1P3GC

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
104
structure length
104
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 32
structure length 104
sequence length 104
chains with identical sequence G
ec nomenclature
pdb deposition date 2003-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3gC00
3AZFD 1BFMA 3VH6T 3X1SD 5B40B 5CPJA 4J8VC 5GT3A 3WAAB 3AZJA 2CV5B 4R8PB 1HQ3A 5B40D 3AZNA 1KX4A 4Z5TC 3LZ0C 3AZIB 5F99B 1TAFB 4X23B 1M1AB 2CV5D 5BNVA 3REJC 3AZFA 3X1SA 3A6ND 4J8XC 5F99D 2YFVA 4J8UB 3WKJB 1M1AD 3MGRB 5CPJC 5CPIB 5B40A 4J8UD 2HIOA 4G91C 4ZUXC 2CV5A 3MNNB 5CPID 3AZLB 3A6NA 5B31D 5F99A 5AY8C 1M1AA 3MNND 2JSSA 2BYMB 3AZHB 4J8UA 1EQZC 4WV4B 1P3KB 2HIOC 3VH5A 1JFIB 3C1CB 3AZHD 4KHAA 1P3BB 5B31A 1P3KD 5E5AD 5B33B 3AZMC 5CHLB 5GSUA 3C1CD 5CP6A 1P3BD 3UT9A 3X1VB 3VH6A 5B33D 1BH9A 3AYWA 1U35B 3MGPA 4H9NB 3AZHA 3B0BA 1TZYC 4WZSB 1U35D 5E5AA 1P3KA 3KUYB 5AVCB 3C1CA 1P3BA 4YM6D 3KXBB 4NE5A 5GSUC 5CP6C 3KUYD 4NFTA 1ID3B 5AVCD 3UT9C 1B6WA 5B0ZB 4G92B 5AV5A 1R4VA 3KXBD 3MGSB 3KWQB 3AYWC 4ZBJB 3MGPC 1ID3D 2NQBC 3UTBB 5B0ZD 5BO0B 1P3FC 4H9NA 3MGSD 3KWQD 4JJNC 3REKC 4YM6A 1P34B 3UTBD 3KUYA 4HGAB 3WA9D 5AVCA 1WWSA 3V9RA 5GT0B 4WU8B 4WU9C 3KXBA 1KX5B 1M18D 5AV6B 3MGQB 1ID3A 4H9PB 5AV5C 5AV9C 4KGCD 3WTPC 5B0ZA 4WU8D 1Q9CA 1KX5D 3AV1C 5AV6D 3MGQD 3W97B 5DNNB 3UTBA 5BO0A 3WA9A 3MVDB 2FJ7B 3C1BB 4XUJB 3W97D 1M18A 5GXQB 4LD9D 5DNND 4NE3A 4H9QA 4KGCA 3MVDD 2FJ7D 2AROB 3O62C 4WU8A 1KX5A 5AVBD 5GXQD 3MGQA 1KU5A 2HUEC 3W96C 3VH5W 2AROD 2RVQD 4Z66B 1P3OB 1AOIC 5DNMC 5B32D 4E44A 1ZLAB 4H9RB 3W97A 4LD9A 4Z66D 5DNNA 3W99B 3MVDA 1ZLAD 2FJ7A 5B1LC 5AVBA 3VH6W 5GXQA 3LZ1C 2NZDC 2AROA 5JRGA 4M6BA 5B32A 3B6GC 1F66C 4Z66A 1ZLAA 2IO5C 4QLCB 5B2ID 3TU4B 1P3PC 3AZKA 5CPKC 5AVBC 4Z2MH 1S32C 3TU4D 5JRGC 3W98C 3LJAC 3LZ0B 1P3IC 1KX3A 4J8WD 1H3OA 3REJB 5B2IA 3B6FB 1P3GC 1P3LC 3AZKC 3B6FD 1P3AC 3X1UC 4G91B 1BH8B 4CSRB 3AN2C 1M19B 3WAAD 4CAYA 4J8WA 4R8PD 2F8NG 5JA4B 1KX3C 3AZID 4X23D 1M19D 3B6FA 3AFAB 4EO5B 3WKJD 5GT3C 3AZJC 3MGRD 3AZNC 1HQ3C 1KX4C 3WAAA 5C3IB 1F1EA 3AV2B 4R8PA 3AFAD 3AZIA 1BH8A 1TAFA 4CSRA 4X23A 1M19A 3AZFC 3AV2D 3X1SC 3AZMB 3AZLD 5JA4A 4WNNB 3WKJA 1P3MB 3MGRA 5B40C 5CPIA 3AFAA 3LELB 5B24B 1P3MD 2CV5C 3AV2A 3MNNA 3A6NC 5F99C 4X23C 3LELD 5B24D 3AZLA 1M1AC 4J8UC 5B1MB 2BYMA 3B0DB 4WNNA 3X1VD 5CPIC 2BYKB 5B1MD 5B31C 1JFIA 2PYOB 3LELA 5B24A 3RELB 4JJNB 3MNNC 5B2JB 5B33A 2PYOD 3RELD 4WU9B 2F8NB 5B2JD 3X1VA 3AZEB 3AZHC 1U35A 5B1MA 3WTPB 2F8ND 3AV1B 1P3KC 5E5AC 3AZED 3C1CC 2BYKA 3REIB 1P3BC 4AWLB 2PYOA 3RELA 5B33C 1P34D 3REID 4YS3B 5KDMB 3O62B 3UTAB 5GT0D 3MGSA 3KWQA 1U35C 1WWIA 3AZEA 4XZQB 4YS3D 3W96B 3UTAD 5AV8B 4YM6C 4KUDB 3KUYC 4XZQD 5AVCC 5BT1D 1P34A 5AV8D 3KXBC 4KUDD 3X1TB 3C1BD 5GT0A 4XUJD 1ID3C 4UUZB 5AV6A 5B0ZC 4H9PA 4YS3A 3X1TD 5KDMA 3KWQC 3MGSC 3UTAA 2CWEA 4H9SA 3UTBC 3REHB 3WA9C 1F66B 1P3OD 5AV8A 4KUDA 1M18C 3C1BA 4XUJA 4HGAC 5B0YB 3REHD 4KGCC 3AZGB 4WU8C 3W99D 1KX5C 5AV6C 3MGQC 3X1TA 5G49B 4UUZA 5B0YD 3AZGD 4DRBA 3W98B 3R45B 3B0CT 1P3OA 4H9SC 5BS7A 3W97C 4LD9C 4H9RA 5DNNC 2YFWB 3REHA 3MVDC 2FJ7C 2L5AA 4J8VB 2F8NK 3W99A 5GXQC 5B31G 4QLCD 1P3GB 5B0YA 2AROC 2RVQC 3X1UB 5FUGB 4Z5TB 1P3AB 5B32C 4J8VD 5G49A 1HTAA 4Z66C 1N1JB 3NQJB 4Z5TD 4J8XB 3LZ0D 1ZLAC 5BNXB 4QLCA 3REJD 5CPJB 3TU4A 4J8XD 4J8VA 1KX4B 5CPJD 4ZUXB 4Z5TA 3LZ0A 5AY8B 3AZFB 5B2IC 4ZUXD 3X1SB 3REJA 2YFVB 1B67A 5AY8D 1ULYA 5BNXA 3TU4C 1EQZB 2HIOB 4J8WC 1EQZD 2HIOD 4ZUXA 3A6NB 5AY8A 4H9OB 3AZMD 3B6FC 3WAAC 4R8PC 1EQZA 1TZYB 4KHAB 3AZIC 5B31B 1M19C 5GSUB 1TZYD 5CP6B 3AZMA 3WKJC 3UT9B 3MGRC 1P3MA 5GSUD 1BH9B 4H9OA 3AYWB 5CP6D 3MGPB 3AFAC 4EO5C 2NQBB 3UT9D 1P3FB 3AYWD 5C3IC 5E5AB 3AV2C 3REKB 3MGPD 3AZLC 1TZYA 2NQBD 1P3FD 4JJND 3REKD 5B32G 5AV9B 5AV5B 1P3MC 4Z2MG 4WU9D 5AV5D 5AV9D 3LELC 5B24C 2NQBA 3WTPD 4YM6B 3AV1D 1P3FA 4JJNA 3REKA 5B2JA 3V9RB 3X1VC 4WU9A 2F8NA 5B1MC 2HUEB 3B0DC 5AV9A 3O62D 3WTPA 1AOIB 5DNMB 3AV1A 2F8NH 3W96D 2PYOC 3WA9B 3REIA 3RELC 3B0CW 1AOID 5DNMD 5B2JC 1M18B 5B1LB 4H9QB 4KGCB 3LZ1B 2NZDB 3WTPE 4G92C 3O62A 4ZBJC 3AZEC 5B1LD 1A7WA 3LZ1D 3B6GB 2NZDD 4XZQA 3NQUB 3W96A 1AOIA 5DNMA 1P34C 2IO5B 3B6GD 3REIC 4LD9B 4AWLC 1F66D 1P3PB 4DRAA 5GT0C 5CPKB 5AVBB 1S32B 5B1LA 4YS3C 3KSYA 3LZ1A 2NZDA 1P3PD 5JRGB 3UTAC 5B32B 3LJAB 5CPKD 1S32D 1P3IB 4XZQC 5BT1C 3B6GA 5JRGD 5AV8C 3W98D 3NQUA 3LJAD 1F66A 4KUDC 3C1BC 1P3ID 4XUJC 1P3LB 3AZKB 3X1TC 3AZGA 1P3PA 5CPKA 1S32A 1P3GD 3AN2B 1P3LD 3AZKD 1P3AD 3X1UD 1P3OC 1KX3B 5BS7C 3W98A 3LJAA 3R45A 2LY8A 3AN2D 1H3OB 1P3IA 3REHC 5B2IB 1KX3D 2YFWA 3W99C 5GT3B 4E45A 3AZJB 5B0YC 3AZNB 1HQ3B 1P3GA 3AZGC 1P3LA 3VH5T 1P3AA 4NE6A 5FUGA 3X1UA 5GT3D 4CAYB 4J8WB 3AZJD 3AZND 1HQ3D 5BNVB 3AN2A 1KX4D 1N1JA 3NQJA 4J8XA 4QLCC
chains in the Genus database with same CATH superfamily
3AZFD 1BFMA 3VH6T 3X1SD 5B40B 5CPJA 4J8VC 5GT3A 3WAAB 3AZJA 2CV5B 4R8PB 1HQ3A 5B40D 3AZNA 1KX4A 4Z5TC 3LZ0C 3AZIB 5F99B 1TAFB 4X23B 1M1AB 2CV5D 5BNVA 3REJC 3AZFA 3X1SA 3A6ND 4J8XC 5F99D 2YFVA 4J8UB 3WKJB 1M1AD 3MGRB 5CPJC 5CPIB 5B40A 4J8UD 2HIOA 4G91C 4ZUXC 2CV5A 3MNNB 5CPID 3AZLB 3A6NA 5B31D 5F99A 2JCHA 5AY8C 1M1AA 3MNND 2JSSA 2ZM5A 3IP4C 2Y2LA 2BYMB 3AZHB 4J8UA 1EQZC 4WV4B 1P3KB 2HIOC 3VH5A 1JFIB 3C1CB 3AZHD 4KHAA 1P3BB 5B31A 1P3KD 5E5AD 5B33B 3AZMC 5CHLB 5GSUA 3C1CD 5CP6A 1P3BD 3UT9A 3X1VB 3VH6A 5B33D 4WJ3C 1BH9A 3AYWA 1U35B 3EPKA 3MGPA 4H9NB 3AZHA 3B0BA 1TZYC 4WZSB 1U35D 5E5AA 1P3KA 3KUYB 5AVCB 3C1CA 1P3BA 4YM6D 3KXBB 3FDDA 4NE5A 5GSUC 5CP6C 3KUYD 4NFTA 1ID3B 5AVCD 3UT9C 1B6WA 5B0ZB 4G92B 5AV5A 1R4VA 3KXBD 3MGSB 2FFFB 3KWQB 3AYWC 4ZBJB 3MGPC 1ID3D 2NQBC 3UTBB 5B0ZD 5BO0B 1P3FC 4H9NA 3H0LC 3MGSD 3KWQD 4JJNC 3REKC 4YM6A 1P34B 3UTBD 3KUYA 4HGAB 3WA9D 5AVCA 1WWSA 3V9RA 5GT0B 4WU8B 4WU9C 3KXBA 1KX5B 1M18D 5AV6B 3MGQB 1ID3A 4H9PB 5AV5C 5AV9C 4KGCD 3WTPC 5B0ZA 4WU8D 1Q9CA 1KX5D 3AV1C 5AV6D 2ZY3A 3MGQD 3H0MC 3W97B 5DNNB 3UTBA 5BO0A 3WA9A 3MVDB 2FJ7B 3C1BB 4XUJB 3W97D 1M18A 5GXQB 4LD9D 5DNND 4NE3A 4H9QA 2W8SA 3MVDD 4KGCA 2FJ7D 2AROB 3O62C 4WU8A 1KX5A 5AVBD 5GXQD 3MGQA 1KU5A 2HUEC 3W96C 3VH5W 2AROD 2RVQD 4Z66B 1P3OB 1AOIC 5DNMC 2ZY5A 5B32D 4E44A 1ZLAB 4H9RB 3W97A 4UPKA 4LD9A 4Z66D 5DNNA 3W99B 3MVDA 1ZLAD 2FJ7A 5B1LC 5AVBA 3VH6W 5GXQA 3LZ1C 2NZDC 2AROA 5JRGA 4M6BA 5B32A 3B6GC 1W2EA 2Y2MA 1F66C 4Z66A 1ZLAA 2IO5C 4QLCB 5B2ID 3TU4B 1P3PC 3AZKA 5CPKC 5AVBC 4Z2MH 1S32C 3TU4D 5JRGC 3W98C 3LJAC 2BG1A 3LZ0B 1P3IC 1KX3A 4J8WD 1H3OA 3REJB 5B2IA 3B6FB 1P3GC 1P3LC 3AZKC 3B6FD 1P3AC 3X1UC 4G91B 1BH8B 4CSRB 3AN2C 1M19B 3WAAD 4CAYA 4J8WA 4R8PD 2F8NG 5JA4B 1KX3C 3AZID 4X23D 3P5JB 1M19D 2Y2QA 2F2AC 3AFAB 4EO5B 3B6FA 3WKJD 5GT3C 3AZJC 3MGRD 3AZNC 1HQ3C 1KX4C 3WAAA 5C3IB 1F1EA 3AV2B 4R8PA 3F6TA 3AFAD 3AZIA 1BH8A 1TAFA 4CSRA 4X23A 1M19A 3AZFC 3AV2D 3X1SC 3AZMB 3AZLD 5JA4A 4WNNB 3WKJA 1P3MB 3MGRA 5B40C 5CPIA 3AFAA 3LELB 5B24B 1P3MD 2CV5C 2Y2GA 3AV2A 3MNNA 3A6NC 5F99C 4X23C 3LELD 5B24D 3AZLA 1M1AC 4J8UC 5B1MB 2BYMA 3B0DB 4WNNA 3X1VD 5CPIC 2BYKB 5B1MD 5B31C 1JFIA 2PYOB 3LELA 5B24A 3RELB 4JJNB 3MNNC 5B2JB 2UWXA 5B33A 2PYOD 3KFUG 3RELD 4WU9B 2F8NB 5B2JD 3X1VA 3AZEB 3AZHC 1U35A 5B1MA 3WTPB 2VQRA 2F8ND 3AV1B 1P3KC 5E5AC 3AZED 3C1CC 2BYKA 2DQNC 3REIB 1P3BC 4AWLB 2PYOA 2JE5A 3RELA 2Y2NA 5B33C 2G5HC 1P34D 3REID 4YS3B 5KDMB 3O62B 3UTAB 5GT0D 3MGSA 3KWQA 1U35C 1WWIA 3AZEA 4XZQB 4YS3D 3A1IA 3W96B 2Y2OA 3UTAD 5AV8B 4YM6C 4KUDB 3KUYC 4XZQD 5AVCC 5BT1D 1P34A 5AV8D 3KXBC 4KUDD 3X1TB 3C1BD 5GT0A 4XUJD 1ID3C 4UUZB 5AV6A 5B0ZC 4H9PA 4YS3A 3X1TD 5KDMA 3KWQC 3MGSC 3UTAA 2CWEA 4H9SA 3UTBC 3REHB 3WA9C 1F66B 1P3OD 5AV8A 4KUDA 1M18C 2G5IC 3C1BA 4XUJA 4HGAC 5B0YB 3REHD 4KGCC 3AZGB 4WU8C 3W99D 1KX5C 5AV6C 3MGQC 3X1TA 5G49B 4UUZA 5B0YD 3AZGD 4DRBA 3W98B 3R45B 3AL0C 3B0CT 1P3OA 4H9SC 3EG5B 5BS7A 3W97C 4LD9C 4H9RA 5DNNC 2YFWB 3REHA 3MVDC 2FJ7C 2L5AA 4J8VB 2F8NK 3W99A 2Y2HA 5GXQC 5B31G 4QLCD 1P3GB 2RIQA 5B0YA 2AROC 2RVQC 3X1UB 5FUGB 4Z5TB 1P3AB 5B32C 4J8VD 5G49A 1HTAA 4Z66C 1N1JB 3NQJB 4Z5TD 4J8XB 2ZY4A 3LZ0D 1ZLAC 5BNXB 4QLCA 3REJD 5CPJB 3TU4A 4J8XD 4J8VA 1KX4B 2J8PA 5CPJD 4ZUXB 4Z5TA 3LZ0A 5AY8B 3AZFB 5B2IC 4ZUXD 3X1SB 3REJA 2YFVB 1B67A 3A1KA 5AY8D 1ULYA 5BNXA 3TU4C 1EQZB 2HIOB 2XD1A 4J8WC 1EQZD 2HIOD 4ZUXA 3A6NB 5AY8A 4H9OB 3AZMD 3B6FC 3EPLA 3H0RC 3WAAC 4R8PC 1EQZA 1TZYB 4KHAB 3AZIC 5B31B 1M19C 5GSUB 1TZYD 1PZRA 5CP6B 3AZMA 3WKJC 3UT9B 3MGRC 1P3MA 5GSUD 1BH9B 4H9OA 3AYWB 5CP6D 3MGPB 3AFAC 4EO5C 2NQBB 3UT9D 1P3FB 3AYWD 5C3IC 5E5AB 3AV2C 3REKB 3MGPD 3AZLC 1TZYA 2NQBD 1P3FD 4JJND 3REKD 5B32G 5AV9B 5AV5B 1P3MC 4Z2MG 2Y2PA 4WU9D 5AV5D 2XD5A 5AV9D 5B24C 3LELC 3WTPD 2NQBA 4YM6B 3AV1D 1P3FA 4JJNA 3REKA 5B2JA 3V9RB 1T3UA 3X1VC 4WU9A 2F8NA 5B1MC 2HUEB 3B0DC 5AV9A 3O62D 3WTPA 1AOIB 5DNMB 3AV1A 2F8NH 3W96D 2PYOC 3WA9B 4DQYB 3REIA 3RELC 3B0CW 1AOID 5DNMD 5B2JC 1M18B 5B1LB 2DF4C 4H9QB 4KGCB 3LZ1B 2NZDB 3WTPE 4G92C 3O62A 4ZBJC 3AZEC 5B1LD 2ZY2A 1A7WA 3LZ1D 3B6GB 2NZDD 4XZQA 3NQUB 3W96A 1AOIA 5DNMA 1P34C 2IO5B 3B6GD 3REIC 4LD9B 4AWLC 1F66D 1P3PB 4DRAA 5GT0C 5CPKB 5AVBB 1S32B 5B1LA 4YS3C 3KSYA 3LZ1A 2NZDA 1P3PD 5JRGB 3UTAC 5B32B 3LJAB 5CPKD 1S32D 1P3IB 4XZQC 5BT1C 3EPJA 3B6GA 5JRGD 5AV8C 3W98D 3NQUA 3LJAD 1F66A 4KUDC 3C1BC 1P3ID 4XUJC 1P3LB 3AZKB 3X1TC 3AZGA 1P3PA 1Z2CB 5CPKA 1S32A 1P3GD 3AN2B 1P3LD 3AZKD 1P3AD 3X1UD 1P3OC 1KX3B 5BS7C 3W98A 3LJAA 3R45A 2LY8A 3AN2D 1H3OB 2Y2IA 1P3IA 3REHC 5B2IB 2Y2JA 1KX3D 2YFWA 3W99C 2Y2KA 5GT3B 4E45A 3AZJB 5B0YC 3AZNB 1HQ3B 1P3GA 3AZGC 1P3LA 3VH5T 3EPHA 1P3AA 4NE6A 5FUGA 3X1UA 5GT3D 4CAYB 4J8WB 3AZJD 3AZND 1HQ3D 5BNVB 3AN2A 1KX4D 1N1JA 3NQJA 4J8XA 4QLCC
chains in the Genus database with same CATH topology
3AZFD 1BFMA 3VH6T 3X1SD 5B40B 5CPJA 4J8VC 5GT3A 3WAAB 3AZJA 2CV5B 4R8PB 1HQ3A 5B40D 3AZNA 1KX4A 4Z5TC 3LZ0C 3AZIB 5F99B 1TAFB 4X23B 1M1AB 2CV5D 5BNVA 3REJC 3AZFA 3X1SA 3A6ND 4J8XC 5F99D 2YFVA 4J8UB 3WKJB 1M1AD 3MGRB 5CPJC 5CPIB 5B40A 4J8UD 2HIOA 4G91C 4ZUXC 2CV5A 3MNNB 5CPID 3AZLB 3A6NA 5B31D 5F99A 2JCHA 5AY8C 1M1AA 3MNND 2JSSA 2ZM5A 3IP4C 2Y2LA 2BYMB 3AZHB 4J8UA 1EQZC 4WV4B 1P3KB 2HIOC 3VH5A 1JFIB 3C1CB 3AZHD 4KHAA 1P3BB 5B31A 1P3KD 5E5AD 5B33B 3AZMC 5CHLB 5GSUA 3C1CD 5CP6A 1P3BD 3UT9A 3X1VB 3VH6A 5B33D 4WJ3C 1BH9A 3AYWA 1U35B 3EPKA 3MGPA 4H9NB 3AZHA 3B0BA 1TZYC 4WZSB 1U35D 5E5AA 1P3KA 3KUYB 5AVCB 3C1CA 1P3BA 4YM6D 3KXBB 3FDDA 4NE5A 5GSUC 5CP6C 3KUYD 4NFTA 1ID3B 5AVCD 3UT9C 1B6WA 5B0ZB 4G92B 5AV5A 1R4VA 3KXBD 3MGSB 2FFFB 3KWQB 3AYWC 4ZBJB 3MGPC 1ID3D 2NQBC 3UTBB 5B0ZD 5BO0B 1P3FC 4H9NA 3H0LC 3MGSD 3KWQD 4JJNC 3REKC 4YM6A 1P34B 3UTBD 3KUYA 4HGAB 3WA9D 5AVCA 1WWSA 3V9RA 5GT0B 4WU8B 4WU9C 3KXBA 1KX5B 1M18D 5AV6B 3MGQB 1ID3A 4H9PB 5AV5C 5AV9C 4KGCD 3WTPC 5B0ZA 4WU8D 1Q9CA 1KX5D 3AV1C 5AV6D 2ZY3A 3MGQD 3H0MC 3W97B 5DNNB 3UTBA 5BO0A 3WA9A 3MVDB 2FJ7B 3C1BB 4XUJB 3W97D 1M18A 5GXQB 4LD9D 5DNND 4NE3A 4H9QA 2W8SA 3MVDD 4KGCA 2FJ7D 2AROB 3O62C 4WU8A 1KX5A 5AVBD 5GXQD 3MGQA 1KU5A 2HUEC 3W96C 3VH5W 2AROD 2RVQD 4Z66B 1P3OB 1AOIC 5DNMC 2ZY5A 5B32D 4E44A 1ZLAB 4H9RB 3W97A 4UPKA 4LD9A 4Z66D 5DNNA 3W99B 3MVDA 1ZLAD 2FJ7A 5B1LC 5AVBA 3VH6W 5GXQA 3LZ1C 2NZDC 2AROA 5JRGA 4M6BA 5B32A 3B6GC 1W2EA 2Y2MA 1F66C 4Z66A 1ZLAA 2IO5C 4QLCB 5B2ID 3TU4B 1P3PC 3AZKA 5CPKC 5AVBC 4Z2MH 1S32C 3TU4D 5JRGC 3W98C 3LJAC 2BG1A 3LZ0B 1P3IC 1KX3A 4J8WD 1H3OA 3REJB 5B2IA 3B6FB 1P3GC 1P3LC 3AZKC 3B6FD 1P3AC 3X1UC 4G91B 1BH8B 4CSRB 3AN2C 1M19B 3WAAD 4CAYA 4J8WA 4R8PD 2F8NG 5JA4B 1KX3C 3AZID 4X23D 3P5JB 1M19D 2Y2QA 2F2AC 3AFAB 4EO5B 3B6FA 3WKJD 5GT3C 3AZJC 3MGRD 3AZNC 1HQ3C 1KX4C 3WAAA 5C3IB 1F1EA 3AV2B 4R8PA 3F6TA 3AFAD 3AZIA 1BH8A 1TAFA 4CSRA 4X23A 1M19A 3AZFC 3AV2D 3X1SC 3AZMB 3AZLD 5JA4A 4WNNB 3WKJA 1P3MB 3MGRA 5B40C 5CPIA 3AFAA 3LELB 5B24B 1P3MD 2CV5C 2Y2GA 3AV2A 3MNNA 3A6NC 5F99C 4X23C 3LELD 5B24D 3AZLA 1M1AC 4J8UC 5B1MB 2BYMA 3B0DB 4WNNA 3X1VD 5CPIC 2BYKB 5B1MD 5B31C 1JFIA 2PYOB 3LELA 5B24A 3RELB 4JJNB 3MNNC 5B2JB 2UWXA 5B33A 2PYOD 3KFUG 3RELD 4WU9B 2F8NB 5B2JD 3X1VA 3AZEB 3AZHC 1U35A 5B1MA 3WTPB 2VQRA 2F8ND 3AV1B 1P3KC 5E5AC 3AZED 3C1CC 2BYKA 2DQNC 3REIB 1P3BC 4AWLB 2PYOA 2JE5A 3RELA 2Y2NA 5B33C 2G5HC 1P34D 3REID 4YS3B 5KDMB 3O62B 3UTAB 5GT0D 3MGSA 3KWQA 1U35C 1WWIA 3AZEA 4XZQB 4YS3D 3A1IA 3W96B 2Y2OA 3UTAD 5AV8B 4YM6C 4KUDB 3KUYC 4XZQD 5AVCC 5BT1D 1P34A 5AV8D 3KXBC 4KUDD 3X1TB 3C1BD 5GT0A 4XUJD 1ID3C 4UUZB 5AV6A 5B0ZC 4H9PA 4YS3A 3X1TD 5KDMA 3KWQC 3MGSC 3UTAA 2CWEA 4H9SA 3UTBC 3REHB 3WA9C 1F66B 1P3OD 5AV8A 4KUDA 1M18C 2G5IC 3C1BA 4XUJA 4HGAC 5B0YB 3REHD 4KGCC 3AZGB 4WU8C 3W99D 1KX5C 5AV6C 3MGQC 3X1TA 5G49B 4UUZA 5B0YD 3AZGD 4DRBA 3W98B 3R45B 3AL0C 3B0CT 1P3OA 4H9SC 3EG5B 5BS7A 3W97C 4LD9C 4H9RA 5DNNC 2YFWB 3REHA 3MVDC 2FJ7C 2L5AA 4J8VB 2F8NK 3W99A 2Y2HA 5GXQC 5B31G 4QLCD 1P3GB 2RIQA 5B0YA 2AROC 2RVQC 3X1UB 5FUGB 4Z5TB 1P3AB 5B32C 4J8VD 5G49A 1HTAA 4Z66C 1N1JB 3NQJB 4Z5TD 4J8XB 2ZY4A 3LZ0D 1ZLAC 5BNXB 4QLCA 3REJD 5CPJB 3TU4A 4J8XD 4J8VA 1KX4B 2J8PA 5CPJD 4ZUXB 4Z5TA 3LZ0A 5AY8B 3AZFB 5B2IC 4ZUXD 3X1SB 3REJA 2YFVB 1B67A 3A1KA 5AY8D 1ULYA 5BNXA 3TU4C 1EQZB 2HIOB 2XD1A 4J8WC 1EQZD 2HIOD 4ZUXA 3A6NB 5AY8A 4H9OB 3AZMD 3B6FC 3EPLA 3H0RC 3WAAC 4R8PC 1EQZA 1TZYB 4KHAB 3AZIC 5B31B 1M19C 5GSUB 1TZYD 1PZRA 5CP6B 3AZMA 3WKJC 3UT9B 3MGRC 1P3MA 5GSUD 1BH9B 4H9OA 3AYWB 5CP6D 3MGPB 3AFAC 4EO5C 2NQBB 3UT9D 1P3FB 3AYWD 5C3IC 5E5AB 3AV2C 3REKB 3MGPD 3AZLC 1TZYA 2NQBD 1P3FD 4JJND 3REKD 5B32G 5AV9B 5AV5B 1P3MC 4Z2MG 2Y2PA 4WU9D 5AV5D 2XD5A 5AV9D 5B24C 3LELC 3WTPD 2NQBA 4YM6B 3AV1D 1P3FA 4JJNA 3REKA 5B2JA 3V9RB 1T3UA 3X1VC 4WU9A 2F8NA 5B1MC 2HUEB 3B0DC 5AV9A 3O62D 3WTPA 1AOIB 5DNMB 3AV1A 2F8NH 3W96D 2PYOC 3WA9B 4DQYB 3REIA 3RELC 3B0CW 1AOID 5DNMD 5B2JC 1M18B 5B1LB 2DF4C 4H9QB 4KGCB 3LZ1B 2NZDB 3WTPE 4G92C 3O62A 4ZBJC 3AZEC 5B1LD 2ZY2A 1A7WA 3LZ1D 3B6GB 2NZDD 4XZQA 3NQUB 3W96A 1AOIA 5DNMA 1P34C 2IO5B 3B6GD 3REIC 4LD9B 4AWLC 1F66D 1P3PB 4DRAA 5GT0C 5CPKB 5AVBB 1S32B 5B1LA 4YS3C 3KSYA 3LZ1A 2NZDA 1P3PD 5JRGB 3UTAC 5B32B 3LJAB 5CPKD 1S32D 1P3IB 4XZQC 5BT1C 3EPJA 3B6GA 5JRGD 5AV8C 3W98D 3NQUA 3LJAD 1F66A 4KUDC 3C1BC 1P3ID 4XUJC 1P3LB 3AZKB 3X1TC 3AZGA 1P3PA 1Z2CB 5CPKA 1S32A 1P3GD 3AN2B 1P3LD 3AZKD 1P3AD 3X1UD 1P3OC 1KX3B 5BS7C 3W98A 3LJAA 3R45A 2LY8A 3AN2D 1H3OB 2Y2IA 1P3IA 3REHC 5B2IB 2Y2JA 1KX3D 2YFWA 3W99C 2Y2KA 5GT3B 4E45A 3AZJB 5B0YC 3AZNB 1HQ3B 1P3GA 3AZGC 1P3LA 3VH5T 3EPHA 1P3AA 4NE6A 5FUGA 3X1UA 5GT3D 4CAYB 4J8WB 3AZJD 3AZND 1HQ3D 5BNVB 3AN2A 1KX4D 1N1JA 3NQJA 4J8XA 4QLCC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZF D;  1BFM A;  3VH6 T;  3X1S D;  5B40 B;  5CPJ A;  4J8V C;  5GT3 A;  3WAA B;  3AZJ A;  2CV5 B;  4R8P B;  1HQ3 A;  5B40 D;  3AZN A;  1KX4 A;  4Z5T C;  3LZ0 C;  3AZI B;  5F99 B;  1TAF B;  4X23 B;  1M1A B;  2CV5 D;  5BNV A;  3REJ C;  3AZF A;  3X1S A;  3A6N D;  4J8X C;  5F99 D;  2YFV A;  4J8U B;  3WKJ B;  1M1A D;  3MGR B;  5CPJ C;  5CPI B;  5B40 A;  4J8U D;  2HIO A;  4G91 C;  4ZUX C;  2CV5 A;  3MNN B;  5CPI D;  3AZL B;  3A6N A;  5B31 D;  5F99 A;  5AY8 C;  1M1A A;  3MNN D;  2JSS A;  2BYM B;  3AZH B;  4J8U A;  1EQZ C;  4WV4 B;  1P3K B;  2HIO C;  3VH5 A;  1JFI B;  3C1C B;  3AZH D;  4KHA A;  1P3B B;  5B31 A;  1P3K D;  5E5A D;  5B33 B;  3AZM C;  5CHL B;  5GSU A;  3C1C D;  5CP6 A;  1P3B D;  3UT9 A;  3X1V B;  3VH6 A;  5B33 D;  1BH9 A;  3AYW A;  1U35 B;  3MGP A;  4H9N B;  3AZH A;  3B0B A;  1TZY C;  4WZS B;  1U35 D;  5E5A A;  1P3K A;  3KUY B;  5AVC B;  3C1C A;  1P3B A;  4YM6 D;  3KXB B;  4NE5 A;  5GSU C;  5CP6 C;  3KUY D;  4NFT A;  1ID3 B;  5AVC D;  3UT9 C;  1B6W A;  5B0Z B;  4G92 B;  5AV5 A;  1R4V A;  3KXB D;  3MGS B;  3KWQ B;  3AYW C;  4ZBJ B;  3MGP C;  1ID3 D;  2NQB C;  3UTB B;  5B0Z D;  5BO0 B;  1P3F C;  4H9N A;  3MGS D;  3KWQ D;  4JJN C;  3REK C;  4YM6 A;  1P34 B;  3UTB D;  3KUY A;  4HGA B;  3WA9 D;  5AVC A;  1WWS A;  3V9R A;  5GT0 B;  4WU8 B;  4WU9 C;  3KXB A;  1KX5 B;  1M18 D;  5AV6 B;  3MGQ B;  1ID3 A;  4H9P B;  5AV5 C;  5AV9 C;  4KGC D;  3WTP C;  5B0Z A;  4WU8 D;  1Q9C A;  1KX5 D;  3AV1 C;  5AV6 D;  3MGQ D;  3W97 B;  5DNN B;  3UTB A;  5BO0 A;  3WA9 A;  3MVD B;  2FJ7 B;  3C1B B;  4XUJ B;  3W97 D;  1M18 A;  5GXQ B;  4LD9 D;  5DNN D;  4NE3 A;  4H9Q A;  4KGC A;  3MVD D;  2FJ7 D;  2ARO B;  3O62 C;  4WU8 A;  1KX5 A;  5AVB D;  5GXQ D;  3MGQ A;  1KU5 A;  2HUE C;  3W96 C;  3VH5 W;  2ARO D;  2RVQ D;  4Z66 B;  1P3O B;  1AOI C;  5DNM C;  5B32 D;  4E44 A;  1ZLA B;  4H9R B;  3W97 A;  4LD9 A;  4Z66 D;  5DNN A;  3W99 B;  3MVD A;  1ZLA D;  2FJ7 A;  5B1L C;  5AVB A;  3VH6 W;  5GXQ A;  3LZ1 C;  2NZD C;  2ARO A;  5JRG A;  4M6B A;  5B32 A;  3B6G C;  1F66 C;  4Z66 A;  1ZLA A;  2IO5 C;  4QLC B;  5B2I D;  3TU4 B;  1P3P C;  3AZK A;  5CPK C;  5AVB C;  4Z2M H;  1S32 C;  3TU4 D;  5JRG C;  3W98 C;  3LJA C;  3LZ0 B;  1P3I C;  1KX3 A;  4J8W D;  1H3O A;  3REJ B;  5B2I A;  3B6F B;  1P3G C;  1P3L C;  3AZK C;  3B6F D;  1P3A C;  3X1U C;  4G91 B;  1BH8 B;  4CSR B;  3AN2 C;  1M19 B;  3WAA D;  4CAY A;  4J8W A;  4R8P D;  2F8N G;  5JA4 B;  1KX3 C;  3AZI D;  4X23 D;  1M19 D;  3B6F A;  3AFA B;  4EO5 B;  3WKJ D;  5GT3 C;  3AZJ C;  3MGR D;  3AZN C;  1HQ3 C;  1KX4 C;  3WAA A;  5C3I B;  1F1E A;  3AV2 B;  4R8P A;  3AFA D;  3AZI A;  1BH8 A;  1TAF A;  4CSR A;  4X23 A;  1M19 A;  3AZF C;  3AV2 D;  3X1S C;  3AZM B;  3AZL D;  5JA4 A;  4WNN B;  3WKJ A;  1P3M B;  3MGR A;  5B40 C;  5CPI A;  3AFA A;  3LEL B;  5B24 B;  1P3M D;  2CV5 C;  3AV2 A;  3MNN A;  3A6N C;  5F99 C;  4X23 C;  3LEL D;  5B24 D;  3AZL A;  1M1A C;  4J8U C;  5B1M B;  2BYM A;  3B0D B;  4WNN A;  3X1V D;  5CPI C;  2BYK B;  5B1M D;  5B31 C;  1JFI A;  2PYO B;  3LEL A;  5B24 A;  3REL B;  4JJN B;  3MNN C;  5B2J B;  5B33 A;  2PYO D;  3REL D;  4WU9 B;  2F8N B;  5B2J D;  3X1V A;  3AZE B;  3AZH C;  1U35 A;  5B1M A;  3WTP B;  2F8N D;  3AV1 B;  1P3K C;  5E5A C;  3AZE D;  3C1C C;  2BYK A;  3REI B;  1P3B C;  4AWL B;  2PYO A;  3REL A;  5B33 C;  1P34 D;  3REI D;  4YS3 B;  5KDM B;  3O62 B;  3UTA B;  5GT0 D;  3MGS A;  3KWQ A;  1U35 C;  1WWI A;  3AZE A;  4XZQ B;  4YS3 D;  3W96 B;  3UTA D;  5AV8 B;  4YM6 C;  4KUD B;  3KUY C;  4XZQ D;  5AVC C;  5BT1 D;  1P34 A;  5AV8 D;  3KXB C;  4KUD D;  3X1T B;  3C1B D;  5GT0 A;  4XUJ D;  1ID3 C;  4UUZ B;  5AV6 A;  5B0Z C;  4H9P A;  4YS3 A;  3X1T D;  5KDM A;  3KWQ C;  3MGS C;  3UTA A;  2CWE A;  4H9S A;  3UTB C;  3REH B;  3WA9 C;  1F66 B;  1P3O D;  5AV8 A;  4KUD A;  1M18 C;  3C1B A;  4XUJ A;  4HGA C;  5B0Y B;  3REH D;  4KGC C;  3AZG B;  4WU8 C;  3W99 D;  1KX5 C;  5AV6 C;  3MGQ C;  3X1T A;  5G49 B;  4UUZ A;  5B0Y D;  3AZG D;  4DRB A;  3W98 B;  3R45 B;  3B0C T;  1P3O A;  4H9S C;  5BS7 A;  3W97 C;  4LD9 C;  4H9R A;  5DNN C;  2YFW B;  3REH A;  3MVD C;  2FJ7 C;  2L5A A;  4J8V B;  2F8N K;  3W99 A;  5GXQ C;  5B31 G;  4QLC D;  1P3G B;  5B0Y A;  2ARO C;  2RVQ C;  3X1U B;  5FUG B;  4Z5T B;  1P3A B;  5B32 C;  4J8V D;  5G49 A;  1HTA A;  4Z66 C;  1N1J B;  3NQJ B;  4Z5T D;  4J8X B;  3LZ0 D;  1ZLA C;  5BNX B;  4QLC A;  3REJ D;  5CPJ B;  3TU4 A;  4J8X D;  4J8V A;  1KX4 B;  5CPJ D;  4ZUX B;  4Z5T A;  3LZ0 A;  5AY8 B;  3AZF B;  5B2I C;  4ZUX D;  3X1S B;  3REJ A;  2YFV B;  1B67 A;  5AY8 D;  1ULY A;  5BNX A;  3TU4 C;  1EQZ B;  2HIO B;  4J8W C;  1EQZ D;  2HIO D;  4ZUX A;  3A6N B;  5AY8 A;  4H9O B;  3AZM D;  3B6F C;  3WAA C;  4R8P C;  1EQZ A;  1TZY B;  4KHA B;  3AZI C;  5B31 B;  1M19 C;  5GSU B;  1TZY D;  5CP6 B;  3AZM A;  3WKJ C;  3UT9 B;  3MGR C;  1P3M A;  5GSU D;  1BH9 B;  4H9O A;  3AYW B;  5CP6 D;  3MGP B;  3AFA C;  4EO5 C;  2NQB B;  3UT9 D;  1P3F B;  3AYW D;  5C3I C;  5E5A B;  3AV2 C;  3REK B;  3MGP D;  3AZL C;  1TZY A;  2NQB D;  1P3F D;  4JJN D;  3REK D;  5B32 G;  5AV9 B;  5AV5 B;  1P3M C;  4Z2M G;  4WU9 D;  5AV5 D;  5AV9 D;  3LEL C;  5B24 C;  2NQB A;  3WTP D;  4YM6 B;  3AV1 D;  1P3F A;  4JJN A;  3REK A;  5B2J A;  3V9R B;  3X1V C;  4WU9 A;  2F8N A;  5B1M C;  2HUE B;  3B0D C;  5AV9 A;  3O62 D;  3WTP A;  1AOI B;  5DNM B;  3AV1 A;  2F8N H;  3W96 D;  2PYO C;  3WA9 B;  3REI A;  3REL C;  3B0C W;  1AOI D;  5DNM D;  5B2J C;  1M18 B;  5B1L B;  4H9Q B;  4KGC B;  3LZ1 B;  2NZD B;  3WTP E;  4G92 C;  3O62 A;  4ZBJ C;  3AZE C;  5B1L D;  1A7W A;  3LZ1 D;  3B6G B;  2NZD D;  4XZQ A;  3NQU B;  3W96 A;  1AOI A;  5DNM A;  1P34 C;  2IO5 B;  3B6G D;  3REI C;  4LD9 B;  4AWL C;  1F66 D;  1P3P B;  4DRA A;  5GT0 C;  5CPK B;  5AVB B;  1S32 B;  5B1L A;  4YS3 C;  3KSY A;  3LZ1 A;  2NZD A;  1P3P D;  5JRG B;  3UTA C;  5B32 B;  3LJA B;  5CPK D;  1S32 D;  1P3I B;  4XZQ C;  5BT1 C;  3B6G A;  5JRG D;  5AV8 C;  3W98 D;  3NQU A;  3LJA D;  1F66 A;  4KUD C;  3C1B C;  1P3I D;  4XUJ C;  1P3L B;  3AZK B;  3X1T C;  3AZG A;  1P3P A;  5CPK A;  1S32 A;  1P3G D;  3AN2 B;  1P3L D;  3AZK D;  1P3A D;  3X1U D;  1P3O C;  1KX3 B;  5BS7 C;  3W98 A;  3LJA A;  3R45 A;  2LY8 A;  3AN2 D;  1H3O B;  1P3I A;  3REH C;  5B2I B;  1KX3 D;  2YFW A;  3W99 C;  5GT3 B;  4E45 A;  3AZJ B;  5B0Y C;  3AZN B;  1HQ3 B;  1P3G A;  3AZG C;  1P3L A;  3VH5 T;  1P3A A;  4NE6 A;  5FUG A;  3X1U A;  5GT3 D;  4CAY B;  4J8W B;  3AZJ D;  3AZN D;  1HQ3 D;  5BNV B;  3AN2 A;  1KX4 D;  1N1J A;  3NQJ A;  4J8X A;  4QLC C; 
#chains in the Genus database with same CATH topology
 3AZF D;  1BFM A;  3VH6 T;  3X1S D;  5B40 B;  5CPJ A;  4J8V C;  5GT3 A;  3WAA B;  3AZJ A;  2CV5 B;  4R8P B;  1HQ3 A;  5B40 D;  3AZN A;  1KX4 A;  4Z5T C;  3LZ0 C;  3AZI B;  5F99 B;  1TAF B;  4X23 B;  1M1A B;  2CV5 D;  5BNV A;  3REJ C;  3AZF A;  3X1S A;  3A6N D;  4J8X C;  5F99 D;  2YFV A;  4J8U B;  3WKJ B;  1M1A D;  3MGR B;  5CPJ C;  5CPI B;  5B40 A;  4J8U D;  2HIO A;  4G91 C;  4ZUX C;  2CV5 A;  3MNN B;  5CPI D;  3AZL B;  3A6N A;  5B31 D;  5F99 A;  2JCH A;  5AY8 C;  1M1A A;  3MNN D;  2JSS A;  2ZM5 A;  3IP4 C;  2Y2L A;  2BYM B;  3AZH B;  4J8U A;  1EQZ C;  4WV4 B;  1P3K B;  2HIO C;  3VH5 A;  1JFI B;  3C1C B;  3AZH D;  4KHA A;  1P3B B;  5B31 A;  1P3K D;  5E5A D;  5B33 B;  3AZM C;  5CHL B;  5GSU A;  3C1C D;  5CP6 A;  1P3B D;  3UT9 A;  3X1V B;  3VH6 A;  5B33 D;  4WJ3 C;  1BH9 A;  3AYW A;  1U35 B;  3EPK A;  3MGP A;  4H9N B;  3AZH A;  3B0B A;  1TZY C;  4WZS B;  1U35 D;  5E5A A;  1P3K A;  3KUY B;  5AVC B;  3C1C A;  1P3B A;  4YM6 D;  3KXB B;  3FDD A;  4NE5 A;  5GSU C;  5CP6 C;  3KUY D;  4NFT A;  1ID3 B;  5AVC D;  3UT9 C;  1B6W A;  5B0Z B;  4G92 B;  5AV5 A;  1R4V A;  3KXB D;  3MGS B;  2FFF B;  3KWQ B;  3AYW C;  4ZBJ B;  3MGP C;  1ID3 D;  2NQB C;  3UTB B;  5B0Z D;  5BO0 B;  1P3F C;  4H9N A;  3H0L C;  3MGS D;  3KWQ D;  4JJN C;  3REK C;  4YM6 A;  1P34 B;  3UTB D;  3KUY A;  4HGA B;  3WA9 D;  5AVC A;  1WWS A;  3V9R A;  5GT0 B;  4WU8 B;  4WU9 C;  3KXB A;  1KX5 B;  1M18 D;  5AV6 B;  3MGQ B;  1ID3 A;  4H9P B;  5AV5 C;  5AV9 C;  4KGC D;  3WTP C;  5B0Z A;  4WU8 D;  1Q9C A;  1KX5 D;  3AV1 C;  5AV6 D;  2ZY3 A;  3MGQ D;  3H0M C;  3W97 B;  5DNN B;  3UTB A;  5BO0 A;  3WA9 A;  3MVD B;  2FJ7 B;  3C1B B;  4XUJ B;  3W97 D;  1M18 A;  5GXQ B;  4LD9 D;  5DNN D;  4NE3 A;  4H9Q A;  2W8S A;  3MVD D;  4KGC A;  2FJ7 D;  2ARO B;  3O62 C;  4WU8 A;  1KX5 A;  5AVB D;  5GXQ D;  3MGQ A;  1KU5 A;  2HUE C;  3W96 C;  3VH5 W;  2ARO D;  2RVQ D;  4Z66 B;  1P3O B;  1AOI C;  5DNM C;  2ZY5 A;  5B32 D;  4E44 A;  1ZLA B;  4H9R B;  3W97 A;  4UPK A;  4LD9 A;  4Z66 D;  5DNN A;  3W99 B;  3MVD A;  1ZLA D;  2FJ7 A;  5B1L C;  5AVB A;  3VH6 W;  5GXQ A;  3LZ1 C;  2NZD C;  2ARO A;  5JRG A;  4M6B A;  5B32 A;  3B6G C;  1W2E A;  2Y2M A;  1F66 C;  4Z66 A;  1ZLA A;  2IO5 C;  4QLC B;  5B2I D;  3TU4 B;  1P3P C;  3AZK A;  5CPK C;  5AVB C;  4Z2M H;  1S32 C;  3TU4 D;  5JRG C;  3W98 C;  3LJA C;  2BG1 A;  3LZ0 B;  1P3I C;  1KX3 A;  4J8W D;  1H3O A;  3REJ B;  5B2I A;  3B6F B;  1P3G C;  1P3L C;  3AZK C;  3B6F D;  1P3A C;  3X1U C;  4G91 B;  1BH8 B;  4CSR B;  3AN2 C;  1M19 B;  3WAA D;  4CAY A;  4J8W A;  4R8P D;  2F8N G;  5JA4 B;  1KX3 C;  3AZI D;  4X23 D;  3P5J B;  1M19 D;  2Y2Q A;  2F2A C;  3AFA B;  4EO5 B;  3B6F A;  3WKJ D;  5GT3 C;  3AZJ C;  3MGR D;  3AZN C;  1HQ3 C;  1KX4 C;  3WAA A;  5C3I B;  1F1E A;  3AV2 B;  4R8P A;  3F6T A;  3AFA D;  3AZI A;  1BH8 A;  1TAF A;  4CSR A;  4X23 A;  1M19 A;  3AZF C;  3AV2 D;  3X1S C;  3AZM B;  3AZL D;  5JA4 A;  4WNN B;  3WKJ A;  1P3M B;  3MGR A;  5B40 C;  5CPI A;  3AFA A;  3LEL B;  5B24 B;  1P3M D;  2CV5 C;  2Y2G A;  3AV2 A;  3MNN A;  3A6N C;  5F99 C;  4X23 C;  3LEL D;  5B24 D;  3AZL A;  1M1A C;  4J8U C;  5B1M B;  2BYM A;  3B0D B;  4WNN A;  3X1V D;  5CPI C;  2BYK B;  5B1M D;  5B31 C;  1JFI A;  2PYO B;  3LEL A;  5B24 A;  3REL B;  4JJN B;  3MNN C;  5B2J B;  2UWX A;  5B33 A;  2PYO D;  3KFU G;  3REL D;  4WU9 B;  2F8N B;  5B2J D;  3X1V A;  3AZE B;  3AZH C;  1U35 A;  5B1M A;  3WTP B;  2VQR A;  2F8N D;  3AV1 B;  1P3K C;  5E5A C;  3AZE D;  3C1C C;  2BYK A;  2DQN C;  3REI B;  1P3B C;  4AWL B;  2PYO A;  2JE5 A;  3REL A;  2Y2N A;  5B33 C;  2G5H C;  1P34 D;  3REI D;  4YS3 B;  5KDM B;  3O62 B;  3UTA B;  5GT0 D;  3MGS A;  3KWQ A;  1U35 C;  1WWI A;  3AZE A;  4XZQ B;  4YS3 D;  3A1I A;  3W96 B;  2Y2O A;  3UTA D;  5AV8 B;  4YM6 C;  4KUD B;  3KUY C;  4XZQ D;  5AVC C;  5BT1 D;  1P34 A;  5AV8 D;  3KXB C;  4KUD D;  3X1T B;  3C1B D;  5GT0 A;  4XUJ D;  1ID3 C;  4UUZ B;  5AV6 A;  5B0Z C;  4H9P A;  4YS3 A;  3X1T D;  5KDM A;  3KWQ C;  3MGS C;  3UTA A;  2CWE A;  4H9S A;  3UTB C;  3REH B;  3WA9 C;  1F66 B;  1P3O D;  5AV8 A;  4KUD A;  1M18 C;  2G5I C;  3C1B A;  4XUJ A;  4HGA C;  5B0Y B;  3REH D;  4KGC C;  3AZG B;  4WU8 C;  3W99 D;  1KX5 C;  5AV6 C;  3MGQ C;  3X1T A;  5G49 B;  4UUZ A;  5B0Y D;  3AZG D;  4DRB A;  3W98 B;  3R45 B;  3AL0 C;  3B0C T;  1P3O A;  4H9S C;  3EG5 B;  5BS7 A;  3W97 C;  4LD9 C;  4H9R A;  5DNN C;  2YFW B;  3REH A;  3MVD C;  2FJ7 C;  2L5A A;  4J8V B;  2F8N K;  3W99 A;  2Y2H A;  5GXQ C;  5B31 G;  4QLC D;  1P3G B;  2RIQ A;  5B0Y A;  2ARO C;  2RVQ C;  3X1U B;  5FUG B;  4Z5T B;  1P3A B;  5B32 C;  4J8V D;  5G49 A;  1HTA A;  4Z66 C;  1N1J B;  3NQJ B;  4Z5T D;  4J8X B;  2ZY4 A;  3LZ0 D;  1ZLA C;  5BNX B;  4QLC A;  3REJ D;  5CPJ B;  3TU4 A;  4J8X D;  4J8V A;  1KX4 B;  2J8P A;  5CPJ D;  4ZUX B;  4Z5T A;  3LZ0 A;  5AY8 B;  3AZF B;  5B2I C;  4ZUX D;  3X1S B;  3REJ A;  2YFV B;  1B67 A;  3A1K A;  5AY8 D;  1ULY A;  5BNX A;  3TU4 C;  1EQZ B;  2HIO B;  2XD1 A;  4J8W C;  1EQZ D;  2HIO D;  4ZUX A;  3A6N B;  5AY8 A;  4H9O B;  3AZM D;  3B6F C;  3EPL A;  3H0R C;  3WAA C;  4R8P C;  1EQZ A;  1TZY B;  4KHA B;  3AZI C;  5B31 B;  1M19 C;  5GSU B;  1TZY D;  1PZR A;  5CP6 B;  3AZM A;  3WKJ C;  3UT9 B;  3MGR C;  1P3M A;  5GSU D;  1BH9 B;  4H9O A;  3AYW B;  5CP6 D;  3MGP B;  3AFA C;  4EO5 C;  2NQB B;  3UT9 D;  1P3F B;  3AYW D;  5C3I C;  5E5A B;  3AV2 C;  3REK B;  3MGP D;  3AZL C;  1TZY A;  2NQB D;  1P3F D;  4JJN D;  3REK D;  5B32 G;  5AV9 B;  5AV5 B;  1P3M C;  4Z2M G;  2Y2P A;  4WU9 D;  5AV5 D;  2XD5 A;  5AV9 D;  5B24 C;  3LEL C;  3WTP D;  2NQB A;  4YM6 B;  3AV1 D;  1P3F A;  4JJN A;  3REK A;  5B2J A;  3V9R B;  1T3U A;  3X1V C;  4WU9 A;  2F8N A;  5B1M C;  2HUE B;  3B0D C;  5AV9 A;  3O62 D;  3WTP A;  1AOI B;  5DNM B;  3AV1 A;  2F8N H;  3W96 D;  2PYO C;  3WA9 B;  4DQY B;  3REI A;  3REL C;  3B0C W;  1AOI D;  5DNM D;  5B2J C;  1M18 B;  5B1L B;  2DF4 C;  4H9Q B;  4KGC B;  3LZ1 B;  2NZD B;  3WTP E;  4G92 C;  3O62 A;  4ZBJ C;  3AZE C;  5B1L D;  2ZY2 A;  1A7W A;  3LZ1 D;  3B6G B;  2NZD D;  4XZQ A;  3NQU B;  3W96 A;  1AOI A;  5DNM A;  1P34 C;  2IO5 B;  3B6G D;  3REI C;  4LD9 B;  4AWL C;  1F66 D;  1P3P B;  4DRA A;  5GT0 C;  5CPK B;  5AVB B;  1S32 B;  5B1L A;  4YS3 C;  3KSY A;  3LZ1 A;  2NZD A;  1P3P D;  5JRG B;  3UTA C;  5B32 B;  3LJA B;  5CPK D;  1S32 D;  1P3I B;  4XZQ C;  5BT1 C;  3EPJ A;  3B6G A;  5JRG D;  5AV8 C;  3W98 D;  3NQU A;  3LJA D;  1F66 A;  4KUD C;  3C1B C;  1P3I D;  4XUJ C;  1P3L B;  3AZK B;  3X1T C;  3AZG A;  1P3P A;  1Z2C B;  5CPK A;  1S32 A;  1P3G D;  3AN2 B;  1P3L D;  3AZK D;  1P3A D;  3X1U D;  1P3O C;  1KX3 B;  5BS7 C;  3W98 A;  3LJA A;  3R45 A;  2LY8 A;  3AN2 D;  1H3O B;  2Y2I A;  1P3I A;  3REH C;  5B2I B;  2Y2J A;  1KX3 D;  2YFW A;  3W99 C;  2Y2K A;  5GT3 B;  4E45 A;  3AZJ B;  5B0Y C;  3AZN B;  1HQ3 B;  1P3G A;  3AZG C;  1P3L A;  3VH5 T;  3EPH A;  1P3A A;  4NE6 A;  5FUG A;  3X1U A;  5GT3 D;  4CAY B;  4J8W B;  3AZJ D;  3AZN D;  1HQ3 D;  5BNV B;  3AN2 A;  1KX4 D;  1N1J A;  3NQJ A;  4J8X A;  4QLC C; 
#chains in the Genus database with same CATH homology
 3AZF D;  1BFM A;  3VH6 T;  3X1S D;  5B40 B;  5CPJ A;  4J8V C;  5GT3 A;  3WAA B;  3AZJ A;  2CV5 B;  4R8P B;  1HQ3 A;  5B40 D;  3AZN A;  1KX4 A;  4Z5T C;  3LZ0 C;  3AZI B;  5F99 B;  1TAF B;  4X23 B;  1M1A B;  2CV5 D;  5BNV A;  3REJ C;  3AZF A;  3X1S A;  3A6N D;  4J8X C;  5F99 D;  2YFV A;  4J8U B;  3WKJ B;  1M1A D;  3MGR B;  5CPJ C;  5CPI B;  5B40 A;  4J8U D;  2HIO A;  4G91 C;  4ZUX C;  2CV5 A;  3MNN B;  5CPI D;  3AZL B;  3A6N A;  5B31 D;  5F99 A;  2JCH A;  5AY8 C;  1M1A A;  3MNN D;  2JSS A;  2ZM5 A;  3IP4 C;  2Y2L A;  2BYM B;  3AZH B;  4J8U A;  1EQZ C;  4WV4 B;  1P3K B;  2HIO C;  3VH5 A;  1JFI B;  3C1C B;  3AZH D;  4KHA A;  1P3B B;  5B31 A;  1P3K D;  5E5A D;  5B33 B;  3AZM C;  5CHL B;  5GSU A;  3C1C D;  5CP6 A;  1P3B D;  3UT9 A;  3X1V B;  3VH6 A;  5B33 D;  4WJ3 C;  1BH9 A;  3AYW A;  1U35 B;  3EPK A;  3MGP A;  4H9N B;  3AZH A;  3B0B A;  1TZY C;  4WZS B;  1U35 D;  5E5A A;  1P3K A;  3KUY B;  5AVC B;  3C1C A;  1P3B A;  4YM6 D;  3KXB B;  3FDD A;  4NE5 A;  5GSU C;  5CP6 C;  3KUY D;  4NFT A;  1ID3 B;  5AVC D;  3UT9 C;  1B6W A;  5B0Z B;  4G92 B;  5AV5 A;  1R4V A;  3KXB D;  3MGS B;  2FFF B;  3KWQ B;  3AYW C;  4ZBJ B;  3MGP C;  1ID3 D;  2NQB C;  3UTB B;  5B0Z D;  5BO0 B;  1P3F C;  4H9N A;  3H0L C;  3MGS D;  3KWQ D;  4JJN C;  3REK C;  4YM6 A;  1P34 B;  3UTB D;  3KUY A;  4HGA B;  3WA9 D;  5AVC A;  1WWS A;  3V9R A;  5GT0 B;  4WU8 B;  4WU9 C;  3KXB A;  1KX5 B;  1M18 D;  5AV6 B;  3MGQ B;  1ID3 A;  4H9P B;  5AV5 C;  5AV9 C;  4KGC D;  3WTP C;  5B0Z A;  4WU8 D;  1Q9C A;  1KX5 D;  3AV1 C;  5AV6 D;  2ZY3 A;  3MGQ D;  3H0M C;  3W97 B;  5DNN B;  3UTB A;  5BO0 A;  3WA9 A;  3MVD B;  2FJ7 B;  3C1B B;  4XUJ B;  3W97 D;  1M18 A;  5GXQ B;  4LD9 D;  5DNN D;  4NE3 A;  4H9Q A;  2W8S A;  3MVD D;  4KGC A;  2FJ7 D;  2ARO B;  3O62 C;  4WU8 A;  1KX5 A;  5AVB D;  5GXQ D;  3MGQ A;  1KU5 A;  2HUE C;  3W96 C;  3VH5 W;  2ARO D;  2RVQ D;  4Z66 B;  1P3O B;  1AOI C;  5DNM C;  2ZY5 A;  5B32 D;  4E44 A;  1ZLA B;  4H9R B;  3W97 A;  4UPK A;  4LD9 A;  4Z66 D;  5DNN A;  3W99 B;  3MVD A;  1ZLA D;  2FJ7 A;  5B1L C;  5AVB A;  3VH6 W;  5GXQ A;  3LZ1 C;  2NZD C;  2ARO A;  5JRG A;  4M6B A;  5B32 A;  3B6G C;  1W2E A;  2Y2M A;  1F66 C;  4Z66 A;  1ZLA A;  2IO5 C;  4QLC B;  5B2I D;  3TU4 B;  1P3P C;  3AZK A;  5CPK C;  5AVB C;  4Z2M H;  1S32 C;  3TU4 D;  5JRG C;  3W98 C;  3LJA C;  2BG1 A;  3LZ0 B;  1P3I C;  1KX3 A;  4J8W D;  1H3O A;  3REJ B;  5B2I A;  3B6F B;  1P3G C;  1P3L C;  3AZK C;  3B6F D;  1P3A C;  3X1U C;  4G91 B;  1BH8 B;  4CSR B;  3AN2 C;  1M19 B;  3WAA D;  4CAY A;  4J8W A;  4R8P D;  2F8N G;  5JA4 B;  1KX3 C;  3AZI D;  4X23 D;  3P5J B;  1M19 D;  2Y2Q A;  2F2A C;  3AFA B;  4EO5 B;  3B6F A;  3WKJ D;  5GT3 C;  3AZJ C;  3MGR D;  3AZN C;  1HQ3 C;  1KX4 C;  3WAA A;  5C3I B;  1F1E A;  3AV2 B;  4R8P A;  3F6T A;  3AFA D;  3AZI A;  1BH8 A;  1TAF A;  4CSR A;  4X23 A;  1M19 A;  3AZF C;  3AV2 D;  3X1S C;  3AZM B;  3AZL D;  5JA4 A;  4WNN B;  3WKJ A;  1P3M B;  3MGR A;  5B40 C;  5CPI A;  3AFA A;  3LEL B;  5B24 B;  1P3M D;  2CV5 C;  2Y2G A;  3AV2 A;  3MNN A;  3A6N C;  5F99 C;  4X23 C;  3LEL D;  5B24 D;  3AZL A;  1M1A C;  4J8U C;  5B1M B;  2BYM A;  3B0D B;  4WNN A;  3X1V D;  5CPI C;  2BYK B;  5B1M D;  5B31 C;  1JFI A;  2PYO B;  3LEL A;  5B24 A;  3REL B;  4JJN B;  3MNN C;  5B2J B;  2UWX A;  5B33 A;  2PYO D;  3KFU G;  3REL D;  4WU9 B;  2F8N B;  5B2J D;  3X1V A;  3AZE B;  3AZH C;  1U35 A;  5B1M A;  3WTP B;  2VQR A;  2F8N D;  3AV1 B;  1P3K C;  5E5A C;  3AZE D;  3C1C C;  2BYK A;  2DQN C;  3REI B;  1P3B C;  4AWL B;  2PYO A;  2JE5 A;  3REL A;  2Y2N A;  5B33 C;  2G5H C;  1P34 D;  3REI D;  4YS3 B;  5KDM B;  3O62 B;  3UTA B;  5GT0 D;  3MGS A;  3KWQ A;  1U35 C;  1WWI A;  3AZE A;  4XZQ B;  4YS3 D;  3A1I A;  3W96 B;  2Y2O A;  3UTA D;  5AV8 B;  4YM6 C;  4KUD B;  3KUY C;  4XZQ D;  5AVC C;  5BT1 D;  1P34 A;  5AV8 D;  3KXB C;  4KUD D;  3X1T B;  3C1B D;  5GT0 A;  4XUJ D;  1ID3 C;  4UUZ B;  5AV6 A;  5B0Z C;  4H9P A;  4YS3 A;  3X1T D;  5KDM A;  3KWQ C;  3MGS C;  3UTA A;  2CWE A;  4H9S A;  3UTB C;  3REH B;  3WA9 C;  1F66 B;  1P3O D;  5AV8 A;  4KUD A;  1M18 C;  2G5I C;  3C1B A;  4XUJ A;  4HGA C;  5B0Y B;  3REH D;  4KGC C;  3AZG B;  4WU8 C;  3W99 D;  1KX5 C;  5AV6 C;  3MGQ C;  3X1T A;  5G49 B;  4UUZ A;  5B0Y D;  3AZG D;  4DRB A;  3W98 B;  3R45 B;  3AL0 C;  3B0C T;  1P3O A;  4H9S C;  3EG5 B;  5BS7 A;  3W97 C;  4LD9 C;  4H9R A;  5DNN C;  2YFW B;  3REH A;  3MVD C;  2FJ7 C;  2L5A A;  4J8V B;  2F8N K;  3W99 A;  2Y2H A;  5GXQ C;  5B31 G;  4QLC D;  1P3G B;  2RIQ A;  5B0Y A;  2ARO C;  2RVQ C;  3X1U B;  5FUG B;  4Z5T B;  1P3A B;  5B32 C;  4J8V D;  5G49 A;  1HTA A;  4Z66 C;  1N1J B;  3NQJ B;  4Z5T D;  4J8X B;  2ZY4 A;  3LZ0 D;  1ZLA C;  5BNX B;  4QLC A;  3REJ D;  5CPJ B;  3TU4 A;  4J8X D;  4J8V A;  1KX4 B;  2J8P A;  5CPJ D;  4ZUX B;  4Z5T A;  3LZ0 A;  5AY8 B;  3AZF B;  5B2I C;  4ZUX D;  3X1S B;  3REJ A;  2YFV B;  1B67 A;  3A1K A;  5AY8 D;  1ULY A;  5BNX A;  3TU4 C;  1EQZ B;  2HIO B;  2XD1 A;  4J8W C;  1EQZ D;  2HIO D;  4ZUX A;  3A6N B;  5AY8 A;  4H9O B;  3AZM D;  3B6F C;  3EPL A;  3H0R C;  3WAA C;  4R8P C;  1EQZ A;  1TZY B;  4KHA B;  3AZI C;  5B31 B;  1M19 C;  5GSU B;  1TZY D;  1PZR A;  5CP6 B;  3AZM A;  3WKJ C;  3UT9 B;  3MGR C;  1P3M A;  5GSU D;  1BH9 B;  4H9O A;  3AYW B;  5CP6 D;  3MGP B;  3AFA C;  4EO5 C;  2NQB B;  3UT9 D;  1P3F B;  3AYW D;  5C3I C;  5E5A B;  3AV2 C;  3REK B;  3MGP D;  3AZL C;  1TZY A;  2NQB D;  1P3F D;  4JJN D;  3REK D;  5B32 G;  5AV9 B;  5AV5 B;  1P3M C;  4Z2M G;  2Y2P A;  4WU9 D;  5AV5 D;  2XD5 A;  5AV9 D;  5B24 C;  3LEL C;  3WTP D;  2NQB A;  4YM6 B;  3AV1 D;  1P3F A;  4JJN A;  3REK A;  5B2J A;  3V9R B;  1T3U A;  3X1V C;  4WU9 A;  2F8N A;  5B1M C;  2HUE B;  3B0D C;  5AV9 A;  3O62 D;  3WTP A;  1AOI B;  5DNM B;  3AV1 A;  2F8N H;  3W96 D;  2PYO C;  3WA9 B;  4DQY B;  3REI A;  3REL C;  3B0C W;  1AOI D;  5DNM D;  5B2J C;  1M18 B;  5B1L B;  2DF4 C;  4H9Q B;  4KGC B;  3LZ1 B;  2NZD B;  3WTP E;  4G92 C;  3O62 A;  4ZBJ C;  3AZE C;  5B1L D;  2ZY2 A;  1A7W A;  3LZ1 D;  3B6G B;  2NZD D;  4XZQ A;  3NQU B;  3W96 A;  1AOI A;  5DNM A;  1P34 C;  2IO5 B;  3B6G D;  3REI C;  4LD9 B;  4AWL C;  1F66 D;  1P3P B;  4DRA A;  5GT0 C;  5CPK B;  5AVB B;  1S32 B;  5B1L A;  4YS3 C;  3KSY A;  3LZ1 A;  2NZD A;  1P3P D;  5JRG B;  3UTA C;  5B32 B;  3LJA B;  5CPK D;  1S32 D;  1P3I B;  4XZQ C;  5BT1 C;  3EPJ A;  3B6G A;  5JRG D;  5AV8 C;  3W98 D;  3NQU A;  3LJA D;  1F66 A;  4KUD C;  3C1B C;  1P3I D;  4XUJ C;  1P3L B;  3AZK B;  3X1T C;  3AZG A;  1P3P A;  1Z2C B;  5CPK A;  1S32 A;  1P3G D;  3AN2 B;  1P3L D;  3AZK D;  1P3A D;  3X1U D;  1P3O C;  1KX3 B;  5BS7 C;  3W98 A;  3LJA A;  3R45 A;  2LY8 A;  3AN2 D;  1H3O B;  2Y2I A;  1P3I A;  3REH C;  5B2I B;  2Y2J A;  1KX3 D;  2YFW A;  3W99 C;  2Y2K A;  5GT3 B;  4E45 A;  3AZJ B;  5B0Y C;  3AZN B;  1HQ3 B;  1P3G A;  3AZG C;  1P3L A;  3VH5 T;  3EPH A;  1P3A A;  4NE6 A;  5FUG A;  3X1U A;  5GT3 D;  4CAY B;  4J8W B;  3AZJ D;  3AZN D;  1HQ3 D;  5BNV B;  3AN2 A;  1KX4 D;  1N1J A;  3NQJ A;  4J8X A;  4QLC C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...