1P3GC

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
104
structure length
104
Chain Sequence
b'AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 32
structure length 104
sequence length 104
chains with identical sequence G
ec nomenclature
pdb deposition date 2003-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3gC00
1KX3A 1JFIB 3RELD 3B6FA 4KUDB 1S32A 1EQZD 3WTPD 5B40D 4J8UA 2BYKA 5FUGB 5F99C 5DNMC 1B67A 4HGAB 4JJNB 2PYOB 3MGQA 3WA9A 1P3IC 5B0ZB 3C1CD 3NQUA 4KUDD 5GXQB 3AZLB 5GSUA 1P3FC 1TZYC 5CPKB 4H9OB 3R45B 2F8NH 5JA4A 3AZEC 3AN2B 3AV2B 3WKJA 4JJND 2PYOD 5B0ZD 4YM6B 5GXQD 3AZLD 1P3AC 4ZBJB 4H9RA 2HIOB 5CPKD 3VH5W 5E5AC 4ZUXA 3AV2D 3AN2D 1P3PC 1P3BB 1P3KB 3AZKB 3B6GC 4YM6D 4NE3A 2L5AA 5AV9C 4H9PB 3W99C 3MVDA 5CPIC 4Z66C 1KX4C 4KGCC 1M18A 3LZ0B 1H3OA 4LD9B 3WA9D 5B33A 1P3OA 3AV1C 3X1UC 4G92C 1P3BD 1P3KD 3AZKD 3AFAB 3AYWC 2AROA 4J8VC 3AZGA 3KUYC 4R8PA 3LZ0D 5CPJC 5AVBC 4LD9D 4Z5TA 3O62C 3RELC 4AWLC 4KHAA 3AFAD 3TU4B 5BT1D 5JRGC 3KSYA 1F66C 3AZIB 5AV8C 2YFWB 3VH6W 2IO5B 3AZHC 4XZQA 4M6BA 4KUDC 1AOIA 3W97B 4QLCB 3UTAB 3TU4D 1M18D 4WV4B 2NQBB 3LELB 3AZID 4HGAC 4JJNC 5BNXA 5B1LA 4WNNA 4G91B 1HTAA 2CV5C 3X1VB 5AY8B 3AZGD 3W97D 4QLCD 3AZLC 1P3FA 4J8WB 3B0CW 3AZMC 2NQBD 4Z5TD 3AV2C 3C1BC 1P3MB 4XUJC 5AVCA 5B24B 5B2JB 5AV5C 1ID3B 3X1VD 5AY8D 1P3AA 3MGPB 3REHB 4ZBJC 4J8WD 2HIOC 5GT0C 1P3PA 1ZLAB 2YFVA 4WZSB 1P3MD 5CP6B 3KWQA 5B24D 1N1JB 5B2JD 2FJ7B 3LJAB 4CAYB 4Z66A 3REJB 1TAFA 5CPIA 1WWIA 1KX4A 2NZDA 2F8NA 3KXBB 5DNNC 4H9NA 5GT3B 3VH5A 3X1UA 3AZFB 1ZLAD 3MGSA 4NFTA 3REIC 5CP6D 3MGRA 3AFAC 2FJ7D 3LJAD 3REJD 3X1TB 5B32B 5AVBA 1M1AB 3KXBD 5BNVA 3O62A 5GT3D 5B1MC 3AZFD 4YS3B 5B2IB 5B40B 3W96A 5JRGA 2HUEC 1P3LB 1F66A 1M19B 3X1TD 1P34C 5B32D 5AV8A 3C1CB 1P3GB 3AZNB 3AZJB 1M1AD 3AZHA 5B0YC 3WAAA 2IO5C 4YS3D 3UTAC 5B2ID 4X23C 2NZDD 4CSRB 4WU9A 1HQ3A 1P3LD 3LELC 1M19D 1U35B 4J8XB 1P3GD 3AZND 3AZJD 2CV5A 4G91C 4H9SC 1BH9A 3MNNA 5B31A 3VH6A 5AY8C 3REKB 3X1SA 3AZMA 1KX3B 5C3IC 1WWSA 3B6FB 1U35D 3C1BA 1S32B 4J8XD 5AV5A 4J8UB 2BYKB 1ID3C 3MGPC 3REHC 3REKD 3MGQB 3WA9B 1KX3D 3NQUB 3B6FD 5GT0A 1S32D 3UTBC 1ZLAC 5B31B 5GSUB 5CP6C 3UT9C 4WU9D 4J8UD 2FJ7C 3LJAC 5JA4B 5AV6A 3REJC 3WKJB 3MGQD 1KX5C 5DNNA 3LZ1C 3AZFC 3REIA 5B31D 5GSUD 4H9RB 3X1SD 4ZUXB 3NQJA 3WKJD 3X1TC 3W98A 4WU8A 4UUZA 3MVDB 1EQZC 3A6NA 4YS3C 1M18B 5B2IC 3WTPC 5B40C 1H3OB 4H9QA 5B32G 5B33B 4ZUXD 1P3OB 1P34A 3C1CC 3AZJC 2AROB 4E44A 5B0YA 3AZGB 3MVDD 4R8PB 4X23A 5F99A 5DNMA 5B33D 3V9RA 4Z5TB 1P3OD 2RVQD 1P3IA 2PYOC 1U35C 4KHAB 5B0ZC 2AROD 4H9SA 5GXQC 1TZYA 4R8PD 5CPKC 3AZEA 3W98D 4XZQB 3AN2C 3B6FC 1AOIB 3A6ND 4YM6C 1BH8A 5BO0A 5KDMA 5E5AA 4Z2MG 1P3IB 5BNXB 5B1LB 3WA9C 4WNNB 4XZQD 3UTBA 1AOID 1P3BC 3B6GA 1P3KC 3AZKC 1P3FB 3UT9A 5AV9A 3W99A 4KGCA 5G49A 3LZ0C 3WKJC 1P3ID 5B1LD 3AV1A 5AVCB 1KX5A 4LD9C 5B31G 3LZ1A 1P3AB 3AYWA 2BYMA 4J8VA 1P3FD 3KUYA 5BT1C 5CPJA 1P3PB 2YFVB 5AVCD 3KWQB 3RELA 1EQZA 1P3AD 4Z66B 5CPIB 1TAFB 3MVDC 1KX4B 5CHLB 1B6WA 2NZDB 3TU4C 2F8NK 1M18C 5E5AD 5BS7C 2F8NB 4H9NB 5B33C 3X1UB 4G92B 3AZIC 3MGSB 1P3PD 3B6GD 3VH5T 3KWQD 1JFIA 3MGRB 4KUDA 2AROC 5AV9D 3AZGC 3W97C 4QLCC 4Z66D 5CPID 1KX4D 4KGCD 4R8PC 5AVBB 5FUGA 2F8ND 2NQBC 5BNVB 3O62B 4JJNA 4Z5TC 2PYOA 3X1UD 4AWLB 3MGSD 5B0ZA 4J8VD 3MGRD 3X1VC 5GXQA 3AZLA 3W96B 5JRGB 1F66B 4J8WC 5AV8B 5CPKA 4H9OA 5AVBD 3R45A 3AZHB 3AV2A 3O62D 3AN2A 3WAAB 4XZQC 1P3MC 4XUJA 1AOIC 1F1EA 5B24C 4YM6A 5B2JC 4WU9B 1HQ3B 3W96D 5JRGD 1F66D 2HIOA 5AV8D 5B1LC 2CV5B 3AZHD 1BH9B 3MNNB 3WAAD 1P3BA 1P3KA 3AZKA 3VH6T 3X1SB 4H9PA 1HQ3D 3AZMB 3LZ0A 3C1BB 4LD9A 4XUJB 5AV5B 3KXBC 5AVCC 2CV5D 5GT3C 3MNND 3AFAA 3AZMD 1Q9CA 5GT0B 5B32C 3C1BD 4XUJD 3B0CT 1M1AC 5AV5D 5B1MA 3KWQC 5AV6B 3TU4A 2NZDC 2HIOD 5BS7A 5DNNB 1P3LC 4Z2MH 1M19C 5GT0D 3AZIA 2YFWA 1P3GC 3REIB 3MGSC 3AZNC 3MGRC 3W97A 4QLCA 3UTAA 5AV6D 3NQJB 4E45A 2F8NG 1BFMA 2NQBA 3LELA 3B0DB 5DNND 3W98B 5B1MB 4WU8B 4UUZB 2JSSA 3A6NB 4J8XC 3REID 3X1VA 5AY8A 4H9QB 2HUEB 3W96C 4EO5B 4J8WA 3REKC 1P34B 1R4VA 4DRBA 1KX3C 5B0YB 5B1MD 4WU8D 1S32C 1P3MA 3WAAC 4X23B 5B24A 5B2JA 1ID3A 5F99B 5DNMB 4DRAA 4J8UC 4WU9C 1HQ3C 3MGPA 3REHA 3V9RB 1P34D 3MGQC 5B0YD 1ZLAA 3MNNC 5B31C 5GSUC 1KU5A 1TZYB 5CP6A 1N1JA 4X23D 3UTAD 5F99D 2FJ7A 5DNMD 3LJAA 4CAYA 3X1SC 5C3IB 3REJA 3AZEB 3LELD 3KXBA 5GT3A 3WTPE 3AZFA 4NE6A 1BH8B 1A7WA 5BO0B 5KDMB 1TZYD 5E5AB 4ZUXC 3AZED 3X1TA 5B32A 3UTBB 3B6GB 1M1AA 3B0BA 3UT9B 5AV9B 3W99B 1ID3D 4YS3A 4KGCB 5B2IA 3WTPA 5G49B 5B40A 3MGPD 3REHD 5AV6C 3AV1B 2LY8A 1KX5B 1P3LA 1P3OC 1M19A 2RVQC 3LZ1B 3C1CA 3UTBD 1P3GA 3AZJA 2BYMB 4NE5A 4J8VB 3AZNA 3AYWB 3UT9D 3W99D 3KUYB 5CPJB 4CSRA 3AV1D 1KX5D 1ULYA 3RELB 3W98C 3B0DC 1U35A 3LZ1D 1EQZB 4J8XA 4WU8C 3AYWD 3A6NC 3WTPB 3KUYD 2CWEA 3REKA 5CPJD 4EO5C
chains in the Genus database with same CATH superfamily
1KX3A 1JFIB 3RELD 3B6FA 4KUDB 1S32A 2F2AC 1EQZD 3WTPD 5B40D 4J8UA 2BYKA 5FUGB 5F99C 5DNMC 1B67A 4HGAB 4JJNB 2PYOB 3MGQA 3WA9A 1P3IC 5B0ZB 3C1CD 3NQUA 3H0LC 4KUDD 5GXQB 3AZLB 5GSUA 1P3FC 1TZYC 5CPKB 4H9OB 3R45B 2F8NH 5JA4A 3AZEC 3AN2B 3AV2B 3EG5B 4JJND 3WKJA 2PYOD 5B0ZD 4YM6B 5GXQD 3AZLD 1P3AC 4ZBJB 4H9RA 2HIOB 5CPKD 3VH5W 5E5AC 4ZUXA 3AV2D 3AN2D 1P3PC 1P3BB 2Y2LA 1P3KB 3AZKB 3B6GC 4YM6D 4NE3A 2L5AA 5AV9C 4H9PB 3W99C 3MVDA 5CPIC 2Y2IA 4Z66C 1KX4C 4KGCC 1M18A 3LZ0B 1H3OA 4LD9B 3WA9D 2Y2KA 5B33A 1P3OA 3AV1C 3X1UC 4G92C 1P3BD 1P3KD 3AZKD 3AFAB 3AYWC 2AROA 4J8VC 3AZGA 3KUYC 4R8PA 3LZ0D 2G5IC 5CPJC 2DQNC 5AVBC 3FDDA 4LD9D 4Z5TA 3O62C 3RELC 4AWLC 4KHAA 4UPKA 3AFAD 3TU4B 5BT1D 5JRGC 2FFFB 3KSYA 1F66C 3AZIB 5AV8C 2YFWB 3VH6W 2IO5B 3AZHC 4XZQA 4M6BA 4KUDC 1AOIA 3W97B 4QLCB 3UTAB 3TU4D 1M18D 4WV4B 2NQBB 3LELB 3AZID 4HGAC 4JJNC 5BNXA 5B1LA 4WNNA 4G91B 1HTAA 2CV5C 3X1VB 5AY8B 3AZGD 3W97D 4QLCD 3AZLC 1P3FA 4J8WB 3B0CW 3AZMC 3KFUG 2NQBD 2UWXA 4Z5TD 2Y2GA 3AV2C 3C1BC 1P3MB 4XUJC 5AVCA 5B24B 5B2JB 2ZY2A 5AV5C 1ID3B 3X1VD 5AY8D 1P3AA 3MGPB 3REHB 4ZBJC 4J8WD 2HIOC 5GT0C 1P3PA 1ZLAB 2YFVA 4WZSB 1P3MD 5CP6B 3KWQA 1N1JB 5B24D 5B2JD 2FJ7B 3A1IA 3LJAB 4CAYB 4Z66A 3REJB 1TAFA 5CPIA 1WWIA 1KX4A 2NZDA 2F8NA 3KXBB 5DNNC 4H9NA 5GT3B 3VH5A 3X1UA 3AZFB 1ZLAD 3MGSA 4NFTA 3REIC 5CP6D 3MGRA 3AFAC 2FJ7D 3F6TA 3LJAD 3REJD 3X1TB 5B32B 5AVBA 1M1AB 3KXBD 5BNVA 3O62A 5GT3D 5B1MC 3AZFD 4YS3B 2JE5A 5B2IB 5B40B 3W96A 5JRGA 2HUEC 1P3LB 1F66A 1M19B 3X1TD 1P34C 5B32D 5AV8A 3C1CB 1P3GB 3AZNB 3AZJB 1M1AD 3AZHA 5B0YC 3WAAA 2IO5C 4YS3D 3UTAC 5B2ID 4X23C 2NZDD 4CSRB 4WU9A 1HQ3A 2Y2OA 1P3LD 3LELC 1M19D 2DF4C 1U35B 4J8XB 1P3GD 3AZND 3AZJD 2CV5A 4G91C 4H9SC 1BH9A 3MNNA 5B31A 3VH6A 5AY8C 3REKB 3X1SA 3AZMA 1KX3B 5C3IC 1WWSA 3B6FB 1U35D 3C1BA 2Y2PA 1S32B 4J8XD 5AV5A 4J8UB 2BYKB 1ID3C 2ZY4A 3MGPC 3REHC 3REKD 3MGQB 3WA9B 1KX3D 3NQUB 3B6FD 5GT0A 1S32D 3UTBC 1ZLAC 5B31B 5GSUB 3A1KA 5CP6C 3UT9C 4WU9D 4J8UD 2FJ7C 3LJAC 5JA4B 5AV6A 3REJC 3WKJB 3MGQD 1KX5C 5DNNA 3LZ1C 3AZFC 2VQRA 5B31D 5GSUD 3REIA 4H9RB 3X1SD 4ZUXB 2XD1A 3NQJA 3WKJD 3X1TC 3IP4C 3W98A 4WU8A 4UUZA 3MVDB 1EQZC 3A6NA 4YS3C 1M18B 5B2IC 3WTPC 5B40C 1H3OB 4H9QA 5B32G 5B33B 4ZUXD 1P3OB 1P34A 3C1CC 1PZRA 3AZJC 2AROB 4E44A 5B0YA 3AZGB 3AL0C 2XD5A 3MVDD 4R8PB 4X23A 2Y2NA 5F99A 5DNMA 5B33D 3V9RA 4Z5TB 1P3OD 2RVQD 1P3IA 2PYOC 1U35C 4KHAB 5B0ZC 2AROD 4H9SA 3EPKA 5GXQC 1TZYA 4R8PD 5CPKC 3AZEA 3W98D 4XZQB 3AN2C 3B6FC 1AOIB 3H0MC 3A6ND 4YM6C 1BH8A 5BO0A 5KDMA 5E5AA 4Z2MG 1P3IB 5BNXB 5B1LB 3WA9C 4WNNB 2Y2HA 4XZQD 3UTBA 1AOID 1P3BC 2ZY5A 1P3KC 3B6GA 3AZKC 1P3FB 3UT9A 5AV9A 3W99A 4KGCA 5G49A 3LZ0C 3WKJC 1P3ID 5B1LD 3AV1A 5AVCB 1KX5A 4LD9C 5B31G 3LZ1A 1P3AB 3AYWA 2BYMA 4J8VA 1P3FD 3KUYA 5BT1C 5CPJA 1P3PB 2YFVB 5AVCD 3KWQB 3RELA 1EQZA 1P3AD 4Z66B 5CPIB 1TAFB 3MVDC 1KX4B 5CHLB 1B6WA 2NZDB 3TU4C 2F8NK 1M18C 5E5AD 5BS7C 2F8NB 4H9NB 5B33C 3X1UB 4G92B 3AZIC 3MGSB 1P3PD 3B6GD 3VH5T 3KWQD 1JFIA 3MGRB 4KUDA 2AROC 5AV9D 3AZGC 3W97C 4QLCC 4Z66D 5CPID 1KX4D 4KGCD 4R8PC 5AVBB 5FUGA 2Y2MA 2F8ND 2NQBC 5BNVB 3O62B 4JJNA 4Z5TC 2PYOA 3X1UD 4AWLB 3MGSD 5B0ZA 4J8VD 3MGRD 3X1VC 5GXQA 3AZLA 3W96B 5JRGB 1F66B 4J8WC 2RIQA 5AV8B 4H9OA 5CPKA 5AVBD 3R45A 3AZHB 3AV2A 3O62D 3AN2A 3WAAB 4XZQC 1P3MC 4XUJA 1AOIC 1F1EA 5B24C 4YM6A 5B2JC 4WU9B 1HQ3B 3W96D 5JRGD 2G5HC 1F66D 2HIOA 5AV8D 5B1LC 2CV5B 3AZHD 1BH9B 3MNNB 3WAAD 1P3BA 1P3KA 3AZKA 3VH6T 3X1SB 2BG1A 4H9PA 1HQ3D 3AZMB 3LZ0A 3C1BB 4LD9A 4XUJB 5AV5B 3KXBC 5AVCC 2CV5D 5GT3C 3MNND 3AFAA 2J8PA 2JCHA 1Z2CB 3AZMD 1Q9CA 4WJ3C 5GT0B 5B32C 3C1BD 4XUJD 3B0CT 1M1AC 5AV5D 5B1MA 3KWQC 5AV6B 3TU4A 2NZDC 2HIOD 5BS7A 5DNNB 1P3LC 4Z2MH 1M19C 5GT0D 3AZIA 2YFWA 1P3GC 3REIB 3MGSC 3AZNC 3EPHA 3H0RC 3MGRC 3W97A 4QLCA 2W8SA 3UTAA 5AV6D 3NQJB 4E45A 2F8NG 1BFMA 2NQBA 3LELA 3B0DB 5DNND 3W98B 5B1MB 4WU8B 4UUZB 2JSSA 3A6NB 4J8XC 3REID 3X1VA 5AY8A 4H9QB 2HUEB 3W96C 4EO5B 4J8WA 3REKC 1P34B 1R4VA 4DRBA 1KX3C 5B0YB 5B1MD 4WU8D 1S32C 1P3MA 3WAAC 4X23B 5B24A 5B2JA 1ID3A 5F99B 5DNMB 4DRAA 4J8UC 4WU9C 1HQ3C 3MGPA 3REHA 3V9RB 1P34D 3MGQC 5B0YD 1ZLAA 3MNNC 5B31C 5CP6A 5GSUC 1KU5A 1TZYB 1W2EA 1N1JA 1T3UA 4X23D 4DQYB 3UTAD 3P5JB 5F99D 2FJ7A 5DNMD 3LJAA 4CAYA 3X1SC 5C3IB 3REJA 3AZEB 3LELD 2Y2QA 3EPLA 3KXBA 5GT3A 3WTPE 3AZFA 4NE6A 1BH8B 1A7WA 5BO0B 5KDMB 1TZYD 5E5AB 4ZUXC 3AZED 3X1TA 5B32A 3UTBB 3B6GB 1M1AA 3B0BA 3UT9B 5AV9B 3W99B 1ID3D 4YS3A 4KGCB 5B2IA 3WTPA 5G49B 5B40A 3MGPD 3REHD 5AV6C 3AV1B 2LY8A 1KX5B 1P3LA 1P3OC 1M19A 2RVQC 3LZ1B 3C1CA 3UTBD 1P3GA 3AZJA 2BYMB 4NE5A 4J8VB 3AZNA 3AYWB 3UT9D 3W99D 3KUYB 2ZM5A 3EPJA 5CPJB 4CSRA 2Y2JA 3AV1D 1KX5D 1ULYA 3RELB 3W98C 3B0DC 1U35A 3LZ1D 1EQZB 4J8XA 4WU8C 3AYWD 3A6NC 3WTPB 2ZY3A 3KUYD 2CWEA 3REKA 5CPJD 4EO5C
chains in the Genus database with same CATH topology
1KX3A 1JFIB 3RELD 3B6FA 4KUDB 1S32A 2F2AC 1EQZD 3WTPD 5B40D 4J8UA 2BYKA 5FUGB 5F99C 5DNMC 1B67A 4HGAB 4JJNB 2PYOB 3MGQA 3WA9A 1P3IC 5B0ZB 3C1CD 3NQUA 3H0LC 4KUDD 5GXQB 3AZLB 5GSUA 1P3FC 1TZYC 5CPKB 4H9OB 3R45B 2F8NH 5JA4A 3AZEC 3AN2B 3AV2B 3EG5B 4JJND 3WKJA 2PYOD 5B0ZD 4YM6B 5GXQD 3AZLD 1P3AC 4ZBJB 4H9RA 2HIOB 5CPKD 3VH5W 5E5AC 4ZUXA 3AV2D 3AN2D 1P3PC 1P3BB 2Y2LA 1P3KB 3AZKB 3B6GC 4YM6D 4NE3A 2L5AA 5AV9C 4H9PB 3W99C 3MVDA 5CPIC 2Y2IA 4Z66C 1KX4C 4KGCC 1M18A 3LZ0B 1H3OA 4LD9B 3WA9D 2Y2KA 5B33A 1P3OA 3AV1C 3X1UC 4G92C 1P3BD 1P3KD 3AZKD 3AFAB 3AYWC 2AROA 4J8VC 3AZGA 3KUYC 4R8PA 3LZ0D 2G5IC 5CPJC 2DQNC 5AVBC 3FDDA 4LD9D 4Z5TA 3O62C 3RELC 4AWLC 4KHAA 4UPKA 3AFAD 3TU4B 5BT1D 5JRGC 2FFFB 3KSYA 1F66C 3AZIB 5AV8C 2YFWB 3VH6W 2IO5B 3AZHC 4XZQA 4M6BA 4KUDC 1AOIA 3W97B 4QLCB 3UTAB 3TU4D 1M18D 4WV4B 2NQBB 3LELB 3AZID 4HGAC 4JJNC 5BNXA 5B1LA 4WNNA 4G91B 1HTAA 2CV5C 3X1VB 5AY8B 3AZGD 3W97D 4QLCD 3AZLC 1P3FA 4J8WB 3B0CW 3AZMC 3KFUG 2NQBD 2UWXA 4Z5TD 2Y2GA 3AV2C 3C1BC 1P3MB 4XUJC 5AVCA 5B24B 5B2JB 2ZY2A 5AV5C 1ID3B 3X1VD 5AY8D 1P3AA 3MGPB 3REHB 4ZBJC 4J8WD 2HIOC 5GT0C 1P3PA 1ZLAB 2YFVA 4WZSB 1P3MD 5CP6B 3KWQA 1N1JB 5B24D 5B2JD 2FJ7B 3A1IA 3LJAB 4CAYB 4Z66A 3REJB 1TAFA 5CPIA 1WWIA 1KX4A 2NZDA 2F8NA 3KXBB 5DNNC 4H9NA 5GT3B 3VH5A 3X1UA 3AZFB 1ZLAD 3MGSA 4NFTA 3REIC 5CP6D 3MGRA 3AFAC 2FJ7D 3F6TA 3LJAD 3REJD 3X1TB 5B32B 5AVBA 1M1AB 3KXBD 5BNVA 3O62A 5GT3D 5B1MC 3AZFD 4YS3B 2JE5A 5B2IB 5B40B 3W96A 5JRGA 2HUEC 1P3LB 1F66A 1M19B 3X1TD 1P34C 5B32D 5AV8A 3C1CB 1P3GB 3AZNB 3AZJB 1M1AD 3AZHA 5B0YC 3WAAA 2IO5C 4YS3D 3UTAC 5B2ID 4X23C 2NZDD 4CSRB 4WU9A 1HQ3A 2Y2OA 1P3LD 3LELC 1M19D 2DF4C 1U35B 4J8XB 1P3GD 3AZND 3AZJD 2CV5A 4G91C 4H9SC 1BH9A 3MNNA 5B31A 3VH6A 5AY8C 3REKB 3X1SA 3AZMA 1KX3B 5C3IC 1WWSA 3B6FB 1U35D 3C1BA 2Y2PA 1S32B 4J8XD 5AV5A 4J8UB 2BYKB 1ID3C 2ZY4A 3MGPC 3REHC 3REKD 3MGQB 3WA9B 1KX3D 3NQUB 3B6FD 5GT0A 1S32D 3UTBC 1ZLAC 5B31B 5GSUB 3A1KA 5CP6C 3UT9C 4WU9D 4J8UD 2FJ7C 3LJAC 5JA4B 5AV6A 3REJC 3WKJB 3MGQD 1KX5C 5DNNA 3LZ1C 3AZFC 2VQRA 5B31D 5GSUD 3REIA 4H9RB 3X1SD 4ZUXB 2XD1A 3NQJA 3WKJD 3X1TC 3IP4C 3W98A 4WU8A 4UUZA 3MVDB 1EQZC 3A6NA 4YS3C 1M18B 5B2IC 3WTPC 5B40C 1H3OB 4H9QA 5B32G 5B33B 4ZUXD 1P3OB 1P34A 3C1CC 1PZRA 3AZJC 2AROB 4E44A 5B0YA 3AZGB 3AL0C 2XD5A 3MVDD 4R8PB 4X23A 2Y2NA 5F99A 5DNMA 5B33D 3V9RA 4Z5TB 1P3OD 2RVQD 1P3IA 2PYOC 1U35C 4KHAB 5B0ZC 2AROD 4H9SA 3EPKA 5GXQC 1TZYA 4R8PD 5CPKC 3AZEA 3W98D 4XZQB 3AN2C 3B6FC 1AOIB 3H0MC 3A6ND 4YM6C 1BH8A 5BO0A 5KDMA 5E5AA 4Z2MG 1P3IB 5BNXB 5B1LB 3WA9C 4WNNB 2Y2HA 4XZQD 3UTBA 1AOID 1P3BC 2ZY5A 1P3KC 3B6GA 3AZKC 1P3FB 3UT9A 5AV9A 3W99A 4KGCA 5G49A 3LZ0C 3WKJC 1P3ID 5B1LD 3AV1A 5AVCB 1KX5A 4LD9C 5B31G 3LZ1A 1P3AB 3AYWA 2BYMA 4J8VA 1P3FD 3KUYA 5BT1C 5CPJA 1P3PB 2YFVB 5AVCD 3KWQB 3RELA 1EQZA 1P3AD 4Z66B 5CPIB 1TAFB 3MVDC 1KX4B 5CHLB 1B6WA 2NZDB 3TU4C 2F8NK 1M18C 5E5AD 5BS7C 2F8NB 4H9NB 5B33C 3X1UB 4G92B 3AZIC 3MGSB 1P3PD 3B6GD 3VH5T 3KWQD 1JFIA 3MGRB 4KUDA 2AROC 5AV9D 3AZGC 3W97C 4QLCC 4Z66D 5CPID 1KX4D 4KGCD 4R8PC 5AVBB 5FUGA 2Y2MA 2F8ND 2NQBC 5BNVB 3O62B 4JJNA 4Z5TC 2PYOA 3X1UD 4AWLB 3MGSD 5B0ZA 4J8VD 3MGRD 3X1VC 5GXQA 3AZLA 3W96B 5JRGB 1F66B 4J8WC 2RIQA 5AV8B 4H9OA 5CPKA 5AVBD 3R45A 3AZHB 3AV2A 3O62D 3AN2A 3WAAB 4XZQC 1P3MC 4XUJA 1AOIC 1F1EA 5B24C 4YM6A 5B2JC 4WU9B 1HQ3B 3W96D 5JRGD 2G5HC 1F66D 2HIOA 5AV8D 5B1LC 2CV5B 3AZHD 1BH9B 3MNNB 3WAAD 1P3BA 1P3KA 3AZKA 3VH6T 3X1SB 2BG1A 4H9PA 1HQ3D 3AZMB 3LZ0A 3C1BB 4LD9A 4XUJB 5AV5B 3KXBC 5AVCC 2CV5D 5GT3C 3MNND 3AFAA 2J8PA 2JCHA 1Z2CB 3AZMD 1Q9CA 4WJ3C 5GT0B 5B32C 3C1BD 4XUJD 3B0CT 1M1AC 5AV5D 5B1MA 3KWQC 5AV6B 3TU4A 2NZDC 2HIOD 5BS7A 5DNNB 1P3LC 4Z2MH 1M19C 5GT0D 3AZIA 2YFWA 1P3GC 3REIB 3MGSC 3AZNC 3EPHA 3H0RC 3MGRC 3W97A 4QLCA 2W8SA 3UTAA 5AV6D 3NQJB 4E45A 2F8NG 1BFMA 2NQBA 3LELA 3B0DB 5DNND 3W98B 5B1MB 4WU8B 4UUZB 2JSSA 3A6NB 4J8XC 3REID 3X1VA 5AY8A 4H9QB 2HUEB 3W96C 4EO5B 4J8WA 3REKC 1P34B 1R4VA 4DRBA 1KX3C 5B0YB 5B1MD 4WU8D 1S32C 1P3MA 3WAAC 4X23B 5B24A 5B2JA 1ID3A 5F99B 5DNMB 4DRAA 4J8UC 4WU9C 1HQ3C 3MGPA 3REHA 3V9RB 1P34D 3MGQC 5B0YD 1ZLAA 3MNNC 5B31C 5CP6A 5GSUC 1KU5A 1TZYB 1W2EA 1N1JA 1T3UA 4X23D 4DQYB 3UTAD 3P5JB 5F99D 2FJ7A 5DNMD 3LJAA 4CAYA 3X1SC 5C3IB 3REJA 3AZEB 3LELD 2Y2QA 3EPLA 3KXBA 5GT3A 3WTPE 3AZFA 4NE6A 1BH8B 1A7WA 5BO0B 5KDMB 1TZYD 5E5AB 4ZUXC 3AZED 3X1TA 5B32A 3UTBB 3B6GB 1M1AA 3B0BA 3UT9B 5AV9B 3W99B 1ID3D 4YS3A 4KGCB 5B2IA 3WTPA 5G49B 5B40A 3MGPD 3REHD 5AV6C 3AV1B 2LY8A 1KX5B 1P3LA 1P3OC 1M19A 2RVQC 3LZ1B 3C1CA 3UTBD 1P3GA 3AZJA 2BYMB 4NE5A 4J8VB 3AZNA 3AYWB 3UT9D 3W99D 3KUYB 2ZM5A 3EPJA 5CPJB 4CSRA 2Y2JA 3AV1D 1KX5D 1ULYA 3RELB 3W98C 3B0DC 1U35A 3LZ1D 1EQZB 4J8XA 4WU8C 3AYWD 3A6NC 3WTPB 2ZY3A 3KUYD 2CWEA 3REKA 5CPJD 4EO5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KX3 A;  1JFI B;  3REL D;  3B6F A;  4KUD B;  1S32 A;  1EQZ D;  3WTP D;  5B40 D;  4J8U A;  2BYK A;  5FUG B;  5F99 C;  5DNM C;  1B67 A;  4HGA B;  4JJN B;  2PYO B;  3MGQ A;  3WA9 A;  1P3I C;  5B0Z B;  3C1C D;  3NQU A;  4KUD D;  5GXQ B;  3AZL B;  5GSU A;  1P3F C;  1TZY C;  5CPK B;  4H9O B;  3R45 B;  2F8N H;  5JA4 A;  3AZE C;  3AN2 B;  3AV2 B;  3WKJ A;  4JJN D;  2PYO D;  5B0Z D;  4YM6 B;  5GXQ D;  3AZL D;  1P3A C;  4ZBJ B;  4H9R A;  2HIO B;  5CPK D;  3VH5 W;  5E5A C;  4ZUX A;  3AV2 D;  3AN2 D;  1P3P C;  1P3B B;  1P3K B;  3AZK B;  3B6G C;  4YM6 D;  4NE3 A;  2L5A A;  5AV9 C;  4H9P B;  3W99 C;  3MVD A;  5CPI C;  4Z66 C;  1KX4 C;  4KGC C;  1M18 A;  3LZ0 B;  1H3O A;  4LD9 B;  3WA9 D;  5B33 A;  1P3O A;  3AV1 C;  3X1U C;  4G92 C;  1P3B D;  1P3K D;  3AZK D;  3AFA B;  3AYW C;  2ARO A;  4J8V C;  3AZG A;  3KUY C;  4R8P A;  3LZ0 D;  5CPJ C;  5AVB C;  4LD9 D;  4Z5T A;  3O62 C;  3REL C;  4AWL C;  4KHA A;  3AFA D;  3TU4 B;  5BT1 D;  5JRG C;  3KSY A;  1F66 C;  3AZI B;  5AV8 C;  2YFW B;  3VH6 W;  2IO5 B;  3AZH C;  4XZQ A;  4M6B A;  4KUD C;  1AOI A;  3W97 B;  4QLC B;  3UTA B;  3TU4 D;  1M18 D;  4WV4 B;  2NQB B;  3LEL B;  3AZI D;  4HGA C;  4JJN C;  5BNX A;  5B1L A;  4WNN A;  4G91 B;  1HTA A;  2CV5 C;  3X1V B;  5AY8 B;  3AZG D;  3W97 D;  4QLC D;  3AZL C;  1P3F A;  4J8W B;  3B0C W;  3AZM C;  2NQB D;  4Z5T D;  3AV2 C;  3C1B C;  1P3M B;  4XUJ C;  5AVC A;  5B24 B;  5B2J B;  5AV5 C;  1ID3 B;  3X1V D;  5AY8 D;  1P3A A;  3MGP B;  3REH B;  4ZBJ C;  4J8W D;  2HIO C;  5GT0 C;  1P3P A;  1ZLA B;  2YFV A;  4WZS B;  1P3M D;  5CP6 B;  3KWQ A;  5B24 D;  1N1J B;  5B2J D;  2FJ7 B;  3LJA B;  4CAY B;  4Z66 A;  3REJ B;  1TAF A;  5CPI A;  1WWI A;  1KX4 A;  2NZD A;  2F8N A;  3KXB B;  5DNN C;  4H9N A;  5GT3 B;  3VH5 A;  3X1U A;  3AZF B;  1ZLA D;  3MGS A;  4NFT A;  3REI C;  5CP6 D;  3MGR A;  3AFA C;  2FJ7 D;  3LJA D;  3REJ D;  3X1T B;  5B32 B;  5AVB A;  1M1A B;  3KXB D;  5BNV A;  3O62 A;  5GT3 D;  5B1M C;  3AZF D;  4YS3 B;  5B2I B;  5B40 B;  3W96 A;  5JRG A;  2HUE C;  1P3L B;  1F66 A;  1M19 B;  3X1T D;  1P34 C;  5B32 D;  5AV8 A;  3C1C B;  1P3G B;  3AZN B;  3AZJ B;  1M1A D;  3AZH A;  5B0Y C;  3WAA A;  2IO5 C;  4YS3 D;  3UTA C;  5B2I D;  4X23 C;  2NZD D;  4CSR B;  4WU9 A;  1HQ3 A;  1P3L D;  3LEL C;  1M19 D;  1U35 B;  4J8X B;  1P3G D;  3AZN D;  3AZJ D;  2CV5 A;  4G91 C;  4H9S C;  1BH9 A;  3MNN A;  5B31 A;  3VH6 A;  5AY8 C;  3REK B;  3X1S A;  3AZM A;  1KX3 B;  5C3I C;  1WWS A;  3B6F B;  1U35 D;  3C1B A;  1S32 B;  4J8X D;  5AV5 A;  4J8U B;  2BYK B;  1ID3 C;  3MGP C;  3REH C;  3REK D;  3MGQ B;  3WA9 B;  1KX3 D;  3NQU B;  3B6F D;  5GT0 A;  1S32 D;  3UTB C;  1ZLA C;  5B31 B;  5GSU B;  5CP6 C;  3UT9 C;  4WU9 D;  4J8U D;  2FJ7 C;  3LJA C;  5JA4 B;  5AV6 A;  3REJ C;  3WKJ B;  3MGQ D;  1KX5 C;  5DNN A;  3LZ1 C;  3AZF C;  3REI A;  5B31 D;  5GSU D;  4H9R B;  3X1S D;  4ZUX B;  3NQJ A;  3WKJ D;  3X1T C;  3W98 A;  4WU8 A;  4UUZ A;  3MVD B;  1EQZ C;  3A6N A;  4YS3 C;  1M18 B;  5B2I C;  3WTP C;  5B40 C;  1H3O B;  4H9Q A;  5B32 G;  5B33 B;  4ZUX D;  1P3O B;  1P34 A;  3C1C C;  3AZJ C;  2ARO B;  4E44 A;  5B0Y A;  3AZG B;  3MVD D;  4R8P B;  4X23 A;  5F99 A;  5DNM A;  5B33 D;  3V9R A;  4Z5T B;  1P3O D;  2RVQ D;  1P3I A;  2PYO C;  1U35 C;  4KHA B;  5B0Z C;  2ARO D;  4H9S A;  5GXQ C;  1TZY A;  4R8P D;  5CPK C;  3AZE A;  3W98 D;  4XZQ B;  3AN2 C;  3B6F C;  1AOI B;  3A6N D;  4YM6 C;  1BH8 A;  5BO0 A;  5KDM A;  5E5A A;  4Z2M G;  1P3I B;  5BNX B;  5B1L B;  3WA9 C;  4WNN B;  4XZQ D;  3UTB A;  1AOI D;  1P3B C;  3B6G A;  1P3K C;  3AZK C;  1P3F B;  3UT9 A;  5AV9 A;  3W99 A;  4KGC A;  5G49 A;  3LZ0 C;  3WKJ C;  1P3I D;  5B1L D;  3AV1 A;  5AVC B;  1KX5 A;  4LD9 C;  5B31 G;  3LZ1 A;  1P3A B;  3AYW A;  2BYM A;  4J8V A;  1P3F D;  3KUY A;  5BT1 C;  5CPJ A;  1P3P B;  2YFV B;  5AVC D;  3KWQ B;  3REL A;  1EQZ A;  1P3A D;  4Z66 B;  5CPI B;  1TAF B;  3MVD C;  1KX4 B;  5CHL B;  1B6W A;  2NZD B;  3TU4 C;  2F8N K;  1M18 C;  5E5A D;  5BS7 C;  2F8N B;  4H9N B;  5B33 C;  3X1U B;  4G92 B;  3AZI C;  3MGS B;  1P3P D;  3B6G D;  3VH5 T;  3KWQ D;  1JFI A;  3MGR B;  4KUD A;  2ARO C;  5AV9 D;  3AZG C;  3W97 C;  4QLC C;  4Z66 D;  5CPI D;  1KX4 D;  4KGC D;  4R8P C;  5AVB B;  5FUG A;  2F8N D;  2NQB C;  5BNV B;  3O62 B;  4JJN A;  4Z5T C;  2PYO A;  3X1U D;  4AWL B;  3MGS D;  5B0Z A;  4J8V D;  3MGR D;  3X1V C;  5GXQ A;  3AZL A;  3W96 B;  5JRG B;  1F66 B;  4J8W C;  5AV8 B;  5CPK A;  4H9O A;  5AVB D;  3R45 A;  3AZH B;  3AV2 A;  3O62 D;  3AN2 A;  3WAA B;  4XZQ C;  1P3M C;  4XUJ A;  1AOI C;  1F1E A;  5B24 C;  4YM6 A;  5B2J C;  4WU9 B;  1HQ3 B;  3W96 D;  5JRG D;  1F66 D;  2HIO A;  5AV8 D;  5B1L C;  2CV5 B;  3AZH D;  1BH9 B;  3MNN B;  3WAA D;  1P3B A;  1P3K A;  3AZK A;  3VH6 T;  3X1S B;  4H9P A;  1HQ3 D;  3AZM B;  3LZ0 A;  3C1B B;  4LD9 A;  4XUJ B;  5AV5 B;  3KXB C;  5AVC C;  2CV5 D;  5GT3 C;  3MNN D;  3AFA A;  3AZM D;  1Q9C A;  5GT0 B;  5B32 C;  3C1B D;  4XUJ D;  3B0C T;  1M1A C;  5AV5 D;  5B1M A;  3KWQ C;  5AV6 B;  3TU4 A;  2NZD C;  2HIO D;  5BS7 A;  5DNN B;  1P3L C;  4Z2M H;  1M19 C;  5GT0 D;  3AZI A;  2YFW A;  1P3G C;  3REI B;  3MGS C;  3AZN C;  3MGR C;  3W97 A;  4QLC A;  3UTA A;  5AV6 D;  3NQJ B;  4E45 A;  2F8N G;  1BFM A;  2NQB A;  3LEL A;  3B0D B;  5DNN D;  3W98 B;  5B1M B;  4WU8 B;  4UUZ B;  2JSS A;  3A6N B;  4J8X C;  3REI D;  3X1V A;  5AY8 A;  4H9Q B;  2HUE B;  3W96 C;  4EO5 B;  4J8W A;  3REK C;  1P34 B;  1R4V A;  4DRB A;  1KX3 C;  5B0Y B;  5B1M D;  4WU8 D;  1S32 C;  1P3M A;  3WAA C;  4X23 B;  5B24 A;  5B2J A;  1ID3 A;  5F99 B;  5DNM B;  4DRA A;  4J8U C;  4WU9 C;  1HQ3 C;  3MGP A;  3REH A;  3V9R B;  1P34 D;  3MGQ C;  5B0Y D;  1ZLA A;  3MNN C;  5B31 C;  5GSU C;  1KU5 A;  1TZY B;  5CP6 A;  1N1J A;  4X23 D;  3UTA D;  5F99 D;  2FJ7 A;  5DNM D;  3LJA A;  4CAY A;  3X1S C;  5C3I B;  3REJ A;  3AZE B;  3LEL D;  3KXB A;  5GT3 A;  3WTP E;  3AZF A;  4NE6 A;  1BH8 B;  1A7W A;  5BO0 B;  5KDM B;  1TZY D;  5E5A B;  4ZUX C;  3AZE D;  3X1T A;  5B32 A;  3UTB B;  3B6G B;  1M1A A;  3B0B A;  3UT9 B;  5AV9 B;  3W99 B;  1ID3 D;  4YS3 A;  4KGC B;  5B2I A;  3WTP A;  5G49 B;  5B40 A;  3MGP D;  3REH D;  5AV6 C;  3AV1 B;  2LY8 A;  1KX5 B;  1P3L A;  1P3O C;  1M19 A;  2RVQ C;  3LZ1 B;  3C1C A;  3UTB D;  1P3G A;  3AZJ A;  2BYM B;  4NE5 A;  4J8V B;  3AZN A;  3AYW B;  3UT9 D;  3W99 D;  3KUY B;  5CPJ B;  4CSR A;  3AV1 D;  1KX5 D;  1ULY A;  3REL B;  3W98 C;  3B0D C;  1U35 A;  3LZ1 D;  1EQZ B;  4J8X A;  4WU8 C;  3AYW D;  3A6N C;  3WTP B;  3KUY D;  2CWE A;  3REK A;  5CPJ D;  4EO5 C; 
#chains in the Genus database with same CATH topology
 1KX3 A;  1JFI B;  3REL D;  3B6F A;  4KUD B;  1S32 A;  2F2A C;  1EQZ D;  3WTP D;  5B40 D;  4J8U A;  2BYK A;  5FUG B;  5F99 C;  5DNM C;  1B67 A;  4HGA B;  4JJN B;  2PYO B;  3MGQ A;  3WA9 A;  1P3I C;  5B0Z B;  3C1C D;  3NQU A;  3H0L C;  4KUD D;  5GXQ B;  3AZL B;  5GSU A;  1P3F C;  1TZY C;  5CPK B;  4H9O B;  3R45 B;  2F8N H;  5JA4 A;  3AZE C;  3AN2 B;  3AV2 B;  3EG5 B;  4JJN D;  3WKJ A;  2PYO D;  5B0Z D;  4YM6 B;  5GXQ D;  3AZL D;  1P3A C;  4ZBJ B;  4H9R A;  2HIO B;  5CPK D;  3VH5 W;  5E5A C;  4ZUX A;  3AV2 D;  3AN2 D;  1P3P C;  1P3B B;  2Y2L A;  1P3K B;  3AZK B;  3B6G C;  4YM6 D;  4NE3 A;  2L5A A;  5AV9 C;  4H9P B;  3W99 C;  3MVD A;  5CPI C;  2Y2I A;  4Z66 C;  1KX4 C;  4KGC C;  1M18 A;  3LZ0 B;  1H3O A;  4LD9 B;  3WA9 D;  2Y2K A;  5B33 A;  1P3O A;  3AV1 C;  3X1U C;  4G92 C;  1P3B D;  1P3K D;  3AZK D;  3AFA B;  3AYW C;  2ARO A;  4J8V C;  3AZG A;  3KUY C;  4R8P A;  3LZ0 D;  2G5I C;  5CPJ C;  2DQN C;  5AVB C;  3FDD A;  4LD9 D;  4Z5T A;  3O62 C;  3REL C;  4AWL C;  4KHA A;  4UPK A;  3AFA D;  3TU4 B;  5BT1 D;  5JRG C;  2FFF B;  3KSY A;  1F66 C;  3AZI B;  5AV8 C;  2YFW B;  3VH6 W;  2IO5 B;  3AZH C;  4XZQ A;  4M6B A;  4KUD C;  1AOI A;  3W97 B;  4QLC B;  3UTA B;  3TU4 D;  1M18 D;  4WV4 B;  2NQB B;  3LEL B;  3AZI D;  4HGA C;  4JJN C;  5BNX A;  5B1L A;  4WNN A;  4G91 B;  1HTA A;  2CV5 C;  3X1V B;  5AY8 B;  3AZG D;  3W97 D;  4QLC D;  3AZL C;  1P3F A;  4J8W B;  3B0C W;  3AZM C;  3KFU G;  2NQB D;  2UWX A;  4Z5T D;  2Y2G A;  3AV2 C;  3C1B C;  1P3M B;  4XUJ C;  5AVC A;  5B24 B;  5B2J B;  2ZY2 A;  5AV5 C;  1ID3 B;  3X1V D;  5AY8 D;  1P3A A;  3MGP B;  3REH B;  4ZBJ C;  4J8W D;  2HIO C;  5GT0 C;  1P3P A;  1ZLA B;  2YFV A;  4WZS B;  1P3M D;  5CP6 B;  3KWQ A;  1N1J B;  5B24 D;  5B2J D;  2FJ7 B;  3A1I A;  3LJA B;  4CAY B;  4Z66 A;  3REJ B;  1TAF A;  5CPI A;  1WWI A;  1KX4 A;  2NZD A;  2F8N A;  3KXB B;  5DNN C;  4H9N A;  5GT3 B;  3VH5 A;  3X1U A;  3AZF B;  1ZLA D;  3MGS A;  4NFT A;  3REI C;  5CP6 D;  3MGR A;  3AFA C;  2FJ7 D;  3F6T A;  3LJA D;  3REJ D;  3X1T B;  5B32 B;  5AVB A;  1M1A B;  3KXB D;  5BNV A;  3O62 A;  5GT3 D;  5B1M C;  3AZF D;  4YS3 B;  2JE5 A;  5B2I B;  5B40 B;  3W96 A;  5JRG A;  2HUE C;  1P3L B;  1F66 A;  1M19 B;  3X1T D;  1P34 C;  5B32 D;  5AV8 A;  3C1C B;  1P3G B;  3AZN B;  3AZJ B;  1M1A D;  3AZH A;  5B0Y C;  3WAA A;  2IO5 C;  4YS3 D;  3UTA C;  5B2I D;  4X23 C;  2NZD D;  4CSR B;  4WU9 A;  1HQ3 A;  2Y2O A;  1P3L D;  3LEL C;  1M19 D;  2DF4 C;  1U35 B;  4J8X B;  1P3G D;  3AZN D;  3AZJ D;  2CV5 A;  4G91 C;  4H9S C;  1BH9 A;  3MNN A;  5B31 A;  3VH6 A;  5AY8 C;  3REK B;  3X1S A;  3AZM A;  1KX3 B;  5C3I C;  1WWS A;  3B6F B;  1U35 D;  3C1B A;  2Y2P A;  1S32 B;  4J8X D;  5AV5 A;  4J8U B;  2BYK B;  1ID3 C;  2ZY4 A;  3MGP C;  3REH C;  3REK D;  3MGQ B;  3WA9 B;  1KX3 D;  3NQU B;  3B6F D;  5GT0 A;  1S32 D;  3UTB C;  1ZLA C;  5B31 B;  5GSU B;  3A1K A;  5CP6 C;  3UT9 C;  4WU9 D;  4J8U D;  2FJ7 C;  3LJA C;  5JA4 B;  5AV6 A;  3REJ C;  3WKJ B;  3MGQ D;  1KX5 C;  5DNN A;  3LZ1 C;  3AZF C;  2VQR A;  5B31 D;  5GSU D;  3REI A;  4H9R B;  3X1S D;  4ZUX B;  2XD1 A;  3NQJ A;  3WKJ D;  3X1T C;  3IP4 C;  3W98 A;  4WU8 A;  4UUZ A;  3MVD B;  1EQZ C;  3A6N A;  4YS3 C;  1M18 B;  5B2I C;  3WTP C;  5B40 C;  1H3O B;  4H9Q A;  5B32 G;  5B33 B;  4ZUX D;  1P3O B;  1P34 A;  3C1C C;  1PZR A;  3AZJ C;  2ARO B;  4E44 A;  5B0Y A;  3AZG B;  3AL0 C;  2XD5 A;  3MVD D;  4R8P B;  4X23 A;  2Y2N A;  5F99 A;  5DNM A;  5B33 D;  3V9R A;  4Z5T B;  1P3O D;  2RVQ D;  1P3I A;  2PYO C;  1U35 C;  4KHA B;  5B0Z C;  2ARO D;  4H9S A;  3EPK A;  5GXQ C;  1TZY A;  4R8P D;  5CPK C;  3AZE A;  3W98 D;  4XZQ B;  3AN2 C;  3B6F C;  1AOI B;  3H0M C;  3A6N D;  4YM6 C;  1BH8 A;  5BO0 A;  5KDM A;  5E5A A;  4Z2M G;  1P3I B;  5BNX B;  5B1L B;  3WA9 C;  4WNN B;  2Y2H A;  4XZQ D;  3UTB A;  1AOI D;  1P3B C;  2ZY5 A;  1P3K C;  3B6G A;  3AZK C;  1P3F B;  3UT9 A;  5AV9 A;  3W99 A;  4KGC A;  5G49 A;  3LZ0 C;  3WKJ C;  1P3I D;  5B1L D;  3AV1 A;  5AVC B;  1KX5 A;  4LD9 C;  5B31 G;  3LZ1 A;  1P3A B;  3AYW A;  2BYM A;  4J8V A;  1P3F D;  3KUY A;  5BT1 C;  5CPJ A;  1P3P B;  2YFV B;  5AVC D;  3KWQ B;  3REL A;  1EQZ A;  1P3A D;  4Z66 B;  5CPI B;  1TAF B;  3MVD C;  1KX4 B;  5CHL B;  1B6W A;  2NZD B;  3TU4 C;  2F8N K;  1M18 C;  5E5A D;  5BS7 C;  2F8N B;  4H9N B;  5B33 C;  3X1U B;  4G92 B;  3AZI C;  3MGS B;  1P3P D;  3B6G D;  3VH5 T;  3KWQ D;  1JFI A;  3MGR B;  4KUD A;  2ARO C;  5AV9 D;  3AZG C;  3W97 C;  4QLC C;  4Z66 D;  5CPI D;  1KX4 D;  4KGC D;  4R8P C;  5AVB B;  5FUG A;  2Y2M A;  2F8N D;  2NQB C;  5BNV B;  3O62 B;  4JJN A;  4Z5T C;  2PYO A;  3X1U D;  4AWL B;  3MGS D;  5B0Z A;  4J8V D;  3MGR D;  3X1V C;  5GXQ A;  3AZL A;  3W96 B;  5JRG B;  1F66 B;  4J8W C;  2RIQ A;  5AV8 B;  4H9O A;  5CPK A;  5AVB D;  3R45 A;  3AZH B;  3AV2 A;  3O62 D;  3AN2 A;  3WAA B;  4XZQ C;  1P3M C;  4XUJ A;  1AOI C;  1F1E A;  5B24 C;  4YM6 A;  5B2J C;  4WU9 B;  1HQ3 B;  3W96 D;  5JRG D;  2G5H C;  1F66 D;  2HIO A;  5AV8 D;  5B1L C;  2CV5 B;  3AZH D;  1BH9 B;  3MNN B;  3WAA D;  1P3B A;  1P3K A;  3AZK A;  3VH6 T;  3X1S B;  2BG1 A;  4H9P A;  1HQ3 D;  3AZM B;  3LZ0 A;  3C1B B;  4LD9 A;  4XUJ B;  5AV5 B;  3KXB C;  5AVC C;  2CV5 D;  5GT3 C;  3MNN D;  3AFA A;  2J8P A;  2JCH A;  1Z2C B;  3AZM D;  1Q9C A;  4WJ3 C;  5GT0 B;  5B32 C;  3C1B D;  4XUJ D;  3B0C T;  1M1A C;  5AV5 D;  5B1M A;  3KWQ C;  5AV6 B;  3TU4 A;  2NZD C;  2HIO D;  5BS7 A;  5DNN B;  1P3L C;  4Z2M H;  1M19 C;  5GT0 D;  3AZI A;  2YFW A;  1P3G C;  3REI B;  3MGS C;  3AZN C;  3EPH A;  3H0R C;  3MGR C;  3W97 A;  4QLC A;  2W8S A;  3UTA A;  5AV6 D;  3NQJ B;  4E45 A;  2F8N G;  1BFM A;  2NQB A;  3LEL A;  3B0D B;  5DNN D;  3W98 B;  5B1M B;  4WU8 B;  4UUZ B;  2JSS A;  3A6N B;  4J8X C;  3REI D;  3X1V A;  5AY8 A;  4H9Q B;  2HUE B;  3W96 C;  4EO5 B;  4J8W A;  3REK C;  1P34 B;  1R4V A;  4DRB A;  1KX3 C;  5B0Y B;  5B1M D;  4WU8 D;  1S32 C;  1P3M A;  3WAA C;  4X23 B;  5B24 A;  5B2J A;  1ID3 A;  5F99 B;  5DNM B;  4DRA A;  4J8U C;  4WU9 C;  1HQ3 C;  3MGP A;  3REH A;  3V9R B;  1P34 D;  3MGQ C;  5B0Y D;  1ZLA A;  3MNN C;  5B31 C;  5CP6 A;  5GSU C;  1KU5 A;  1TZY B;  1W2E A;  1N1J A;  1T3U A;  4X23 D;  4DQY B;  3UTA D;  3P5J B;  5F99 D;  2FJ7 A;  5DNM D;  3LJA A;  4CAY A;  3X1S C;  5C3I B;  3REJ A;  3AZE B;  3LEL D;  2Y2Q A;  3EPL A;  3KXB A;  5GT3 A;  3WTP E;  3AZF A;  4NE6 A;  1BH8 B;  1A7W A;  5BO0 B;  5KDM B;  1TZY D;  5E5A B;  4ZUX C;  3AZE D;  3X1T A;  5B32 A;  3UTB B;  3B6G B;  1M1A A;  3B0B A;  3UT9 B;  5AV9 B;  3W99 B;  1ID3 D;  4YS3 A;  4KGC B;  5B2I A;  3WTP A;  5G49 B;  5B40 A;  3MGP D;  3REH D;  5AV6 C;  3AV1 B;  2LY8 A;  1KX5 B;  1P3L A;  1P3O C;  1M19 A;  2RVQ C;  3LZ1 B;  3C1C A;  3UTB D;  1P3G A;  3AZJ A;  2BYM B;  4NE5 A;  4J8V B;  3AZN A;  3AYW B;  3UT9 D;  3W99 D;  3KUY B;  2ZM5 A;  3EPJ A;  5CPJ B;  4CSR A;  2Y2J A;  3AV1 D;  1KX5 D;  1ULY A;  3REL B;  3W98 C;  3B0D C;  1U35 A;  3LZ1 D;  1EQZ B;  4J8X A;  4WU8 C;  3AYW D;  3A6N C;  3WTP B;  2ZY3 A;  3KUY D;  2CWE A;  3REK A;  5CPJ D;  4EO5 C; 
#chains in the Genus database with same CATH homology
 1KX3 A;  1JFI B;  3REL D;  3B6F A;  4KUD B;  1S32 A;  2F2A C;  1EQZ D;  3WTP D;  5B40 D;  4J8U A;  2BYK A;  5FUG B;  5F99 C;  5DNM C;  1B67 A;  4HGA B;  4JJN B;  2PYO B;  3MGQ A;  3WA9 A;  1P3I C;  5B0Z B;  3C1C D;  3NQU A;  3H0L C;  4KUD D;  5GXQ B;  3AZL B;  5GSU A;  1P3F C;  1TZY C;  5CPK B;  4H9O B;  3R45 B;  2F8N H;  5JA4 A;  3AZE C;  3AN2 B;  3AV2 B;  3EG5 B;  4JJN D;  3WKJ A;  2PYO D;  5B0Z D;  4YM6 B;  5GXQ D;  3AZL D;  1P3A C;  4ZBJ B;  4H9R A;  2HIO B;  5CPK D;  3VH5 W;  5E5A C;  4ZUX A;  3AV2 D;  3AN2 D;  1P3P C;  1P3B B;  2Y2L A;  1P3K B;  3AZK B;  3B6G C;  4YM6 D;  4NE3 A;  2L5A A;  5AV9 C;  4H9P B;  3W99 C;  3MVD A;  5CPI C;  2Y2I A;  4Z66 C;  1KX4 C;  4KGC C;  1M18 A;  3LZ0 B;  1H3O A;  4LD9 B;  3WA9 D;  2Y2K A;  5B33 A;  1P3O A;  3AV1 C;  3X1U C;  4G92 C;  1P3B D;  1P3K D;  3AZK D;  3AFA B;  3AYW C;  2ARO A;  4J8V C;  3AZG A;  3KUY C;  4R8P A;  3LZ0 D;  2G5I C;  5CPJ C;  2DQN C;  5AVB C;  3FDD A;  4LD9 D;  4Z5T A;  3O62 C;  3REL C;  4AWL C;  4KHA A;  4UPK A;  3AFA D;  3TU4 B;  5BT1 D;  5JRG C;  2FFF B;  3KSY A;  1F66 C;  3AZI B;  5AV8 C;  2YFW B;  3VH6 W;  2IO5 B;  3AZH C;  4XZQ A;  4M6B A;  4KUD C;  1AOI A;  3W97 B;  4QLC B;  3UTA B;  3TU4 D;  1M18 D;  4WV4 B;  2NQB B;  3LEL B;  3AZI D;  4HGA C;  4JJN C;  5BNX A;  5B1L A;  4WNN A;  4G91 B;  1HTA A;  2CV5 C;  3X1V B;  5AY8 B;  3AZG D;  3W97 D;  4QLC D;  3AZL C;  1P3F A;  4J8W B;  3B0C W;  3AZM C;  3KFU G;  2NQB D;  2UWX A;  4Z5T D;  2Y2G A;  3AV2 C;  3C1B C;  1P3M B;  4XUJ C;  5AVC A;  5B24 B;  5B2J B;  2ZY2 A;  5AV5 C;  1ID3 B;  3X1V D;  5AY8 D;  1P3A A;  3MGP B;  3REH B;  4ZBJ C;  4J8W D;  2HIO C;  5GT0 C;  1P3P A;  1ZLA B;  2YFV A;  4WZS B;  1P3M D;  5CP6 B;  3KWQ A;  1N1J B;  5B24 D;  5B2J D;  2FJ7 B;  3A1I A;  3LJA B;  4CAY B;  4Z66 A;  3REJ B;  1TAF A;  5CPI A;  1WWI A;  1KX4 A;  2NZD A;  2F8N A;  3KXB B;  5DNN C;  4H9N A;  5GT3 B;  3VH5 A;  3X1U A;  3AZF B;  1ZLA D;  3MGS A;  4NFT A;  3REI C;  5CP6 D;  3MGR A;  3AFA C;  2FJ7 D;  3F6T A;  3LJA D;  3REJ D;  3X1T B;  5B32 B;  5AVB A;  1M1A B;  3KXB D;  5BNV A;  3O62 A;  5GT3 D;  5B1M C;  3AZF D;  4YS3 B;  2JE5 A;  5B2I B;  5B40 B;  3W96 A;  5JRG A;  2HUE C;  1P3L B;  1F66 A;  1M19 B;  3X1T D;  1P34 C;  5B32 D;  5AV8 A;  3C1C B;  1P3G B;  3AZN B;  3AZJ B;  1M1A D;  3AZH A;  5B0Y C;  3WAA A;  2IO5 C;  4YS3 D;  3UTA C;  5B2I D;  4X23 C;  2NZD D;  4CSR B;  4WU9 A;  1HQ3 A;  2Y2O A;  1P3L D;  3LEL C;  1M19 D;  2DF4 C;  1U35 B;  4J8X B;  1P3G D;  3AZN D;  3AZJ D;  2CV5 A;  4G91 C;  4H9S C;  1BH9 A;  3MNN A;  5B31 A;  3VH6 A;  5AY8 C;  3REK B;  3X1S A;  3AZM A;  1KX3 B;  5C3I C;  1WWS A;  3B6F B;  1U35 D;  3C1B A;  2Y2P A;  1S32 B;  4J8X D;  5AV5 A;  4J8U B;  2BYK B;  1ID3 C;  2ZY4 A;  3MGP C;  3REH C;  3REK D;  3MGQ B;  3WA9 B;  1KX3 D;  3NQU B;  3B6F D;  5GT0 A;  1S32 D;  3UTB C;  1ZLA C;  5B31 B;  5GSU B;  3A1K A;  5CP6 C;  3UT9 C;  4WU9 D;  4J8U D;  2FJ7 C;  3LJA C;  5JA4 B;  5AV6 A;  3REJ C;  3WKJ B;  3MGQ D;  1KX5 C;  5DNN A;  3LZ1 C;  3AZF C;  2VQR A;  5B31 D;  5GSU D;  3REI A;  4H9R B;  3X1S D;  4ZUX B;  2XD1 A;  3NQJ A;  3WKJ D;  3X1T C;  3IP4 C;  3W98 A;  4WU8 A;  4UUZ A;  3MVD B;  1EQZ C;  3A6N A;  4YS3 C;  1M18 B;  5B2I C;  3WTP C;  5B40 C;  1H3O B;  4H9Q A;  5B32 G;  5B33 B;  4ZUX D;  1P3O B;  1P34 A;  3C1C C;  1PZR A;  3AZJ C;  2ARO B;  4E44 A;  5B0Y A;  3AZG B;  3AL0 C;  2XD5 A;  3MVD D;  4R8P B;  4X23 A;  2Y2N A;  5F99 A;  5DNM A;  5B33 D;  3V9R A;  4Z5T B;  1P3O D;  2RVQ D;  1P3I A;  2PYO C;  1U35 C;  4KHA B;  5B0Z C;  2ARO D;  4H9S A;  3EPK A;  5GXQ C;  1TZY A;  4R8P D;  5CPK C;  3AZE A;  3W98 D;  4XZQ B;  3AN2 C;  3B6F C;  1AOI B;  3H0M C;  3A6N D;  4YM6 C;  1BH8 A;  5BO0 A;  5KDM A;  5E5A A;  4Z2M G;  1P3I B;  5BNX B;  5B1L B;  3WA9 C;  4WNN B;  2Y2H A;  4XZQ D;  3UTB A;  1AOI D;  1P3B C;  2ZY5 A;  1P3K C;  3B6G A;  3AZK C;  1P3F B;  3UT9 A;  5AV9 A;  3W99 A;  4KGC A;  5G49 A;  3LZ0 C;  3WKJ C;  1P3I D;  5B1L D;  3AV1 A;  5AVC B;  1KX5 A;  4LD9 C;  5B31 G;  3LZ1 A;  1P3A B;  3AYW A;  2BYM A;  4J8V A;  1P3F D;  3KUY A;  5BT1 C;  5CPJ A;  1P3P B;  2YFV B;  5AVC D;  3KWQ B;  3REL A;  1EQZ A;  1P3A D;  4Z66 B;  5CPI B;  1TAF B;  3MVD C;  1KX4 B;  5CHL B;  1B6W A;  2NZD B;  3TU4 C;  2F8N K;  1M18 C;  5E5A D;  5BS7 C;  2F8N B;  4H9N B;  5B33 C;  3X1U B;  4G92 B;  3AZI C;  3MGS B;  1P3P D;  3B6G D;  3VH5 T;  3KWQ D;  1JFI A;  3MGR B;  4KUD A;  2ARO C;  5AV9 D;  3AZG C;  3W97 C;  4QLC C;  4Z66 D;  5CPI D;  1KX4 D;  4KGC D;  4R8P C;  5AVB B;  5FUG A;  2Y2M A;  2F8N D;  2NQB C;  5BNV B;  3O62 B;  4JJN A;  4Z5T C;  2PYO A;  3X1U D;  4AWL B;  3MGS D;  5B0Z A;  4J8V D;  3MGR D;  3X1V C;  5GXQ A;  3AZL A;  3W96 B;  5JRG B;  1F66 B;  4J8W C;  2RIQ A;  5AV8 B;  4H9O A;  5CPK A;  5AVB D;  3R45 A;  3AZH B;  3AV2 A;  3O62 D;  3AN2 A;  3WAA B;  4XZQ C;  1P3M C;  4XUJ A;  1AOI C;  1F1E A;  5B24 C;  4YM6 A;  5B2J C;  4WU9 B;  1HQ3 B;  3W96 D;  5JRG D;  2G5H C;  1F66 D;  2HIO A;  5AV8 D;  5B1L C;  2CV5 B;  3AZH D;  1BH9 B;  3MNN B;  3WAA D;  1P3B A;  1P3K A;  3AZK A;  3VH6 T;  3X1S B;  2BG1 A;  4H9P A;  1HQ3 D;  3AZM B;  3LZ0 A;  3C1B B;  4LD9 A;  4XUJ B;  5AV5 B;  3KXB C;  5AVC C;  2CV5 D;  5GT3 C;  3MNN D;  3AFA A;  2J8P A;  2JCH A;  1Z2C B;  3AZM D;  1Q9C A;  4WJ3 C;  5GT0 B;  5B32 C;  3C1B D;  4XUJ D;  3B0C T;  1M1A C;  5AV5 D;  5B1M A;  3KWQ C;  5AV6 B;  3TU4 A;  2NZD C;  2HIO D;  5BS7 A;  5DNN B;  1P3L C;  4Z2M H;  1M19 C;  5GT0 D;  3AZI A;  2YFW A;  1P3G C;  3REI B;  3MGS C;  3AZN C;  3EPH A;  3H0R C;  3MGR C;  3W97 A;  4QLC A;  2W8S A;  3UTA A;  5AV6 D;  3NQJ B;  4E45 A;  2F8N G;  1BFM A;  2NQB A;  3LEL A;  3B0D B;  5DNN D;  3W98 B;  5B1M B;  4WU8 B;  4UUZ B;  2JSS A;  3A6N B;  4J8X C;  3REI D;  3X1V A;  5AY8 A;  4H9Q B;  2HUE B;  3W96 C;  4EO5 B;  4J8W A;  3REK C;  1P34 B;  1R4V A;  4DRB A;  1KX3 C;  5B0Y B;  5B1M D;  4WU8 D;  1S32 C;  1P3M A;  3WAA C;  4X23 B;  5B24 A;  5B2J A;  1ID3 A;  5F99 B;  5DNM B;  4DRA A;  4J8U C;  4WU9 C;  1HQ3 C;  3MGP A;  3REH A;  3V9R B;  1P34 D;  3MGQ C;  5B0Y D;  1ZLA A;  3MNN C;  5B31 C;  5CP6 A;  5GSU C;  1KU5 A;  1TZY B;  1W2E A;  1N1J A;  1T3U A;  4X23 D;  4DQY B;  3UTA D;  3P5J B;  5F99 D;  2FJ7 A;  5DNM D;  3LJA A;  4CAY A;  3X1S C;  5C3I B;  3REJ A;  3AZE B;  3LEL D;  2Y2Q A;  3EPL A;  3KXB A;  5GT3 A;  3WTP E;  3AZF A;  4NE6 A;  1BH8 B;  1A7W A;  5BO0 B;  5KDM B;  1TZY D;  5E5A B;  4ZUX C;  3AZE D;  3X1T A;  5B32 A;  3UTB B;  3B6G B;  1M1A A;  3B0B A;  3UT9 B;  5AV9 B;  3W99 B;  1ID3 D;  4YS3 A;  4KGC B;  5B2I A;  3WTP A;  5G49 B;  5B40 A;  3MGP D;  3REH D;  5AV6 C;  3AV1 B;  2LY8 A;  1KX5 B;  1P3L A;  1P3O C;  1M19 A;  2RVQ C;  3LZ1 B;  3C1C A;  3UTB D;  1P3G A;  3AZJ A;  2BYM B;  4NE5 A;  4J8V B;  3AZN A;  3AYW B;  3UT9 D;  3W99 D;  3KUY B;  2ZM5 A;  3EPJ A;  5CPJ B;  4CSR A;  2Y2J A;  3AV1 D;  1KX5 D;  1ULY A;  3REL B;  3W98 C;  3B0D C;  1U35 A;  3LZ1 D;  1EQZ B;  4J8X A;  4WU8 C;  3AYW D;  3A6N C;  3WTP B;  2ZY3 A;  3KUY D;  2CWE A;  3REK A;  5CPJ D;  4EO5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...