4ZBJ B;  1F66 B;  4UPK A;  3EPK A;  1M19 D;  5B1L D;  1U35 C;  3AV2 C;  3AZE A;  3H0L C;  5B1L B;  4DQY B;  2F8N A;  2Y2G A;  4Z5T C;  1KX4 C;  3B0D C;  3W96 A;  5BS7 C;  5GT3 B;  2F2A C;  2Y2K A;  5AV5 A;  4KGC D;  4H9O A;  3AZI C;  3AZH D;  1P3G B;  2YFW A;  4UUZ A;  3WTP A;  4EO5 B;  2PYO D;  2ZY3 A;  4G91 C;  4WJ3 C;  5GT3 C;  3NQJ B;  5AY8 C;  3REL A;  3MVD B;  2PYO B;  2ARO D;  4JJN A;  3AZG B;  4J8V B;  3MGP A;  2FFF B;  1P3G C;  1ULY A;  2ARO B;  5DNN A;  1KX3 A;  3REI D;  4H9S C;  5CPK D;  2G5I C;  4G92 B;  3MVD C;  3REI B;  5AV9 A;  4KHA A;  3VH6 A;  5CPJ B;  4J8W A;  3AZG C;  2JCH A;  4J8V C;  3AV1 C;  5FUG A;  3H0R C;  4X23 C;  1TZY D;  4Z2M G;  5AVB B;  2NZD A;  3X1T C;  2CV5 D;  1S32 D;  4H9N A;  1P3B B;  5BO0 A;  3LJA B;  4R8P A;  4G92 C;  2Y2H A;  4QLC D;  2CV5 B;  1S32 B;  1P3F B;  5B0Z C;  5CPJ C;  1BFM A;  1HQ3 C;  5GT0 D;  3AZI A;  4QLC B;  3AZN A;  5AVB C;  3MGQ D;  3W98 B;  3WKJ C;  1P3B C;  5GT0 B;  1AOI A;  2Y2O A;  2DQN C;  3REK C;  3WAA C;  3MGQ B;  1ZLA B;  5B0Y A;  2HUE C;  1P3F C;  3MGS D;  3AZL B;  1PZR A;  4WU9 D;  2NQB A;  4WU8 D;  3MGS B;  5AV8 A;  3UTA D;  4WU9 B;  3AFA D;  2IO5 B;  4WU8 B;  5BNV A;  1ZLA C;  3UTA B;  1M18 A;  2L5A A;  3AZK D;  3AZL C;  3X1V A;  1N1J B;  3AYW A;  3V9R A;  3AFA B;  5DNM D;  3A6N B;  3AV1 A;  2RIQ A;  1P3P C;  3FDD A;  3AZK B;  1P3I B;  5DNM B;  5B32 A;  2IO5 C;  2FJ7 D;  1P3K A;  3AZM D;  3W97 D;  3REJ D;  2BYM A;  3MGR C;  5KDM A;  1HTA A;  4H9R A;  3LZ1 D;  3A6N C;  3EPL A;  5GXQ D;  3TU4 A;  2F8N D;  5AV6 C;  3AZM B;  1H3O A;  1KX5 A;  1P3I C;  5B33 D;  3LZ1 B;  2F8N K;  5GXQ B;  2F8N B;  5B2J C;  1P3O C;  1R4V A;  3W96 B;  5B33 B;  4KUD D; 
#chains in the Genus database with same CATH homology
 2XD1 A;  5AV5 B;  1P3L D;  4XZQ D;  2VQR A;  4ZUX C;  3AZE C;  4KUD B;  3LEL C;  4WNN B;  2YFW B;  4UUZ B;  3X1S D;  5CPI A;  5E5A D;  1P3L B;  3KFU G;  3W96 C;  5B24 A;  4H9Q A;  3AZF D;  1JFI A;  3A1K A;  5JRG D;  3VH6 T;  3UTB D;  3X1S B;  5AV5 C;  3LZ0 D;  3AZF B;  3WTP C;  2UWX A;  3EG5 B;  1P34 A;  1KX3 B;  5C3I B;  2Y2J A;  1U35 D;  1KU5 A;  3REL C;  5G49 B;  3AV2 D;  5AV9 B;  4J8W B;  4JJN C;  3REH A;  1U35 B;  4Z5T D;  3MGP C;  3AL0 C;  5FUG B;  3B6F A;  1KX4 D;  5DNN C;  5B32 G;  3C1B A;  1KX3 C;  2LY8 A;  4Z5T B;  3B6G A;  1KX4 B;  4R8P B;  3B0D B;  3C1C A;  3MNN A;  3AZI D;  5AV9 C;  4J8W C;  1WWS A;  3AZI B;  4ZUX A;  5B31 A;  3LEL A;  3AZN B;  5GT3 D;  2NZD C;  5AY8 D;  4G91 B;  4R8P C;  1EQZ A;  1P3G D;  2HIO A;  5AY8 B;  3B0C T;  5AVC A;  2ZY2 A;  3AZN C;  3KXB A;  3F6T A;  1AOI C;  3MVD D;  1P3A A;  2Y2L A;  2YFV A;  4E44 A;  5BNV B;  5B0Y C;  4J8V D;  3AZG D;  3AV1 D;  5GSU A;  3W99 A;  4X23 D;  4LD9 A;  4CAY A;  5B2I A;  3V9R B;  3KUY A;  4XUJ A;  3AYW B;  2BG1 A;  3X1U A;  3X1T D;  2NQB C;  5B1M A;  3AV1 B;  5BNX B;  3AZJ C;  5AV8 C;  4X23 B;  3X1T B;  5B0Z D;  5CPJ D;  1P3K B;  1HQ3 D;  4DRA A;  4YM6 A;  1M18 C;  3X1V C;  5AVB D;  3AYW C;  5B0Z B;  4H9R B;  3WKJ D;  1P3B D;  1HQ3 B;  3B0B A;  3LJA D;  1H3O B;  3REK D;  3WAA D;  1KX5 B;  3WA9 A;  5B32 C;  1P3M C;  1P3F D;  3WKJ B;  1BH8 A;  1P3K C;  3UT9 A;  3REK B;  1BH9 A;  3WAA B;  3W98 D;  2HUE B;  4NE6 A;  4Z66 A;  2J8P A;  5CP6 A;  2JSS A;  3TU4 C;  2G5H C;  1WWI A;  1KX5 C;  1M1A A;  3VH5 W;  3KSY A;  5B31 G;  1ZLA D;  3AZL D;  5CPI B;  3O62 A;  5B24 B;  1P3P D;  5F99 A;  4NFT A;  4J8X A;  4H9P A;  1P3P B;  3AZJ A;  4YS3 A;  4J8U A;  1F66 A;  3MGR D;  5CPI C;  3AN2 C;  2Y2P A;  3A6N D;  5B24 C;  5AV6 D;  3MGR B;  1P3I D;  1M19 A;  3R45 B;  5B1L A;  4HGA C;  5B2J D;  5AV6 B;  1P3O D;  1P3M A;  1P34 C;  5B2J B;  3KWQ C;  1P3O B;  5BT1 C;  3H0M C;  3C1C B;  3AZE D;  3LEL D;  3REH C;  4KGC A;  1ID3 C;  3B6F C;  4ZUX B;  3AZE B;  5B31 B;  3LEL B;  3C1B C;  3W96 D;  3AZH A;  2ZY4 A;  3NQJ A;  3B6G C;  5AV5 D;  2PYO A;  3C1C C;  3MNN C;  2HIO B;  3WTP D;  2ARO A;  4H9O B;  5B31 C;  3KXB B;  3WTP B;  3NQU A;  3REL D;  1P3A B;  3AN2 A;  3REI A;  1EQZ C;  4JJN D;  5CPK A;  3MGP D;  4CSR A;  5GSU B;  3REL B;  2HIO C;  4M6B A;  3IP4 C;  2ZM5 A;  4CAY B;  5DNN D;  3KUY B;  4XUJ B;  1KX3 D;  5AVC C;  3X1U B;  4JJN B;  3MGP B;  3KXB C;  1TZY A;  5DNN B;  1P3A C;  5AV9 D;  2DF4 C;  2CV5 A;  1S32 A;  3KWQ A;  1B67 A;  4J8W D;  2FJ7 C;  4YM6 B;  5GSU C;  3WTP E;  3W99 C;  4LD9 C;  3EPJ A;  4QLC A;  4KHA B;  5B2I C;  4XUJ C;  3KUY C;  2NZD D;  3X1U C;  5B1M C;  5GT0 A;  1ID3 A;  4R8P D;  3MGQ A;  3A1I A;  3WA9 B;  2NZD B;  4H9N B;  2RVQ C;  5BO0 B;  4YM6 C;  1BH9 B;  4NE3 A;  4WV4 B;  3AZN D;  4Z66 B;  3MGS A;  1AOI D;  4WU9 A;  5B0Y D;  1M1A B;  3WA9 C;  3UTA A;  1AOI B;  3AFA A;  2ZY5 A;  5JA4 A;  3UT9 C;  2NQB D;  5B0Y B;  2CWE A;  4Z66 C;  5AV8 D;  3AZK A;  5CP6 C;  5B40 C;  5DNM A;  2NQB B;  4AWL C;  1M1A C;  4H9P B;  3AZJ B;  5AV8 B;  1M18 D;  4J8U B;  3X1V D;  3AYW D;  2FJ7 A;  3O62 C;  1M18 B;  5F99 C;  3AZM A;  3W97 A;  3X1V B;  3REJ A;  5B32 D;  1P3M D;  4J8X C;  1M19 B;  3LZ1 A;  1P3K D;  2BYK A;  5GXQ A;  4YS3 C;  4J8U C;  4ZBJ C;  5B32 B;  1F66 C;  1P3M B;  5B33 A;  3TU4 D;  2BYM B;  1KX5 D;  5KDM B;  1W2E A;  4KUD A;  1M19 C;  4WNN A;  5B1L C;  3TU4 B;  4KGC B;  1P3L A;  4XZQ A;  3AZH B;  3VH5 A;  3X1S A;  5E5A A;  3AZF A;  5JRG A;  3UTB A;  1TAF A;  5B40 A;  4EO5 C;  5CPI D;  4KGC C;  3LZ0 A;  3AN2 D;  5B24 D;  3AZH C;  3NQU B;  2W8S A;  1Q9C A;  5G49 A;  2PYO C;  1Z2C B;  3AN2 B;  4H9Q B;  1JFI B;  5CPK B;  1U35 A;  4CSR B;  3AV2 A;  1P34 D;  2ARO C;  4HGA B;  3KWQ D;  4Z5T A;  5BT1 D;  1T3U A;  1B6W A;  4DRB A;  1KX4 A;  1TZY B;  1P34 B;  3VH6 W;  5BS7 A;  3REI C;  4NE5 A;  3KWQ B;  3REH D;  3EPH A;  5CPK C;  4Z2M H;  1ID3 D;  3B6F D;  3C1B D;  3REH B;  3B6G D;  2F8N G;  1ID3 B;  3LJA C;  3B6F B;  3C1C D;  1TZY C;  3MNN D;  3C1B B;  5GT3 A;  1F1E A;  2CV5 C;  1S32 C;  5AY8 A;  2Y2M A;  3B6G B;  3P5J B;  3MNN B;  4ZUX D;  5B31 D;  4QLC C;  3W98 C;  2F8N H;  1P3G A;  5GT0 C;  2Y2Q A;  4H9S A;  1EQZ D;  3MGQ C;  2HIO D;  3MVD A;  5JA4 B;  1EQZ B;  5AVC D;  3AZG A;  4J8V A;  3KXB D;  5BNX A;  3MGS C;  4X23 A;  1P3A D;  4WU9 C;  5AVC B;  3X1T A;  4WU8 C;  5GSU D;  3UTA C;  3W99 D;  4LD9 D;  5CHL B;  5B2I D;  3KUY D;  4XUJ D;  2YFV B;  3AFA C;  5B0Z A;  3X1U D;  5CPJ A;  2FJ7 B;  1HQ3 A;  3B0C W;  5B1M D;  3W99 B;  4LD9 B;  3W97 B;  3AZK C;  5B2I B;  3REJ B;  5AVB A;  5DNM C;  3WKJ A;  1P3B A;  5B1M B;  2RVQ D;  2BYK B;  3LJA A;  4YM6 D;  3VH5 T;  4WZS B;  3REK A;  3WAA A;  1A7W A;  1P3F A;  3AZM C;  3W97 C;  3REJ C;  3W98 A;  3WA9 D;  3LZ1 C;  5GXQ C;  3UT9 D;  4XZQ B;  1ZLA A;  4Z66 D;  5B33 C;  1BH8 B;  3AZL A;  5CP6 D;  5B40 D;  3UT9 B;  5E5A B;  1M1A D;  1P3P A;  5JRG B;  4KUD C;  5CP6 B;  1TAF B;  3UTB B;  5B40 B;  4E45 A;  4WU8 A;  4XZQ C;  3LZ0 B;  4AWL B;  1P3L C;  3O62 D;  5F99 D;  2Y2I A;  1N1J A;  3MGR A;  3X1S C;  5E5A C;  4J8X D;  3R45 A;  3O62 B;  3A6N A;  3AZF C;  3AZJ D;  5AV6 A;  5JRG C;  5F99 B;  4YS3 D;  3UTB C;  4J8U D;  1P3I A;  3AV2 B;  1F66 D;  4J8X B;  3LZ0 C;  2JE5 A;  5C3I C;  5B2J A;  4YS3 B;  2XD5 A;  1P3O A;  2Y2N A;  4ZBJ B;  1F66 B;  4UPK A;  3EPK A;  1M19 D;  5B1L D;  1U35 C;  3AV2 C;  3AZE A;  3H0L C;  5B1L B;  4DQY B;  2F8N A;  2Y2G A;  4Z5T C;  1KX4 C;  3B0D C;  3W96 A;  5BS7 C;  5GT3 B;  2F2A C;  2Y2K A;  5AV5 A;  4KGC D;  4H9O A;  3AZI C;  3AZH D;  1P3G B;  2YFW A;  4UUZ A;  3WTP A;  4EO5 B;  2PYO D;  2ZY3 A;  4G91 C;  4WJ3 C;  5GT3 C;  3NQJ B;  5AY8 C;  3REL A;  3MVD B;  2PYO B;  2ARO D;  4JJN A;  3AZG B;  4J8V B;  3MGP A;  2FFF B;  1P3G C;  1ULY A;  2ARO B;  5DNN A;  1KX3 A;  3REI D;  4H9S C;  5CPK D;  2G5I C;  4G92 B;  3MVD C;  3REI B;  5AV9 A;  4KHA A;  3VH6 A;  5CPJ B;  4J8W A;  3AZG C;  2JCH A;  4J8V C;  3AV1 C;  5FUG A;  3H0R C;  4X23 C;  1TZY D;  4Z2M G;  5AVB B;  2NZD A;  3X1T C;  2CV5 D;  1S32 D;  4H9N A;  1P3B B;  5BO0 A;  3LJA B;  4R8P A;  4G92 C;  2Y2H A;  4QLC D;  2CV5 B;  1S32 B;  1P3F B;  5B0Z C;  5CPJ C;  1BFM A;  1HQ3 C;  5GT0 D;  3AZI A;  4QLC B;  3AZN A;  5AVB C;  3MGQ D;  3W98 B;  3WKJ C;  1P3B C;  5GT0 B;  1AOI A;  2Y2O A;  2DQN C;  3REK C;  3WAA C;  3MGQ B;  1ZLA B;  5B0Y A;  2HUE C;  1P3F C;  3MGS D;  3AZL B;  1PZR A;  4WU9 D;  2NQB A;  4WU8 D;  3MGS B;  5AV8 A;  3UTA D;  4WU9 B;  3AFA D;  2IO5 B;  4WU8 B;  5BNV A;  1ZLA C;  3UTA B;  1M18 A;  2L5A A;  3AZK D;  3AZL C;  3X1V A;  1N1J B;  3AYW A;  3V9R A;  3AFA B;  5DNM D;  3A6N B;  3AV1 A;  2RIQ A;  1P3P C;  3FDD A;  3AZK B;  1P3I B;  5DNM B;  5B32 A;  2IO5 C;  2FJ7 D;  1P3K A;  3AZM D;  3W97 D;  3REJ D;  2BYM A;  3MGR C;  5KDM A;  1HTA A;  4H9R A;  3LZ1 D;  3A6N C;  3EPL A;  5GXQ D;  3TU4 A;  2F8N D;  5AV6 C;  3AZM B;  1H3O A;  1KX5 A;  1P3I C;  5B33 D;  3LZ1 B;  2F8N K;  5GXQ B;  2F8N B;  5B2J C;  1P3O C;  1R4V A;  3W96 B;  5B33 B;  4KUD D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...