1P3GC

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
104
structure length
104
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 32
structure length 104
sequence length 104
chains with identical sequence G
ec nomenclature
pdb deposition date 2003-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3gC00
4J8UD 1P3IA 5B1MD 4JJNB 1U35D 1P3BB 3KUYC 3AZHA 2F8NK 5F99D 1P3PC 4XUJB 3LELA 1ID3A 5B2IA 5B1LD 5DNMD 3AN2D 3LJAC 5AV9D 1HQ3A 2FJ7C 3MGSA 5DNNA 3WA9C 1KX5C 1KX3B 1KX4B 3B0DB 3AZKD 2AROC 1P3OC 1P3AC 3B6FB 5CHLB 4WNNB 1P3MC 5CP6B 3AZJA 5GT3B 5AV6D 1P3FB 2NQBA 3AZGD 5E5AD 1JFIA 4LD9D 3AZFC 1AOIC 5BS7C 3V9RB 1P34C 1M19A 3KUYB 5GT3A 3KWQC 4NE5A 3UTBB 3W97C 1P3PB 4J8UC 5B1MC 3O62B 1TZYB 2FJ7B 1P3GB 5F99C 3WA9B 3LZ0D 3W99D 4J8WD 3X1TD 5AVCD 3AV1B 5B1LC 5DNMC 3AZLB 5AV9C 4H9OA 4YS3C 3LJAA 3WA9A 1KX5A 3KSYA 3AZKC 2AROA 1P3OA 4CSRB 1P3AA 4WU8D 4XZQC 4R8PD 1P3MA 3TU4A 5CPID 1F66D 1P34B 5B24D 4WZSB 4G91C 1S32B 2IO5B 1BH9B 2NZDB 3AZGC 5E5AC 4LD9C 3REID 4J8UB 1M18D 3AZFA 5AY8B 5BS7A 5BO0A 1U35B 1AOIA 1P34A 4H9RA 3WKJB 3KWQA 5B33D 4ZBJB 3W97A 1ID3D 5B2ID 4J8UA 5B1MA 4YM6D 5DNMB 3AN2B 3LZ1B 3MGSD 5F99A 3RELD 3LZ0C 3AV2D 2L5AA 3W99C 4J8WC 5AVBB 3X1TC 5B32G 5AVCC 5B1LA 3B6GC 5AV9A 4YS3A 3REJD 5AV6B 3AZJD 5CPJB 5B0YC 3AZKA 5E5AB 4KHAB 4WU8C 4R8PC 4XZQA 3X1VC 2YFWB 5CPIC 5B24C 1M19D 4ZUXD 5B40B 5JA4B 3AZGA 5E5AA 2BYKB 3WAAB 1TAFB 3REIC 4LD9A 1M18C 5B33C 3X1SA 3C1CB 1ID3C 4YM6C 3AFAA 2CV5D 3RELC 3B0CT 3AV2C 3LZ0A 4H9QA 1KX5D 3W99A 4J8WA 3X1TA 5AVCA 1Q9CA 2AROD 5FUGB 3B6GA 3A6ND 3REJC 1P3MD 1F66B 3TU4D 3X1UD 2F8NB 4G92C 5B0YA 4X23A 3REHD 4WU8A 4R8PA 1R4VA 1P3IB 2RVQC 3X1VA 5CPIA 1M19C 1WWIA 5B24A 3AZHB 2LY8A 4ZUXC 2PYOD 4AWLB 3B0CW 4H9NA 1P3LA 3W97D 3LELB 1ID3B 5B0ZA 5B2IB 3REIA 1M18A 4YM6B 3MVDD 5B32D 1HQ3B 5B33A 3MGSB 5DNNB 4H9PA 3W98C 4YM6A 2CV5C 2BYMA 4KGCD 4QLCD 4YS3D 1BFMA 2F8NH 3MNND 3RELA 3AZJB 3AV2A 2HUEC 2NQBB 1H3OA 4EO5B 5BNXA 3A6NC 4XZQD 1JFIB 3AZNC 3REJA 3TU4C 3X1UC 1M19B 4J8VC 3REHC 5AV8D 3NQJA 2PYOC 4ZUXA 3X1SD 5AV5D 3WTPD 3MVDC 5B32C 3AFAD 3AZED 4H9OB 3LJAB 3KXBA 5B2JD 1KX5B 3W98A 2AROB 2CV5A 5JRGD 1P3OB 4QLCC 1P3AB 4KGCC 3B6GD 4E44A 1P3MB 3TU4B 3MNNC 1F1EA 3AYWC 5B0YD 4X23D 3A6NA 3AZFB 3AZNA 3X1VD 5BO0B 1AOIB 5C3IC 4H9RB 3X1UA 3W96D 4J8VA 3KWQB 3W97B 1P3LD 5AV8C 3REHA 3NQUA 5B0ZD 4WU9D 5B1MB 1ZLAD 4DRAA 2PYOA 3X1SC 1EQZD 5AV5C 5F99B 3AZIA 1M1AA 3WTPC 4M6BA 5GXQD 5B1LB 4Z5TA 5B32A 3AFAC 3MVDA 3AZEC 3MGQD 1P3KD 5AV9B 4YS3B 5B2JC 3MNNB 5KDMA 3AZKB 1N1JA 5JRGC 3MGRA 2HIOD 4KGCA 4QLCA 4XZQB 4J8XD 3MNNA 3REKD 4G91B 3UT9D 4X23C 1B67A 3AYWA 3AZGB 4LD9B 2RVQD 3UTAD 3W96C 4UUZA 5CPKA 3X1SB 1P3BD 1P3LC 5AV8A 5B0ZC 4WU9C 4HGAC 3AFAB 1ZLAC 3VH5A 3KXBD 1EQZC 2YFVA 5AV5A 3LZ0B 4H9QB 3W99B 4J8WB 3WTPA 3X1TB 4CAYA 5AVCB 3W98D 5GXQC 1P3KC 5JRGB 3AZEA 3MGQC 1KX4D 3B6GB 5B2JA 3VH5W 4Z66C 1HTAA 5B0YB 4X23B 2HIOC 5JRGA 1P3FD 4WU8B 5GT0C 4R8PB 5B31G 4J8XC 3X1VB 3MGPA 3AZND 3REKC 5CPIB 5B24B 3W96B 5GSUC 1KU5A 4J8VD 3UT9C 4H9NB 5G49A 1P3LB 5B0ZB 3REIB 4HGAB 1M18B 3UTAC 3W96A 5B33B 3R45B 1P3BC 1A7WA 3AZMA 3AZID 3O62D 1M1AD 4H9PB 1P3GD 4WU9A 4XUJC 1BH8A 5GXQB 2BYMB 4Z5TD 1ZLAA 3AV1D 3KXBC 4Z2MG 3R45A 1EQZA 3AZLD 3RELB 4NFTA 3AV2B 5GXQA 1H3OB 3MGRD 1P3KA 1KX4C 3B0DC 3MGQA 5BNXB 3REJB 4NE6A 4NE3A 4G92B 4Z66A 5BNVA 1B6WA 3AYWD 1P3FC 2HIOA 1S32D 4H9SC 5GT0A 4J8XA 3UTAB 3REKA 3NQJB 5GSUA 4ZUXB 5CPKD 3VH6A 5AY8D 3UT9A 2F8NG 3WKJD 4KUDA 3UTBC 3UTAA 3KXBB 4JJNA 1P3BA 3AZIC 3O62C 1TZYC 3LZ1D 1ULYA 1P3GC 1M1AC 3VH6W 3W98B 4XUJA 2CV5B 4Z5TC 5AVBD 3AV1C 3AZLC 5B31D 2HUEB 3MGRC 5CPJD 1KX3A 3WTPE 1KX4A 3A6NB 3AZNB 3MGPD 3X1UB 3B6FA 4WNNA 4J8VB 3B0BA 5CP6A 1S32C 2IO5C 1P3FA 3REHB 2NZDC 3NQUB 4H9SA 5B40D 3WAAD 1WWSA 4E45A 5CPKC 2PYOB 5AY8C 1U35C 3WKJC 3V9RA 3KUYA 3AZIB 3AZMD 1M1AB 4ZBJC 3UTBA 3C1CD 3MVDB 5B32B 1P3PA 4Z5TB 2CWEA 3C1BD 3AN2C 5KDMB 3LZ1C 4DRBA 1TZYA 3O62A 2FJ7A 1P3GA 1N1JB 3MGRB 5AVBC 4KGCB 4QLCB 3AV1A 5B31C 3AZLA 4Z66D 3AYWB 5AV6C 5CPJC 2F8ND 5GT0D 3MGPC 4CSRA 5C3IB 4UUZB 5GSUD 5CPKB 1P3ID 4KUDD 3AZHD 1S32A 2NZDA 1BH9A 5AV8B 5B40C 3WAAC 3LELD 5AY8A 3VH5T 4JJND 1U35A 3WKJA 2YFVB 5AV5B 3AZMC 1HQ3D 3WTPB 4CAYB 3C1CC 5DNND 4XUJD 3AZEB 5DNMA 5B2JB 3C1BC 5B31B 3AN2A 3LZ1A 1KX3D 5AVBA 2NQBD 3MGPB 5B31A 3B6FD 1F66C 5BT1D 5CP6D 5G49B 5AV6A 5CPJA 5GT3D 4KHAA 1P3IC 4KUDC 2YFWA 3AZHC 3KUYD 3AZMB 5B40A 5JA4A 4AWLC 3UTBD 4WU9B 2BYKA 1BH8B 4WV4B 3LELC 1P3PD 5B2IC 1TAFA 1ZLAB 3WAAA 4JJNC 3C1BB 1EQZB 3LJAD 1HQ3C 1TZYD 3MGSC 2FJ7D 5DNNC 3C1CA 1P3KB 3WA9D 3MGQB 2JSSA 3C1BA 1P3OD 1P3AD 4Z66B 5BNVB 3AZJC 1KX3C 2HIOB 2NQBC 5GT0B 4J8XB 4EO5C 5FUGA 3REKB 3B6FC 5GSUB 5BT1C 5CP6C 3AZFD 3UT9B 1AOID 1F66A 4KUDB 3VH6T 4Z2MH 5GT3C 1P34D 2F8NA 2NZDD 3KWQD
chains in the Genus database with same CATH superfamily
2Y2OA 4DQYB 4J8UD 1P3IA 5B1MD 4JJNB 1U35D 1P3BB 3KUYC 3AZHA 2F8NK 5F99D 1P3PC 4XUJB 3LELA 1ID3A 5B2IA 2BG1A 5B1LD 5DNMD 3AN2D 3LJAC 5AV9D 1HQ3A 2FJ7C 3MGSA 5DNNA 2JE5A 1KX5C 3WA9C 1KX3B 1KX4B 3B0DB 3AZKD 2AROC 1P3OC 1P3AC 3B6FB 2Y2MA 5CHLB 4WNNB 1P3MC 2ZY5A 5CP6B 3AZJA 5GT3B 5AV6D 1P3FB 2NQBA 3AZGD 5E5AD 1JFIA 4LD9D 3AZFC 1AOIC 5BS7C 3V9RB 1P34C 1M19A 3KUYB 5GT3A 3KWQC 4NE5A 3UTBB 3W97C 3EPHA 1P3PB 4J8UC 5B1MC 3O62B 1TZYB 2FJ7B 1P3GB 5F99C 3WA9B 3LZ0D 3W99D 4J8WD 3X1TD 5AVCD 3AV1B 5B1LC 5DNMC 3AZLB 5AV9C 4H9OA 4YS3C 3LJAA 2Y2GA 3WA9A 1KX5A 3KSYA 3AZKC 2AROA 1P3OA 4CSRB 1P3AA 4WU8D 4XZQC 4R8PD 1P3MA 2Y2PA 3TU4A 5CPID 1F66D 1P34B 5B24D 4WZSB 4G91C 1S32B 2IO5B 1BH9B 2NZDB 3AZGC 5E5AC 3EPKA 4LD9C 3REID 4J8UB 1M18D 3AZFA 5AY8B 5BS7A 5BO0A 1U35B 1AOIA 1P34A 4H9RA 3WKJB 3KWQA 5B33D 4ZBJB 3W97A 2Y2HA 2Y2NA 1ID3D 5B2ID 2J8PA 4J8UA 5B1MA 4YM6D 5DNMB 3AN2B 3LZ1B 3MGSD 5F99A 3RELD 3LZ0C 3EPLA 3AV2D 2L5AA 3W99C 3IP4C 5AVBB 4J8WC 5B32G 5AVCC 3X1TC 5B1LA 3B6GC 5AV9A 4YS3A 3REJD 5AV6B 3AZJD 5CPJB 5B0YC 3H0LC 3AZKA 5E5AB 4KHAB 4WU8C 4R8PC 4XZQA 3X1VC 3KFUG 2YFWB 5CPIC 5B24C 1M19D 4ZUXD 5B40B 5JA4B 3AZGA 5E5AA 2BYKB 3WAAB 1TAFB 3REIC 4LD9A 1M18C 2G5HC 5B33C 3X1SA 3C1CB 1ID3C 4YM6C 3AFAA 2CV5D 3RELC 3B0CT 3AV2C 3LZ0A 4H9QA 1KX5D 3W99A 4J8WA 3X1TA 5AVCA 1Q9CA 2AROD 5FUGB 3B6GA 3A6ND 3REJC 1P3MD 1F66B 3TU4D 3X1UD 2F8NB 4G92C 5B0YA 4X23A 3REHD 4WU8A 4R8PA 1R4VA 1P3IB 2RVQC 3X1VA 5CPIA 1M19C 1WWIA 5B24A 3AZHB 2LY8A 2RIQA 4ZUXC 2PYOD 4AWLB 3B0CW 4H9NA 1P3LA 3W97D 3LELB 1ID3B 5B0ZA 5B2IB 3REIA 1M18A 4YM6B 3MVDD 3H0RC 5B32D 1HQ3B 5B33A 3MGSB 5DNNB 2ZY4A 4H9PA 3W98C 4YM6A 1W2EA 2CV5C 2BYMA 4KGCD 4QLCD 4YS3D 1BFMA 2F8NH 3MNND 3RELA 3AZJB 3AV2A 2HUEC 2NQBB 1H3OA 4EO5B 5BNXA 3A6NC 4XZQD 1JFIB 3AZNC 3REJA 3TU4C 3X1UC 1M19B 4J8VC 3REHC 5AV8D 3NQJA 2PYOC 4ZUXA 3X1SD 5AV5D 3WTPD 3MVDC 5B32C 2ZM5A 3AFAD 3AZED 4H9OB 3LJAB 3KXBA 5B2JD 1KX5B 3A1KA 3W98A 2AROB 2CV5A 5JRGD 3P5JB 4QLCC 1P3AB 1P3OB 3B6GD 4KGCC 4E44A 1P3MB 3EG5B 3TU4B 3MNNC 1F1EA 3AYWC 5B0YD 4X23D 3A6NA 3AZFB 3AZNA 3X1VD 5BO0B 1AOIB 5C3IC 4H9RB 3X1UA 3W96D 4J8VA 3KWQB 3W97B 1P3LD 5AV8C 3REHA 3NQUA 5B0ZD 4WU9D 5B1MB 1ZLAD 4DRAA 2PYOA 3X1SC 1T3UA 1EQZD 5AV5C 5F99B 3AZIA 1M1AA 3WTPC 4M6BA 5GXQD 5B1LB 4Z5TA 5B32A 3AFAC 3MVDA 3AZEC 3MGQD 1P3KD 5AV9B 4YS3B 5B2JC 3MNNB 5KDMA 3AZKB 2DQNC 1N1JA 5JRGC 3MGRA 2HIOD 4KGCA 4QLCA 4XZQB 4J8XD 3MNNA 3REKD 4G91B 3UT9D 4X23C 1B67A 3AYWA 3AZGB 4LD9B 3FDDA 2RVQD 3UTAD 3W96C 4UUZA 5CPKA 3X1SB 1P3BD 1P3LC 5AV8A 5B0ZC 4WU9C 4HGAC 3AFAB 1ZLAC 3VH5A 3KXBD 1EQZC 2YFVA 5AV5A 3EPJA 3LZ0B 4H9QB 3W99B 4J8WB 3WTPA 3X1TB 4CAYA 5AVCB 3W98D 5GXQC 1Z2CB 1P3KC 5JRGB 3AZEA 3MGQC 1KX4D 3B6GB 5B2JA 2G5IC 3VH5W 4Z66C 1HTAA 2Y2KA 2F2AC 5B0YB 4X23B 2HIOC 5JRGA 1P3FD 4WU8B 5GT0C 4R8PB 5B31G 4J8XC 3X1VB 3MGPA 3AZND 3REKC 5CPIB 5B24B 3W96B 5GSUC 1KU5A 4J8VD 3UT9C 4H9NB 5G49A 1P3LB 5B0ZB 3REIB 4HGAB 1M18B 2DF4C 3UTAC 3W96A 5B33B 3R45B 1P3BC 1A7WA 3AZMA 3AZID 3O62D 1M1AD 4H9PB 1P3GD 4WU9A 4XUJC 1BH8A 5GXQB 2BYMB 4Z5TD 1ZLAA 3AV1D 3KXBC 4Z2MG 3R45A 1EQZA 2FFFB 2W8SA 3AZLD 3RELB 4NFTA 3AV2B 5GXQA 1H3OB 2Y2LA 3MGRD 1P3KA 1KX4C 3B0DC 3MGQA 5BNXB 3REJB 4NE6A 4NE3A 4G92B 2XD5A 4Z66A 5BNVA 1B6WA 3AYWD 1P3FC 2HIOA 1S32D 4H9SC 5GT0A 4J8XA 3UTAB 3REKA 3NQJB 5GSUA 4ZUXB 5CPKD 3VH6A 5AY8D 3UT9A 2F8NG 3WKJD 4KUDA 3UTBC 2Y2IA 3UTAA 3KXBB 4JJNA 1P3BA 3AZIC 3O62C 1TZYC 3LZ1D 1ULYA 1P3GC 1M1AC 3VH6W 3W98B 4XUJA 2CV5B 4Z5TC 5AVBD 3AV1C 2ZY3A 4UPKA 5B31D 3AZLC 2ZY2A 2HUEB 3MGRC 5CPJD 1KX3A 3WTPE 1KX4A 3A6NB 3AZNB 3MGPD 2JCHA 3X1UB 3B6FA 4WNNA 4J8VB 3B0BA 5CP6A 1S32C 2IO5C 3H0MC 3REHB 1P3FA 3NQUB 4H9SA 3A1IA 5B40D 2NZDC 3WAAD 1WWSA 4E45A 5CPKC 2PYOB 5AY8C 1U35C 3WKJC 3V9RA 3KUYA 2UWXA 3AZIB 3AZMD 1M1AB 4WJ3C 4ZBJC 3UTBA 3C1CD 3MVDB 5B32B 1P3PA 4Z5TB 3AL0C 2CWEA 3C1BD 3AN2C 5KDMB 3LZ1C 4DRBA 1TZYA 3O62A 2FJ7A 1P3GA 2Y2JA 1N1JB 3MGRB 5AVBC 4KGCB 4QLCB 3AV1A 5B31C 3AZLA 4Z66D 3AYWB 5AV6C 5CPJC 2F8ND 5GT0D 3MGPC 4CSRA 5C3IB 4UUZB 5GSUD 5CPKB 1P3ID 4KUDD 3AZHD 1S32A 2NZDA 1BH9A 3F6TA 5AV8B 5B40C 3WAAC 3LELD 2VQRA 5AY8A 3VH5T 4JJND 1U35A 3WKJA 2YFVB 5AV5B 3AZMC 1HQ3D 3WTPB 4CAYB 3C1CC 2Y2QA 5DNND 4XUJD 3AZEB 5DNMA 5B2JB 3C1BC 5B31B 3AN2A 3LZ1A 1KX3D 5AVBA 2NQBD 3MGPB 5B31A 3B6FD 1F66C 5BT1D 5CP6D 5G49B 5AV6A 5CPJA 5GT3D 4KHAA 1P3IC 4KUDC 2YFWA 3AZHC 3KUYD 3AZMB 5B40A 5JA4A 4AWLC 3UTBD 4WU9B 2BYKA 1BH8B 4WV4B 3LELC 1P3PD 5B2IC 1TAFA 1ZLAB 3WAAA 2XD1A 4JJNC 3C1BB 1EQZB 3LJAD 1HQ3C 1PZRA 1TZYD 3MGSC 2FJ7D 5DNNC 3C1CA 1P3KB 3WA9D 3MGQB 2JSSA 3C1BA 1P3OD 1P3AD 4Z66B 5BNVB 3AZJC 1KX3C 2HIOB 2NQBC 5GT0B 4J8XB 4EO5C 5FUGA 3REKB 3B6FC 5GSUB 5BT1C 5CP6C 3AZFD 3UT9B 1AOID 1F66A 4KUDB 3VH6T 4Z2MH 5GT3C 1P34D 2F8NA 2NZDD 3KWQD
chains in the Genus database with same CATH topology
2Y2OA 4DQYB 4J8UD 1P3IA 5B1MD 4JJNB 1U35D 1P3BB 3KUYC 3AZHA 2F8NK 5F99D 1P3PC 4XUJB 3LELA 1ID3A 5B2IA 2BG1A 5B1LD 5DNMD 3AN2D 3LJAC 5AV9D 1HQ3A 2FJ7C 3MGSA 5DNNA 2JE5A 1KX5C 3WA9C 1KX3B 1KX4B 3B0DB 3AZKD 2AROC 1P3OC 1P3AC 3B6FB 2Y2MA 5CHLB 4WNNB 1P3MC 2ZY5A 5CP6B 3AZJA 5GT3B 5AV6D 1P3FB 2NQBA 3AZGD 5E5AD 1JFIA 4LD9D 3AZFC 1AOIC 5BS7C 3V9RB 1P34C 1M19A 3KUYB 5GT3A 3KWQC 4NE5A 3UTBB 3W97C 3EPHA 1P3PB 4J8UC 5B1MC 3O62B 1TZYB 2FJ7B 1P3GB 5F99C 3WA9B 3LZ0D 3W99D 4J8WD 3X1TD 5AVCD 3AV1B 5B1LC 5DNMC 3AZLB 5AV9C 4H9OA 4YS3C 3LJAA 2Y2GA 3WA9A 1KX5A 3KSYA 3AZKC 2AROA 1P3OA 4CSRB 1P3AA 4WU8D 4XZQC 4R8PD 1P3MA 2Y2PA 3TU4A 5CPID 1F66D 1P34B 5B24D 4WZSB 4G91C 1S32B 2IO5B 1BH9B 2NZDB 3AZGC 5E5AC 3EPKA 4LD9C 3REID 4J8UB 1M18D 3AZFA 5AY8B 5BS7A 5BO0A 1U35B 1AOIA 1P34A 4H9RA 3WKJB 3KWQA 5B33D 4ZBJB 3W97A 2Y2HA 2Y2NA 1ID3D 5B2ID 2J8PA 4J8UA 5B1MA 4YM6D 5DNMB 3AN2B 3LZ1B 3MGSD 5F99A 3RELD 3LZ0C 3EPLA 3AV2D 2L5AA 3W99C 3IP4C 5AVBB 4J8WC 5B32G 5AVCC 3X1TC 5B1LA 3B6GC 5AV9A 4YS3A 3REJD 5AV6B 3AZJD 5CPJB 5B0YC 3H0LC 3AZKA 5E5AB 4KHAB 4WU8C 4R8PC 4XZQA 3X1VC 3KFUG 2YFWB 5CPIC 5B24C 1M19D 4ZUXD 5B40B 5JA4B 3AZGA 5E5AA 2BYKB 3WAAB 1TAFB 3REIC 4LD9A 1M18C 2G5HC 5B33C 3X1SA 3C1CB 1ID3C 4YM6C 3AFAA 2CV5D 3RELC 3B0CT 3AV2C 3LZ0A 4H9QA 1KX5D 3W99A 4J8WA 3X1TA 5AVCA 1Q9CA 2AROD 5FUGB 3B6GA 3A6ND 3REJC 1P3MD 1F66B 3TU4D 3X1UD 2F8NB 4G92C 5B0YA 4X23A 3REHD 4WU8A 4R8PA 1R4VA 1P3IB 2RVQC 3X1VA 5CPIA 1M19C 1WWIA 5B24A 3AZHB 2LY8A 2RIQA 4ZUXC 2PYOD 4AWLB 3B0CW 4H9NA 1P3LA 3W97D 3LELB 1ID3B 5B0ZA 5B2IB 3REIA 1M18A 4YM6B 3MVDD 3H0RC 5B32D 1HQ3B 5B33A 3MGSB 5DNNB 2ZY4A 4H9PA 3W98C 4YM6A 1W2EA 2CV5C 2BYMA 4KGCD 4QLCD 4YS3D 1BFMA 2F8NH 3MNND 3RELA 3AZJB 3AV2A 2HUEC 2NQBB 1H3OA 4EO5B 5BNXA 3A6NC 4XZQD 1JFIB 3AZNC 3REJA 3TU4C 3X1UC 1M19B 4J8VC 3REHC 5AV8D 3NQJA 2PYOC 4ZUXA 3X1SD 5AV5D 3WTPD 3MVDC 5B32C 2ZM5A 3AFAD 3AZED 4H9OB 3LJAB 3KXBA 5B2JD 1KX5B 3A1KA 3W98A 2AROB 2CV5A 5JRGD 3P5JB 4QLCC 1P3AB 1P3OB 3B6GD 4KGCC 4E44A 1P3MB 3EG5B 3TU4B 3MNNC 1F1EA 3AYWC 5B0YD 4X23D 3A6NA 3AZFB 3AZNA 3X1VD 5BO0B 1AOIB 5C3IC 4H9RB 3X1UA 3W96D 4J8VA 3KWQB 3W97B 1P3LD 5AV8C 3REHA 3NQUA 5B0ZD 4WU9D 5B1MB 1ZLAD 4DRAA 2PYOA 3X1SC 1T3UA 1EQZD 5AV5C 5F99B 3AZIA 1M1AA 3WTPC 4M6BA 5GXQD 5B1LB 4Z5TA 5B32A 3AFAC 3MVDA 3AZEC 3MGQD 1P3KD 5AV9B 4YS3B 5B2JC 3MNNB 5KDMA 3AZKB 2DQNC 1N1JA 5JRGC 3MGRA 2HIOD 4KGCA 4QLCA 4XZQB 4J8XD 3MNNA 3REKD 4G91B 3UT9D 4X23C 1B67A 3AYWA 3AZGB 4LD9B 3FDDA 2RVQD 3UTAD 3W96C 4UUZA 5CPKA 3X1SB 1P3BD 1P3LC 5AV8A 5B0ZC 4WU9C 4HGAC 3AFAB 1ZLAC 3VH5A 3KXBD 1EQZC 2YFVA 5AV5A 3EPJA 3LZ0B 4H9QB 3W99B 4J8WB 3WTPA 3X1TB 4CAYA 5AVCB 3W98D 5GXQC 1Z2CB 1P3KC 5JRGB 3AZEA 3MGQC 1KX4D 3B6GB 5B2JA 2G5IC 3VH5W 4Z66C 1HTAA 2Y2KA 2F2AC 5B0YB 4X23B 2HIOC 5JRGA 1P3FD 4WU8B 5GT0C 4R8PB 5B31G 4J8XC 3X1VB 3MGPA 3AZND 3REKC 5CPIB 5B24B 3W96B 5GSUC 1KU5A 4J8VD 3UT9C 4H9NB 5G49A 1P3LB 5B0ZB 3REIB 4HGAB 1M18B 2DF4C 3UTAC 3W96A 5B33B 3R45B 1P3BC 1A7WA 3AZMA 3AZID 3O62D 1M1AD 4H9PB 1P3GD 4WU9A 4XUJC 1BH8A 5GXQB 2BYMB 4Z5TD 1ZLAA 3AV1D 3KXBC 4Z2MG 3R45A 1EQZA 2FFFB 2W8SA 3AZLD 3RELB 4NFTA 3AV2B 5GXQA 1H3OB 2Y2LA 3MGRD 1P3KA 1KX4C 3B0DC 3MGQA 5BNXB 3REJB 4NE6A 4NE3A 4G92B 2XD5A 4Z66A 5BNVA 1B6WA 3AYWD 1P3FC 2HIOA 1S32D 4H9SC 5GT0A 4J8XA 3UTAB 3REKA 3NQJB 5GSUA 4ZUXB 5CPKD 3VH6A 5AY8D 3UT9A 2F8NG 3WKJD 4KUDA 3UTBC 2Y2IA 3UTAA 3KXBB 4JJNA 1P3BA 3AZIC 3O62C 1TZYC 3LZ1D 1ULYA 1P3GC 1M1AC 3VH6W 3W98B 4XUJA 2CV5B 4Z5TC 5AVBD 3AV1C 2ZY3A 4UPKA 5B31D 3AZLC 2ZY2A 2HUEB 3MGRC 5CPJD 1KX3A 3WTPE 1KX4A 3A6NB 3AZNB 3MGPD 2JCHA 3X1UB 3B6FA 4WNNA 4J8VB 3B0BA 5CP6A 1S32C 2IO5C 3H0MC 3REHB 1P3FA 3NQUB 4H9SA 3A1IA 5B40D 2NZDC 3WAAD 1WWSA 4E45A 5CPKC 2PYOB 5AY8C 1U35C 3WKJC 3V9RA 3KUYA 2UWXA 3AZIB 3AZMD 1M1AB 4WJ3C 4ZBJC 3UTBA 3C1CD 3MVDB 5B32B 1P3PA 4Z5TB 3AL0C 2CWEA 3C1BD 3AN2C 5KDMB 3LZ1C 4DRBA 1TZYA 3O62A 2FJ7A 1P3GA 2Y2JA 1N1JB 3MGRB 5AVBC 4KGCB 4QLCB 3AV1A 5B31C 3AZLA 4Z66D 3AYWB 5AV6C 5CPJC 2F8ND 5GT0D 3MGPC 4CSRA 5C3IB 4UUZB 5GSUD 5CPKB 1P3ID 4KUDD 3AZHD 1S32A 2NZDA 1BH9A 3F6TA 5AV8B 5B40C 3WAAC 3LELD 2VQRA 5AY8A 3VH5T 4JJND 1U35A 3WKJA 2YFVB 5AV5B 3AZMC 1HQ3D 3WTPB 4CAYB 3C1CC 2Y2QA 5DNND 4XUJD 3AZEB 5DNMA 5B2JB 3C1BC 5B31B 3AN2A 3LZ1A 1KX3D 5AVBA 2NQBD 3MGPB 5B31A 3B6FD 1F66C 5BT1D 5CP6D 5G49B 5AV6A 5CPJA 5GT3D 4KHAA 1P3IC 4KUDC 2YFWA 3AZHC 3KUYD 3AZMB 5B40A 5JA4A 4AWLC 3UTBD 4WU9B 2BYKA 1BH8B 4WV4B 3LELC 1P3PD 5B2IC 1TAFA 1ZLAB 3WAAA 2XD1A 4JJNC 3C1BB 1EQZB 3LJAD 1HQ3C 1PZRA 1TZYD 3MGSC 2FJ7D 5DNNC 3C1CA 1P3KB 3WA9D 3MGQB 2JSSA 3C1BA 1P3OD 1P3AD 4Z66B 5BNVB 3AZJC 1KX3C 2HIOB 2NQBC 5GT0B 4J8XB 4EO5C 5FUGA 3REKB 3B6FC 5GSUB 5BT1C 5CP6C 3AZFD 3UT9B 1AOID 1F66A 4KUDB 3VH6T 4Z2MH 5GT3C 1P34D 2F8NA 2NZDD 3KWQD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J8U D;  1P3I A;  5B1M D;  4JJN B;  1U35 D;  1P3B B;  3KUY C;  3AZH A;  2F8N K;  5F99 D;  1P3P C;  4XUJ B;  3LEL A;  1ID3 A;  5B2I A;  5B1L D;  5DNM D;  3AN2 D;  3LJA C;  5AV9 D;  1HQ3 A;  2FJ7 C;  3MGS A;  5DNN A;  3WA9 C;  1KX5 C;  1KX3 B;  1KX4 B;  3B0D B;  3AZK D;  2ARO C;  1P3O C;  1P3A C;  3B6F B;  5CHL B;  4WNN B;  1P3M C;  5CP6 B;  3AZJ A;  5GT3 B;  5AV6 D;  1P3F B;  2NQB A;  3AZG D;  5E5A D;  1JFI A;  4LD9 D;  3AZF C;  1AOI C;  5BS7 C;  3V9R B;  1P34 C;  1M19 A;  3KUY B;  5GT3 A;  3KWQ C;  4NE5 A;  3UTB B;  3W97 C;  1P3P B;  4J8U C;  5B1M C;  3O62 B;  1TZY B;  2FJ7 B;  1P3G B;  5F99 C;  3WA9 B;  3LZ0 D;  3W99 D;  4J8W D;  3X1T D;  5AVC D;  3AV1 B;  5B1L C;  5DNM C;  3AZL B;  5AV9 C;  4H9O A;  4YS3 C;  3LJA A;  3WA9 A;  1KX5 A;  3KSY A;  3AZK C;  2ARO A;  1P3O A;  4CSR B;  1P3A A;  4WU8 D;  4XZQ C;  4R8P D;  1P3M A;  3TU4 A;  5CPI D;  1F66 D;  1P34 B;  5B24 D;  4WZS B;  4G91 C;  1S32 B;  2IO5 B;  1BH9 B;  2NZD B;  3AZG C;  5E5A C;  4LD9 C;  3REI D;  4J8U B;  1M18 D;  3AZF A;  5AY8 B;  5BS7 A;  5BO0 A;  1U35 B;  1AOI A;  1P34 A;  4H9R A;  3WKJ B;  3KWQ A;  5B33 D;  4ZBJ B;  3W97 A;  1ID3 D;  5B2I D;  4J8U A;  5B1M A;  4YM6 D;  5DNM B;  3AN2 B;  3LZ1 B;  3MGS D;  5F99 A;  3REL D;  3LZ0 C;  3AV2 D;  2L5A A;  3W99 C;  4J8W C;  5AVB B;  3X1T C;  5B32 G;  5AVC C;  5B1L A;  3B6G C;  5AV9 A;  4YS3 A;  3REJ D;  5AV6 B;  3AZJ D;  5CPJ B;  5B0Y C;  3AZK A;  5E5A B;  4KHA B;  4WU8 C;  4R8P C;  4XZQ A;  3X1V C;  2YFW B;  5CPI C;  5B24 C;  1M19 D;  4ZUX D;  5B40 B;  5JA4 B;  3AZG A;  5E5A A;  2BYK B;  3WAA B;  1TAF B;  3REI C;  4LD9 A;  1M18 C;  5B33 C;  3X1S A;  3C1C B;  1ID3 C;  4YM6 C;  3AFA A;  2CV5 D;  3REL C;  3B0C T;  3AV2 C;  3LZ0 A;  4H9Q A;  1KX5 D;  3W99 A;  4J8W A;  3X1T A;  5AVC A;  1Q9C A;  2ARO D;  5FUG B;  3B6G A;  3A6N D;  3REJ C;  1P3M D;  1F66 B;  3TU4 D;  3X1U D;  2F8N B;  4G92 C;  5B0Y A;  4X23 A;  3REH D;  4WU8 A;  4R8P A;  1R4V A;  1P3I B;  2RVQ C;  3X1V A;  5CPI A;  1M19 C;  1WWI A;  5B24 A;  3AZH B;  2LY8 A;  4ZUX C;  2PYO D;  4AWL B;  3B0C W;  4H9N A;  1P3L A;  3W97 D;  3LEL B;  1ID3 B;  5B0Z A;  5B2I B;  3REI A;  1M18 A;  4YM6 B;  3MVD D;  5B32 D;  1HQ3 B;  5B33 A;  3MGS B;  5DNN B;  4H9P A;  3W98 C;  4YM6 A;  2CV5 C;  2BYM A;  4KGC D;  4QLC D;  4YS3 D;  1BFM A;  2F8N H;  3MNN D;  3REL A;  3AZJ B;  3AV2 A;  2HUE C;  2NQB B;  1H3O A;  4EO5 B;  5BNX A;  3A6N C;  4XZQ D;  1JFI B;  3AZN C;  3REJ A;  3TU4 C;  3X1U C;  1M19 B;  4J8V C;  3REH C;  5AV8 D;  3NQJ A;  2PYO C;  4ZUX A;  3X1S D;  5AV5 D;  3WTP D;  3MVD C;  5B32 C;  3AFA D;  3AZE D;  4H9O B;  3LJA B;  3KXB A;  5B2J D;  1KX5 B;  3W98 A;  2ARO B;  2CV5 A;  5JRG D;  1P3O B;  4QLC C;  1P3A B;  4KGC C;  3B6G D;  4E44 A;  1P3M B;  3TU4 B;  3MNN C;  1F1E A;  3AYW C;  5B0Y D;  4X23 D;  3A6N A;  3AZF B;  3AZN A;  3X1V D;  5BO0 B;  1AOI B;  5C3I C;  4H9R B;  3X1U A;  3W96 D;  4J8V A;  3KWQ B;  3W97 B;  1P3L D;  5AV8 C;  3REH A;  3NQU A;  5B0Z D;  4WU9 D;  5B1M B;  1ZLA D;  4DRA A;  2PYO A;  3X1S C;  1EQZ D;  5AV5 C;  5F99 B;  3AZI A;  1M1A A;  3WTP C;  4M6B A;  5GXQ D;  5B1L B;  4Z5T A;  5B32 A;  3AFA C;  3MVD A;  3AZE C;  3MGQ D;  1P3K D;  5AV9 B;  4YS3 B;  5B2J C;  3MNN B;  5KDM A;  3AZK B;  1N1J A;  5JRG C;  3MGR A;  2HIO D;  4KGC A;  4QLC A;  4XZQ B;  4J8X D;  3MNN A;  3REK D;  4G91 B;  3UT9 D;  4X23 C;  1B67 A;  3AYW A;  3AZG B;  4LD9 B;  2RVQ D;  3UTA D;  3W96 C;  4UUZ A;  5CPK A;  3X1S B;  1P3B D;  1P3L C;  5AV8 A;  5B0Z C;  4WU9 C;  4HGA C;  3AFA B;  1ZLA C;  3VH5 A;  3KXB D;  1EQZ C;  2YFV A;  5AV5 A;  3LZ0 B;  4H9Q B;  3W99 B;  4J8W B;  3WTP A;  3X1T B;  4CAY A;  5AVC B;  3W98 D;  5GXQ C;  1P3K C;  5JRG B;  3AZE A;  3MGQ C;  1KX4 D;  3B6G B;  5B2J A;  3VH5 W;  4Z66 C;  1HTA A;  5B0Y B;  4X23 B;  2HIO C;  5JRG A;  1P3F D;  4WU8 B;  5GT0 C;  4R8P B;  5B31 G;  4J8X C;  3X1V B;  3MGP A;  3AZN D;  3REK C;  5CPI B;  5B24 B;  3W96 B;  5GSU C;  1KU5 A;  4J8V D;  3UT9 C;  4H9N B;  5G49 A;  1P3L B;  5B0Z B;  3REI B;  4HGA B;  1M18 B;  3UTA C;  3W96 A;  5B33 B;  3R45 B;  1P3B C;  1A7W A;  3AZM A;  3AZI D;  3O62 D;  1M1A D;  4H9P B;  1P3G D;  4WU9 A;  4XUJ C;  1BH8 A;  5GXQ B;  2BYM B;  4Z5T D;  1ZLA A;  3AV1 D;  3KXB C;  4Z2M G;  3R45 A;  1EQZ A;  3AZL D;  3REL B;  4NFT A;  3AV2 B;  5GXQ A;  1H3O B;  3MGR D;  1P3K A;  1KX4 C;  3B0D C;  3MGQ A;  5BNX B;  3REJ B;  4NE6 A;  4NE3 A;  4G92 B;  4Z66 A;  5BNV A;  1B6W A;  3AYW D;  1P3F C;  2HIO A;  1S32 D;  4H9S C;  5GT0 A;  4J8X A;  3UTA B;  3REK A;  3NQJ B;  5GSU A;  4ZUX B;  5CPK D;  3VH6 A;  5AY8 D;  3UT9 A;  2F8N G;  3WKJ D;  4KUD A;  3UTB C;  3UTA A;  3KXB B;  4JJN A;  1P3B A;  3AZI C;  3O62 C;  1TZY C;  3LZ1 D;  1ULY A;  1P3G C;  1M1A C;  3VH6 W;  3W98 B;  4XUJ A;  2CV5 B;  4Z5T C;  5AVB D;  3AV1 C;  3AZL C;  5B31 D;  2HUE B;  3MGR C;  5CPJ D;  1KX3 A;  3WTP E;  1KX4 A;  3A6N B;  3AZN B;  3MGP D;  3X1U B;  3B6F A;  4WNN A;  4J8V B;  3B0B A;  5CP6 A;  1S32 C;  2IO5 C;  1P3F A;  3REH B;  2NZD C;  3NQU B;  4H9S A;  5B40 D;  3WAA D;  1WWS A;  4E45 A;  5CPK C;  2PYO B;  5AY8 C;  1U35 C;  3WKJ C;  3V9R A;  3KUY A;  3AZI B;  3AZM D;  1M1A B;  4ZBJ C;  3UTB A;  3C1C D;  3MVD B;  5B32 B;  1P3P A;  4Z5T B;  2CWE A;  3C1B D;  3AN2 C;  5KDM B;  3LZ1 C;  4DRB A;  1TZY A;  3O62 A;  2FJ7 A;  1P3G A;  1N1J B;  3MGR B;  5AVB C;  4KGC B;  4QLC B;  3AV1 A;  5B31 C;  3AZL A;  4Z66 D;  3AYW B;  5AV6 C;  5CPJ C;  2F8N D;  5GT0 D;  3MGP C;  4CSR A;  5C3I B;  4UUZ B;  5GSU D;  5CPK B;  1P3I D;  4KUD D;  3AZH D;  1S32 A;  2NZD A;  1BH9 A;  5AV8 B;  5B40 C;  3WAA C;  3LEL D;  5AY8 A;  3VH5 T;  4JJN D;  1U35 A;  3WKJ A;  2YFV B;  5AV5 B;  3AZM C;  1HQ3 D;  3WTP B;  4CAY B;  3C1C C;  5DNN D;  4XUJ D;  3AZE B;  5DNM A;  5B2J B;  3C1B C;  5B31 B;  3AN2 A;  3LZ1 A;  1KX3 D;  5AVB A;  2NQB D;  3MGP B;  5B31 A;  3B6F D;  1F66 C;  5BT1 D;  5CP6 D;  5G49 B;  5AV6 A;  5CPJ A;  5GT3 D;  4KHA A;  1P3I C;  4KUD C;  2YFW A;  3AZH C;  3KUY D;  3AZM B;  5B40 A;  5JA4 A;  4AWL C;  3UTB D;  4WU9 B;  2BYK A;  1BH8 B;  4WV4 B;  3LEL C;  1P3P D;  5B2I C;  1TAF A;  1ZLA B;  3WAA A;  4JJN C;  3C1B B;  1EQZ B;  3LJA D;  1HQ3 C;  1TZY D;  3MGS C;  2FJ7 D;  5DNN C;  3C1C A;  1P3K B;  3WA9 D;  3MGQ B;  2JSS A;  3C1B A;  1P3O D;  1P3A D;  4Z66 B;  5BNV B;  3AZJ C;  1KX3 C;  2HIO B;  2NQB C;  5GT0 B;  4J8X B;  4EO5 C;  5FUG A;  3REK B;  3B6F C;  5GSU B;  5BT1 C;  5CP6 C;  3AZF D;  3UT9 B;  1AOI D;  1F66 A;  4KUD B;  3VH6 T;  4Z2M H;  5GT3 C;  1P34 D;  2F8N A;  2NZD D;  3KWQ D; 
#chains in the Genus database with same CATH topology
 2Y2O A;  4DQY B;  4J8U D;  1P3I A;  5B1M D;  4JJN B;  1U35 D;  1P3B B;  3KUY C;  3AZH A;  2F8N K;  5F99 D;  1P3P C;  4XUJ B;  3LEL A;  1ID3 A;  5B2I A;  2BG1 A;  5B1L D;  5DNM D;  3AN2 D;  3LJA C;  5AV9 D;  1HQ3 A;  2FJ7 C;  3MGS A;  5DNN A;  2JE5 A;  1KX5 C;  3WA9 C;  1KX3 B;  1KX4 B;  3B0D B;  3AZK D;  2ARO C;  1P3O C;  1P3A C;  3B6F B;  2Y2M A;  5CHL B;  4WNN B;  1P3M C;  2ZY5 A;  5CP6 B;  3AZJ A;  5GT3 B;  5AV6 D;  1P3F B;  2NQB A;  3AZG D;  5E5A D;  1JFI A;  4LD9 D;  3AZF C;  1AOI C;  5BS7 C;  3V9R B;  1P34 C;  1M19 A;  3KUY B;  5GT3 A;  3KWQ C;  4NE5 A;  3UTB B;  3W97 C;  3EPH A;  1P3P B;  4J8U C;  5B1M C;  3O62 B;  1TZY B;  2FJ7 B;  1P3G B;  5F99 C;  3WA9 B;  3LZ0 D;  3W99 D;  4J8W D;  3X1T D;  5AVC D;  3AV1 B;  5B1L C;  5DNM C;  3AZL B;  5AV9 C;  4H9O A;  4YS3 C;  3LJA A;  2Y2G A;  3WA9 A;  1KX5 A;  3KSY A;  3AZK C;  2ARO A;  1P3O A;  4CSR B;  1P3A A;  4WU8 D;  4XZQ C;  4R8P D;  1P3M A;  2Y2P A;  3TU4 A;  5CPI D;  1F66 D;  1P34 B;  5B24 D;  4WZS B;  4G91 C;  1S32 B;  2IO5 B;  1BH9 B;  2NZD B;  3AZG C;  5E5A C;  3EPK A;  4LD9 C;  3REI D;  4J8U B;  1M18 D;  3AZF A;  5AY8 B;  5BS7 A;  5BO0 A;  1U35 B;  1AOI A;  1P34 A;  4H9R A;  3WKJ B;  3KWQ A;  5B33 D;  4ZBJ B;  3W97 A;  2Y2H A;  2Y2N A;  1ID3 D;  5B2I D;  2J8P A;  4J8U A;  5B1M A;  4YM6 D;  5DNM B;  3AN2 B;  3LZ1 B;  3MGS D;  5F99 A;  3REL D;  3LZ0 C;  3EPL A;  3AV2 D;  2L5A A;  3W99 C;  3IP4 C;  5AVB B;  4J8W C;  5B32 G;  5AVC C;  3X1T C;  5B1L A;  3B6G C;  5AV9 A;  4YS3 A;  3REJ D;  5AV6 B;  3AZJ D;  5CPJ B;  5B0Y C;  3H0L C;  3AZK A;  5E5A B;  4KHA B;  4WU8 C;  4R8P C;  4XZQ A;  3X1V C;  3KFU G;  2YFW B;  5CPI C;  5B24 C;  1M19 D;  4ZUX D;  5B40 B;  5JA4 B;  3AZG A;  5E5A A;  2BYK B;  3WAA B;  1TAF B;  3REI C;  4LD9 A;  1M18 C;  2G5H C;  5B33 C;  3X1S A;  3C1C B;  1ID3 C;  4YM6 C;  3AFA A;  2CV5 D;  3REL C;  3B0C T;  3AV2 C;  3LZ0 A;  4H9Q A;  1KX5 D;  3W99 A;  4J8W A;  3X1T A;  5AVC A;  1Q9C A;  2ARO D;  5FUG B;  3B6G A;  3A6N D;  3REJ C;  1P3M D;  1F66 B;  3TU4 D;  3X1U D;  2F8N B;  4G92 C;  5B0Y A;  4X23 A;  3REH D;  4WU8 A;  4R8P A;  1R4V A;  1P3I B;  2RVQ C;  3X1V A;  5CPI A;  1M19 C;  1WWI A;  5B24 A;  3AZH B;  2LY8 A;  2RIQ A;  4ZUX C;  2PYO D;  4AWL B;  3B0C W;  4H9N A;  1P3L A;  3W97 D;  3LEL B;  1ID3 B;  5B0Z A;  5B2I B;  3REI A;  1M18 A;  4YM6 B;  3MVD D;  3H0R C;  5B32 D;  1HQ3 B;  5B33 A;  3MGS B;  5DNN B;  2ZY4 A;  4H9P A;  3W98 C;  4YM6 A;  1W2E A;  2CV5 C;  2BYM A;  4KGC D;  4QLC D;  4YS3 D;  1BFM A;  2F8N H;  3MNN D;  3REL A;  3AZJ B;  3AV2 A;  2HUE C;  2NQB B;  1H3O A;  4EO5 B;  5BNX A;  3A6N C;  4XZQ D;  1JFI B;  3AZN C;  3REJ A;  3TU4 C;  3X1U C;  1M19 B;  4J8V C;  3REH C;  5AV8 D;  3NQJ A;  2PYO C;  4ZUX A;  3X1S D;  5AV5 D;  3WTP D;  3MVD C;  5B32 C;  2ZM5 A;  3AFA D;  3AZE D;  4H9O B;  3LJA B;  3KXB A;  5B2J D;  1KX5 B;  3A1K A;  3W98 A;  2ARO B;  2CV5 A;  5JRG D;  3P5J B;  4QLC C;  1P3A B;  1P3O B;  3B6G D;  4KGC C;  4E44 A;  1P3M B;  3EG5 B;  3TU4 B;  3MNN C;  1F1E A;  3AYW C;  5B0Y D;  4X23 D;  3A6N A;  3AZF B;  3AZN A;  3X1V D;  5BO0 B;  1AOI B;  5C3I C;  4H9R B;  3X1U A;  3W96 D;  4J8V A;  3KWQ B;  3W97 B;  1P3L D;  5AV8 C;  3REH A;  3NQU A;  5B0Z D;  4WU9 D;  5B1M B;  1ZLA D;  4DRA A;  2PYO A;  3X1S C;  1T3U A;  1EQZ D;  5AV5 C;  5F99 B;  3AZI A;  1M1A A;  3WTP C;  4M6B A;  5GXQ D;  5B1L B;  4Z5T A;  5B32 A;  3AFA C;  3MVD A;  3AZE C;  3MGQ D;  1P3K D;  5AV9 B;  4YS3 B;  5B2J C;  3MNN B;  5KDM A;  3AZK B;  2DQN C;  1N1J A;  5JRG C;  3MGR A;  2HIO D;  4KGC A;  4QLC A;  4XZQ B;  4J8X D;  3MNN A;  3REK D;  4G91 B;  3UT9 D;  4X23 C;  1B67 A;  3AYW A;  3AZG B;  4LD9 B;  3FDD A;  2RVQ D;  3UTA D;  3W96 C;  4UUZ A;  5CPK A;  3X1S B;  1P3B D;  1P3L C;  5AV8 A;  5B0Z C;  4WU9 C;  4HGA C;  3AFA B;  1ZLA C;  3VH5 A;  3KXB D;  1EQZ C;  2YFV A;  5AV5 A;  3EPJ A;  3LZ0 B;  4H9Q B;  3W99 B;  4J8W B;  3WTP A;  3X1T B;  4CAY A;  5AVC B;  3W98 D;  5GXQ C;  1Z2C B;  1P3K C;  5JRG B;  3AZE A;  3MGQ C;  1KX4 D;  3B6G B;  5B2J A;  2G5I C;  3VH5 W;  4Z66 C;  1HTA A;  2Y2K A;  2F2A C;  5B0Y B;  4X23 B;  2HIO C;  5JRG A;  1P3F D;  4WU8 B;  5GT0 C;  4R8P B;  5B31 G;  4J8X C;  3X1V B;  3MGP A;  3AZN D;  3REK C;  5CPI B;  5B24 B;  3W96 B;  5GSU C;  1KU5 A;  4J8V D;  3UT9 C;  4H9N B;  5G49 A;  1P3L B;  5B0Z B;  3REI B;  4HGA B;  1M18 B;  2DF4 C;  3UTA C;  3W96 A;  5B33 B;  3R45 B;  1P3B C;  1A7W A;  3AZM A;  3AZI D;  3O62 D;  1M1A D;  4H9P B;  1P3G D;  4WU9 A;  4XUJ C;  1BH8 A;  5GXQ B;  2BYM B;  4Z5T D;  1ZLA A;  3AV1 D;  3KXB C;  4Z2M G;  3R45 A;  1EQZ A;  2FFF B;  2W8S A;  3AZL D;  3REL B;  4NFT A;  3AV2 B;  5GXQ A;  1H3O B;  2Y2L A;  3MGR D;  1P3K A;  1KX4 C;  3B0D C;  3MGQ A;  5BNX B;  3REJ B;  4NE6 A;  4NE3 A;  4G92 B;  2XD5 A;  4Z66 A;  5BNV A;  1B6W A;  3AYW D;  1P3F C;  2HIO A;  1S32 D;  4H9S C;  5GT0 A;  4J8X A;  3UTA B;  3REK A;  3NQJ B;  5GSU A;  4ZUX B;  5CPK D;  3VH6 A;  5AY8 D;  3UT9 A;  2F8N G;  3WKJ D;  4KUD A;  3UTB C;  2Y2I A;  3UTA A;  3KXB B;  4JJN A;  1P3B A;  3AZI C;  3O62 C;  1TZY C;  3LZ1 D;  1ULY A;  1P3G C;  1M1A C;  3VH6 W;  3W98 B;  4XUJ A;  2CV5 B;  4Z5T C;  5AVB D;  3AV1 C;  2ZY3 A;  4UPK A;  5B31 D;  3AZL C;  2ZY2 A;  2HUE B;  3MGR C;  5CPJ D;  1KX3 A;  3WTP E;  1KX4 A;  3A6N B;  3AZN B;  3MGP D;  2JCH A;  3X1U B;  3B6F A;  4WNN A;  4J8V B;  3B0B A;  5CP6 A;  1S32 C;  2IO5 C;  3H0M C;  3REH B;  1P3F A;  3NQU B;  4H9S A;  3A1I A;  5B40 D;  2NZD C;  3WAA D;  1WWS A;  4E45 A;  5CPK C;  2PYO B;  5AY8 C;  1U35 C;  3WKJ C;  3V9R A;  3KUY A;  2UWX A;  3AZI B;  3AZM D;  1M1A B;  4WJ3 C;  4ZBJ C;  3UTB A;  3C1C D;  3MVD B;  5B32 B;  1P3P A;  4Z5T B;  3AL0 C;  2CWE A;  3C1B D;  3AN2 C;  5KDM B;  3LZ1 C;  4DRB A;  1TZY A;  3O62 A;  2FJ7 A;  1P3G A;  2Y2J A;  1N1J B;  3MGR B;  5AVB C;  4KGC B;  4QLC B;  3AV1 A;  5B31 C;  3AZL A;  4Z66 D;  3AYW B;  5AV6 C;  5CPJ C;  2F8N D;  5GT0 D;  3MGP C;  4CSR A;  5C3I B;  4UUZ B;  5GSU D;  5CPK B;  1P3I D;  4KUD D;  3AZH D;  1S32 A;  2NZD A;  1BH9 A;  3F6T A;  5AV8 B;  5B40 C;  3WAA C;  3LEL D;  2VQR A;  5AY8 A;  3VH5 T;  4JJN D;  1U35 A;  3WKJ A;  2YFV B;  5AV5 B;  3AZM C;  1HQ3 D;  3WTP B;  4CAY B;  3C1C C;  2Y2Q A;  5DNN D;  4XUJ D;  3AZE B;  5DNM A;  5B2J B;  3C1B C;  5B31 B;  3AN2 A;  3LZ1 A;  1KX3 D;  5AVB A;  2NQB D;  3MGP B;  5B31 A;  3B6F D;  1F66 C;  5BT1 D;  5CP6 D;  5G49 B;  5AV6 A;  5CPJ A;  5GT3 D;  4KHA A;  1P3I C;  4KUD C;  2YFW A;  3AZH C;  3KUY D;  3AZM B;  5B40 A;  5JA4 A;  4AWL C;  3UTB D;  4WU9 B;  2BYK A;  1BH8 B;  4WV4 B;  3LEL C;  1P3P D;  5B2I C;  1TAF A;  1ZLA B;  3WAA A;  2XD1 A;  4JJN C;  3C1B B;  1EQZ B;  3LJA D;  1HQ3 C;  1PZR A;  1TZY D;  3MGS C;  2FJ7 D;  5DNN C;  3C1C A;  1P3K B;  3WA9 D;  3MGQ B;  2JSS A;  3C1B A;  1P3O D;  1P3A D;  4Z66 B;  5BNV B;  3AZJ C;  1KX3 C;  2HIO B;  2NQB C;  5GT0 B;  4J8X B;  4EO5 C;  5FUG A;  3REK B;  3B6F C;  5GSU B;  5BT1 C;  5CP6 C;  3AZF D;  3UT9 B;  1AOI D;  1F66 A;  4KUD B;  3VH6 T;  4Z2M H;  5GT3 C;  1P34 D;  2F8N A;  2NZD D;  3KWQ D; 
#chains in the Genus database with same CATH homology
 2Y2O A;  4DQY B;  4J8U D;  1P3I A;  5B1M D;  4JJN B;  1U35 D;  1P3B B;  3KUY C;  3AZH A;  2F8N K;  5F99 D;  1P3P C;  4XUJ B;  3LEL A;  1ID3 A;  5B2I A;  2BG1 A;  5B1L D;  5DNM D;  3AN2 D;  3LJA C;  5AV9 D;  1HQ3 A;  2FJ7 C;  3MGS A;  5DNN A;  2JE5 A;  1KX5 C;  3WA9 C;  1KX3 B;  1KX4 B;  3B0D B;  3AZK D;  2ARO C;  1P3O C;  1P3A C;  3B6F B;  2Y2M A;  5CHL B;  4WNN B;  1P3M C;  2ZY5 A;  5CP6 B;  3AZJ A;  5GT3 B;  5AV6 D;  1P3F B;  2NQB A;  3AZG D;  5E5A D;  1JFI A;  4LD9 D;  3AZF C;  1AOI C;  5BS7 C;  3V9R B;  1P34 C;  1M19 A;  3KUY B;  5GT3 A;  3KWQ C;  4NE5 A;  3UTB B;  3W97 C;  3EPH A;  1P3P B;  4J8U C;  5B1M C;  3O62 B;  1TZY B;  2FJ7 B;  1P3G B;  5F99 C;  3WA9 B;  3LZ0 D;  3W99 D;  4J8W D;  3X1T D;  5AVC D;  3AV1 B;  5B1L C;  5DNM C;  3AZL B;  5AV9 C;  4H9O A;  4YS3 C;  3LJA A;  2Y2G A;  3WA9 A;  1KX5 A;  3KSY A;  3AZK C;  2ARO A;  1P3O A;  4CSR B;  1P3A A;  4WU8 D;  4XZQ C;  4R8P D;  1P3M A;  2Y2P A;  3TU4 A;  5CPI D;  1F66 D;  1P34 B;  5B24 D;  4WZS B;  4G91 C;  1S32 B;  2IO5 B;  1BH9 B;  2NZD B;  3AZG C;  5E5A C;  3EPK A;  4LD9 C;  3REI D;  4J8U B;  1M18 D;  3AZF A;  5AY8 B;  5BS7 A;  5BO0 A;  1U35 B;  1AOI A;  1P34 A;  4H9R A;  3WKJ B;  3KWQ A;  5B33 D;  4ZBJ B;  3W97 A;  2Y2H A;  2Y2N A;  1ID3 D;  5B2I D;  2J8P A;  4J8U A;  5B1M A;  4YM6 D;  5DNM B;  3AN2 B;  3LZ1 B;  3MGS D;  5F99 A;  3REL D;  3LZ0 C;  3EPL A;  3AV2 D;  2L5A A;  3W99 C;  3IP4 C;  5AVB B;  4J8W C;  5B32 G;  5AVC C;  3X1T C;  5B1L A;  3B6G C;  5AV9 A;  4YS3 A;  3REJ D;  5AV6 B;  3AZJ D;  5CPJ B;  5B0Y C;  3H0L C;  3AZK A;  5E5A B;  4KHA B;  4WU8 C;  4R8P C;  4XZQ A;  3X1V C;  3KFU G;  2YFW B;  5CPI C;  5B24 C;  1M19 D;  4ZUX D;  5B40 B;  5JA4 B;  3AZG A;  5E5A A;  2BYK B;  3WAA B;  1TAF B;  3REI C;  4LD9 A;  1M18 C;  2G5H C;  5B33 C;  3X1S A;  3C1C B;  1ID3 C;  4YM6 C;  3AFA A;  2CV5 D;  3REL C;  3B0C T;  3AV2 C;  3LZ0 A;  4H9Q A;  1KX5 D;  3W99 A;  4J8W A;  3X1T A;  5AVC A;  1Q9C A;  2ARO D;  5FUG B;  3B6G A;  3A6N D;  3REJ C;  1P3M D;  1F66 B;  3TU4 D;  3X1U D;  2F8N B;  4G92 C;  5B0Y A;  4X23 A;  3REH D;  4WU8 A;  4R8P A;  1R4V A;  1P3I B;  2RVQ C;  3X1V A;  5CPI A;  1M19 C;  1WWI A;  5B24 A;  3AZH B;  2LY8 A;  2RIQ A;  4ZUX C;  2PYO D;  4AWL B;  3B0C W;  4H9N A;  1P3L A;  3W97 D;  3LEL B;  1ID3 B;  5B0Z A;  5B2I B;  3REI A;  1M18 A;  4YM6 B;  3MVD D;  3H0R C;  5B32 D;  1HQ3 B;  5B33 A;  3MGS B;  5DNN B;  2ZY4 A;  4H9P A;  3W98 C;  4YM6 A;  1W2E A;  2CV5 C;  2BYM A;  4KGC D;  4QLC D;  4YS3 D;  1BFM A;  2F8N H;  3MNN D;  3REL A;  3AZJ B;  3AV2 A;  2HUE C;  2NQB B;  1H3O A;  4EO5 B;  5BNX A;  3A6N C;  4XZQ D;  1JFI B;  3AZN C;  3REJ A;  3TU4 C;  3X1U C;  1M19 B;  4J8V C;  3REH C;  5AV8 D;  3NQJ A;  2PYO C;  4ZUX A;  3X1S D;  5AV5 D;  3WTP D;  3MVD C;  5B32 C;  2ZM5 A;  3AFA D;  3AZE D;  4H9O B;  3LJA B;  3KXB A;  5B2J D;  1KX5 B;  3A1K A;  3W98 A;  2ARO B;  2CV5 A;  5JRG D;  3P5J B;  4QLC C;  1P3A B;  1P3O B;  3B6G D;  4KGC C;  4E44 A;  1P3M B;  3EG5 B;  3TU4 B;  3MNN C;  1F1E A;  3AYW C;  5B0Y D;  4X23 D;  3A6N A;  3AZF B;  3AZN A;  3X1V D;  5BO0 B;  1AOI B;  5C3I C;  4H9R B;  3X1U A;  3W96 D;  4J8V A;  3KWQ B;  3W97 B;  1P3L D;  5AV8 C;  3REH A;  3NQU A;  5B0Z D;  4WU9 D;  5B1M B;  1ZLA D;  4DRA A;  2PYO A;  3X1S C;  1T3U A;  1EQZ D;  5AV5 C;  5F99 B;  3AZI A;  1M1A A;  3WTP C;  4M6B A;  5GXQ D;  5B1L B;  4Z5T A;  5B32 A;  3AFA C;  3MVD A;  3AZE C;  3MGQ D;  1P3K D;  5AV9 B;  4YS3 B;  5B2J C;  3MNN B;  5KDM A;  3AZK B;  2DQN C;  1N1J A;  5JRG C;  3MGR A;  2HIO D;  4KGC A;  4QLC A;  4XZQ B;  4J8X D;  3MNN A;  3REK D;  4G91 B;  3UT9 D;  4X23 C;  1B67 A;  3AYW A;  3AZG B;  4LD9 B;  3FDD A;  2RVQ D;  3UTA D;  3W96 C;  4UUZ A;  5CPK A;  3X1S B;  1P3B D;  1P3L C;  5AV8 A;  5B0Z C;  4WU9 C;  4HGA C;  3AFA B;  1ZLA C;  3VH5 A;  3KXB D;  1EQZ C;  2YFV A;  5AV5 A;  3EPJ A;  3LZ0 B;  4H9Q B;  3W99 B;  4J8W B;  3WTP A;  3X1T B;  4CAY A;  5AVC B;  3W98 D;  5GXQ C;  1Z2C B;  1P3K C;  5JRG B;  3AZE A;  3MGQ C;  1KX4 D;  3B6G B;  5B2J A;  2G5I C;  3VH5 W;  4Z66 C;  1HTA A;  2Y2K A;  2F2A C;  5B0Y B;  4X23 B;  2HIO C;  5JRG A;  1P3F D;  4WU8 B;  5GT0 C;  4R8P B;  5B31 G;  4J8X C;  3X1V B;  3MGP A;  3AZN D;  3REK C;  5CPI B;  5B24 B;  3W96 B;  5GSU C;  1KU5 A;  4J8V D;  3UT9 C;  4H9N B;  5G49 A;  1P3L B;  5B0Z B;  3REI B;  4HGA B;  1M18 B;  2DF4 C;  3UTA C;  3W96 A;  5B33 B;  3R45 B;  1P3B C;  1A7W A;  3AZM A;  3AZI D;  3O62 D;  1M1A D;  4H9P B;  1P3G D;  4WU9 A;  4XUJ C;  1BH8 A;  5GXQ B;  2BYM B;  4Z5T D;  1ZLA A;  3AV1 D;  3KXB C;  4Z2M G;  3R45 A;  1EQZ A;  2FFF B;  2W8S A;  3AZL D;  3REL B;  4NFT A;  3AV2 B;  5GXQ A;  1H3O B;  2Y2L A;  3MGR D;  1P3K A;  1KX4 C;  3B0D C;  3MGQ A;  5BNX B;  3REJ B;  4NE6 A;  4NE3 A;  4G92 B;  2XD5 A;  4Z66 A;  5BNV A;  1B6W A;  3AYW D;  1P3F C;  2HIO A;  1S32 D;  4H9S C;  5GT0 A;  4J8X A;  3UTA B;  3REK A;  3NQJ B;  5GSU A;  4ZUX B;  5CPK D;  3VH6 A;  5AY8 D;  3UT9 A;  2F8N G;  3WKJ D;  4KUD A;  3UTB C;  2Y2I A;  3UTA A;  3KXB B;  4JJN A;  1P3B A;  3AZI C;  3O62 C;  1TZY C;  3LZ1 D;  1ULY A;  1P3G C;  1M1A C;  3VH6 W;  3W98 B;  4XUJ A;  2CV5 B;  4Z5T C;  5AVB D;  3AV1 C;  2ZY3 A;  4UPK A;  5B31 D;  3AZL C;  2ZY2 A;  2HUE B;  3MGR C;  5CPJ D;  1KX3 A;  3WTP E;  1KX4 A;  3A6N B;  3AZN B;  3MGP D;  2JCH A;  3X1U B;  3B6F A;  4WNN A;  4J8V B;  3B0B A;  5CP6 A;  1S32 C;  2IO5 C;  3H0M C;  3REH B;  1P3F A;  3NQU B;  4H9S A;  3A1I A;  5B40 D;  2NZD C;  3WAA D;  1WWS A;  4E45 A;  5CPK C;  2PYO B;  5AY8 C;  1U35 C;  3WKJ C;  3V9R A;  3KUY A;  2UWX A;  3AZI B;  3AZM D;  1M1A B;  4WJ3 C;  4ZBJ C;  3UTB A;  3C1C D;  3MVD B;  5B32 B;  1P3P A;  4Z5T B;  3AL0 C;  2CWE A;  3C1B D;  3AN2 C;  5KDM B;  3LZ1 C;  4DRB A;  1TZY A;  3O62 A;  2FJ7 A;  1P3G A;  2Y2J A;  1N1J B;  3MGR B;  5AVB C;  4KGC B;  4QLC B;  3AV1 A;  5B31 C;  3AZL A;  4Z66 D;  3AYW B;  5AV6 C;  5CPJ C;  2F8N D;  5GT0 D;  3MGP C;  4CSR A;  5C3I B;  4UUZ B;  5GSU D;  5CPK B;  1P3I D;  4KUD D;  3AZH D;  1S32 A;  2NZD A;  1BH9 A;  3F6T A;  5AV8 B;  5B40 C;  3WAA C;  3LEL D;  2VQR A;  5AY8 A;  3VH5 T;  4JJN D;  1U35 A;  3WKJ A;  2YFV B;  5AV5 B;  3AZM C;  1HQ3 D;  3WTP B;  4CAY B;  3C1C C;  2Y2Q A;  5DNN D;  4XUJ D;  3AZE B;  5DNM A;  5B2J B;  3C1B C;  5B31 B;  3AN2 A;  3LZ1 A;  1KX3 D;  5AVB A;  2NQB D;  3MGP B;  5B31 A;  3B6F D;  1F66 C;  5BT1 D;  5CP6 D;  5G49 B;  5AV6 A;  5CPJ A;  5GT3 D;  4KHA A;  1P3I C;  4KUD C;  2YFW A;  3AZH C;  3KUY D;  3AZM B;  5B40 A;  5JA4 A;  4AWL C;  3UTB D;  4WU9 B;  2BYK A;  1BH8 B;  4WV4 B;  3LEL C;  1P3P D;  5B2I C;  1TAF A;  1ZLA B;  3WAA A;  2XD1 A;  4JJN C;  3C1B B;  1EQZ B;  3LJA D;  1HQ3 C;  1PZR A;  1TZY D;  3MGS C;  2FJ7 D;  5DNN C;  3C1C A;  1P3K B;  3WA9 D;  3MGQ B;  2JSS A;  3C1B A;  1P3O D;  1P3A D;  4Z66 B;  5BNV B;  3AZJ C;  1KX3 C;  2HIO B;  2NQB C;  5GT0 B;  4J8X B;  4EO5 C;  5FUG A;  3REK B;  3B6F C;  5GSU B;  5BT1 C;  5CP6 C;  3AZF D;  3UT9 B;  1AOI D;  1F66 A;  4KUD B;  3VH6 T;  4Z2M H;  5GT3 C;  1P34 D;  2F8N A;  2NZD D;  3KWQ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...