3A6NB

The nucleosome containing a testis-specific histone variant, human h3t
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
81
structure length
81
Chain Sequence
LRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1t
publication title Structural basis of instability of the nucleosome containing a testis-specific histone variant, human H3T
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 81
sequence length 81
chains with identical sequence F
ec nomenclature
pdb deposition date 2009-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3a6nB00
4KHAA 3A6NA 5BO0A 3KWQC 3VH6W 3REKA 3AZGC 4J8VD 2AROC 5AV8D 4JJND 3REID 1KX5A 5CP6D 3B0DB 2F8NB 4ZBJB 5GSUB 1KX3D 3WA9C 3AZNB 3UT9C 3UTAA 1TAFB 3X1UC 3AZFD 1WWSA 4Z66B 3UTBB 1KU5A 4LD9C 5KDMA 4Z5TC 4XUJD 3AZEC 4KUDB 5B24C 4H9PA 1P3IA 3MGRA 3KWQB 3AV2C 1HQ3C 2NQBC 5AY8D 2AROB 3VH5A 5B1LB 4H9OB 3MGPC 4KGCC 3UT9B 2F8NA 5CHLB 5GSUA 3X1TD 1TAFA 3AZEB 3VH5T 4LD9B 5B24B 4Z66A 5B2ID 4KUDA 3AV1C 3AV2B 1HQ3B 4J8UC 3O62D 3C1BC 4H9SC 2NQBB 3AZGD 3B6FC 5DNMD 5AVCD 3MGPB 3AZLC 1P3LB 5B1LA 3RELD 4KGCB 4H9OA 5E5AA 3UT9A 3AN2D 4EO5C 5B0YD 1A7WA 3TU4D 5F99D 1B67A 4J8UB 1P3PD 3X1SD 2HUEC 3AV2A 1HQ3A 2NZDD 4WNNA 2NQBA 4G92C 1ID3B 5BNXB 3MNNC 1P3LA 3LJAB 2HIOC 3KUYC 5B40A 5AV6D 1TZYC 3B0CW 4H9NB 1P3AC 1P3GD 1KX4D 5B1MC 3REJD 5JRGC 4WU9C 4G92B 4J8WA 3AZIC 3AZJA 4J8XB 1U35C 3W97A 4ZUXB 1ID3A 1P34C 1BH8B 2HIOB 3KUYB 3MGQB 1ZLAC 3LJAA 5GT0D 3LELD 1TZYB 1P3AB 1AOID 5GT3D 3MVDD 5B1MB 5AV9D 5BS7C 4H9NA 4WU9B 3W98C 1P3BB 4M6BA 3KXBD 2YFVB 4J8VC 3B6GB 5AVBD 5AV8C 4JJNC 3AZIB 4WU8D 1U35B 1P34B 5CP6C 1ZLAB 4J8XA 1KX3C 4ZUXA 1BH8A 3MGQA 3AZFC 4XUJC 2FJ7D 1P3AA 3LZ1D 4WU9A 5G49B 4J8VB 5AY8C 5AV8B 4JJNB 3REIB 5GXQD 1P3BA 1EQZA 5AV5A 3B6GA 5CP6B 4WZSB 3LZ0D 1KX3B 3VH5W 3WTPC 1P34A 1P3OD 1ZLAA 3WKJA 3C1CB 3AZFB 3X1TC 1F66B 4XUJB 4E44A 5B2IC 5BS7A 3REHA 3O62C 1P3MA 5CPKD 4R8PC 2F8NH 2CV5D 5B31D 5DNMC 5G49A 5AVCC 1M1AA 4AWLC 5AV8A 4JJNA 3W99D 5C3IC 4CSRB 4XZQD 3REIA 3RELC 5FUGB 3X1VD 5CP6A 3AZKD 1KX3A 5B33D 3AN2C 3X1TB 3C1CA 3AZFA 5B0YC 5B2IB 4YM6B 1P3FD 3AZMD 1F66A 2PYOD 3MGSD 5F99C 3TU4C 1P3PC 3O62B 5B32D 3X1SC 3AZGB 3AZHD 2NZDC 5AVCB 3A6ND 5DNMB 1P3KD 4AWLB 3REKD 3RELB 4CSRA 3WTPD 3WA9B 2BYMB 4QLCD 3X1UB 3AFAD 5AV6C 5B0YB 3AZNA 3UTAD 4Z5TB 3X1TA 1P3GC 3UTBA 5F99B 3TU4B 1KX4C 5B2IA 4YM6A 3REJC 1P3PB 1M18C 3X1SB 3W96D 5CPID 3MGRD 4NFTA 3O62A 4R8PD 3KWQA 3AZGA 5DNMA 5AVCA 2AROA 1R4VA 4YS3D 5GT0C 3LELC 3WA9A 2F8ND 2BYMA 3X1UA 1AOIC 2JSSA 5GT3C 1P3GB 3MVDC 3V9RB 5AV9C 3REJB 4LD9A 3AZEA 4Z5TA 3AV1B 5B24A 4Z66D 3C1BB 4KUDD 3X1SA 3KXBC 3B6FB 3AZLB 5AVBC 4DRBA 4WU8C 1HTAA 4E45A 3MGPA 3B0BA 5B1LD 5GT0B 3LELB 4KGCA 1H3OB 4EO5B 5E5AD 3MVDB 5AV9B 2FJ7C 1P3GA 5B2JD 1M18D 3V9RA 3REJA 3LZ1C 5DNND 3AV1A 2HUEB 3KXBB 4J8UA 3C1BA 5AVBB 4H9SA 1ULYA 5GXQC 4WU8B 1N1JB 2IO5C 3MNNB 3AZLA 3B6FA 1B6WA 2RVQD 3LZ0C 5BNXA 1P3OC 1P3LD 5GT0A 4X23D 5B40D 2FJ7B 3AYWD 5JRGB 3LZ1B 5CPKC 5B32G 2CV5C 5B31C 5CPJD 2IO5B 3W99C 4XZQC 4WU8A 3LZ0B 4J8WD 1S32D 3MNNA 3X1VC 1P3OB 3AZKC 3AZJD 3W97D 1ID3D 5B33C 2HIOA 3KUYA 3LJAD 1P3FC 3AZMC 1TZYA 2PYOC 2FJ7A 5B0ZD 3MGSC 3W98B 5B1MA 5B32C 5JRGA 5CPKB 3LZ1A 5B31B 3AZHC 3A6NC 5BT1D 1P3KC 3REKC 4XZQB 2YFVA 1Q9CA 3X1VB 2YFWB 3AZKB 3AZIA 1M19D 1U35A 1P3OA 4QLCC 3AFAC 4UUZB 3R45B 4ZUXD 3UTAC 1P3FB 3AZMB 3MGQD 2PYOB 3MGSB 3NQJB 3W96C 5B32B 5CPIC 3W98A 1P3IC 3MGRC 3AZHB 3A6NB 5BO0B 5CPKA 5JA4B 5AY8B 1P3KB 4H9QB 3WAAD 4J8VA 1BH9B 1P3BD 1EQZD 3WTPB 5AV5D 3B6GD 3X1VA 2YFWA 4YS3C 4QLCB 3AFAB 3AZKA 3WKJD 3R45A 1P3FA 3AZMA 4XUJA 3W96B 2PYOA 4Z66C 5CPIB 4KUDC 5B32A 4Z2MG 4R8PB 3REHD 3AZHA 4NE6A 1P3MD 5AY8A 5JA4A 1P3KA 5C3IB 4H9QA 1BH9A 1M1AD 4YS3B 5B1LC 3WTPA 5FUGA 1KX5D 3AN2B 5E5AC 4QLCA 3AFAA 3C1CD 5B2JC 1JFIB 1F66D 5DNNC 3W96A 5CPIA 1P3ID 2NZDB 4R8PA 2RVQC 3RELA 1P3LC 4Z2MH 5E5AB 5AV6B 4YS3A 4X23C 4DRAA 5B40C 3AN2A 3AYWC 5GSUD 5B2JB 5B0YA 3AZND 2CWEA 1M18B 1KX4B 5DNNB 3TU4A 5F99A 3UTBD 3VH6A 4YM6D 1P3PA 1JFIA 1WWIA 5CPJC 2NZDA 4WNNB 3KWQD 4J8WC 1S32C 2AROD 3AZJC 3W97C 1ID3C 2LY8A 3VH6T 3KSYA 4X23B 5B40B 3AYWB 3LJAC 5GT3B 5AV6A 1AOIB 3WA9D 3UT9D 5B0ZC 3X1UD 2F8NK 5B2JA 1M18A 1KX4A 4LD9D 1F1EA 4Z5TD 3AZED 5DNNA 5B24D 5CPJB 5BT1C 4NE3A 3AV2D 1HQ3D 4J8WB 1S32B 5B31G 2NQBD 1M19C 3AZJB 3W97B 3MGPD 4HGAC 4J8XC 4ZUXC 3LELA 4KGCD 4X23A 3MGQC 1H3OA 4WV4B 5B0ZB 3AYWA 5GT3A 1AOIA 3MVDA 5AV9A 3NQUB 4NE5A 4H9RB 3AV1D 5GXQB 3KXBA 4J8UD 3WAAC 5CPJA 3C1BD 5AVBA 1P3BC 1N1JA 1M19B 1EQZC 5AV5C 3B6FD 1S32A 3AZLD 3B6GC 4HGAB 4G91C 3WKJC 5B0ZA 2L5AA 2BYKB 4CAYB 3REHC 2CV5B 1P3MC 3NQUA 3WAAB 1BFMA 4H9RA 3W99B 5GXQA 1EQZB 5AV5B 1M1AC 3REIC 1M19A 3LZ0A 4G91B 5B33B 1KX5C 3MNND 3WKJB 4J8XD 3WTPE 2HIOD 3KUYD 3C1CC 2F8NG 1F66C 1TZYD 5BNVB 1P3AD 3REHB 5B1MD 4KHAB 1P3MB 2BYKA 5JRGD 4WU9D 4CAYA 3REKB 3B0CT 2CV5A 5B31A 3WAAA 1M1AB 3W99A 4XZQA 1KX5B 3AZID 1U35D 5B33A 1P34D 3UTAB 3B0DC 1ZLAD 4UUZA 4ZBJC 5GSUC 3AZNC 5KDMB 3MGSA 3UTBC 4H9PB 3NQJA 3MGRB 4YM6C 1P3IB 5BNVA 3W98D
chains in the Genus database with same CATH superfamily
4KHAA 3A6NA 5BO0A 3KWQC 3VH6W 3REKA 3AZGC 4J8VD 2AROC 5AV8D 4JJND 3REID 1KX5A 5CP6D 3B0DB 2F8NB 4ZBJB 5GSUB 1KX3D 3WA9C 3AZNB 3UT9C 3UTAA 1TAFB 3X1UC 3AZFD 1WWSA 4Z66B 3UTBB 1KU5A 2XD5A 4LD9C 5KDMA 4Z5TC 4XUJD 3AZEC 4KUDB 5B24C 4H9PA 1P3IA 3MGRA 2JE5A 3KWQB 3AV2C 1HQ3C 2NQBC 5AY8D 2AROB 3VH5A 5B1LB 2Y2QA 4H9OB 3MGPC 4KGCC 3UT9B 2F8NA 5CHLB 5GSUA 3X1TD 1TAFA 3AZEB 3VH5T 4LD9B 5B24B 4Z66A 5B2ID 2Y2NA 4KUDA 3AV1C 3AV2B 1HQ3B 4J8UC 3O62D 3C1BC 2FFFB 4H9SC 2NQBB 3AZGD 3B6FC 5DNMD 5AVCD 4UPKA 3MGPB 3AZLC 1P3LB 5B1LA 3RELD 4KGCB 4H9OA 5E5AA 3UT9A 3AN2D 4EO5C 5B0YD 1A7WA 3TU4D 5F99D 1B67A 4J8UB 1P3PD 3X1SD 2HUEC 3AV2A 1HQ3A 2NZDD 4WNNA 2NQBA 4G92C 1ID3B 5BNXB 3MNNC 1P3LA 2Y2GA 3LJAB 2HIOC 3KUYC 5B40A 5AV6D 1TZYC 3B0CW 4H9NB 1P3AC 1P3GD 1KX4D 5B1MC 3REJD 5JRGC 4WJ3C 4WU9C 4G92B 2ZY2A 2Y2HA 4J8WA 3AZIC 3AZJA 4J8XB 1U35C 3W97A 4ZUXB 1ID3A 1P34C 1BH8B 2HIOB 3KUYB 3MGQB 1ZLAC 3LJAA 5GT0D 3LELD 2DQNC 1TZYB 1P3AB 1AOID 5GT3D 3MVDD 5B1MB 5AV9D 5BS7C 4H9NA 4WU9B 3W98C 3IP4C 1P3BB 4M6BA 3KXBD 2JCHA 2YFVB 4J8VC 3B6GB 5AVBD 5AV8C 4JJNC 3AZIB 4WU8D 1U35B 1P34B 5CP6C 1ZLAB 4J8XA 1KX3C 4ZUXA 1BH8A 3MGQA 3AZFC 3AL0C 4XUJC 2FJ7D 1P3AA 2DF4C 3LZ1D 4WU9A 2Y2MA 5G49B 4J8VB 5AY8C 5AV8B 4JJNB 3REIB 5GXQD 1P3BA 1EQZA 5AV5A 3B6GA 5CP6B 4WZSB 3LZ0D 1KX3B 3VH5W 3WTPC 3H0LC 1P34A 1P3OD 1ZLAA 3WKJA 3C1CB 3AZFB 3FDDA 3X1TC 1F66B 4XUJB 4E44A 5B2IC 5BS7A 3REHA 2XD1A 3O62C 5CPKD 1P3MA 4R8PC 2F8NH 2CV5D 5B31D 5DNMC 5G49A 5AVCC 1M1AA 4AWLC 5AV8A 3H0RC 3W99D 5C3IC 4CSRB 4XZQD 4JJNA 3REIA 3RELC 5FUGB 3X1VD 5CP6A 3AZKD 1KX3A 5B33D 3AN2C 3X1TB 3C1CA 3AZFA 5B0YC 4DQYB 5B2IB 4YM6B 1P3FD 3AZMD 1F66A 2PYOD 3MGSD 5F99C 3TU4C 1P3PC 3O62B 5B32D 3X1SC 3AZGB 3AZHD 2NZDC 5AVCB 3A6ND 2F2AC 5DNMB 1P3KD 4AWLB 3REKD 3RELB 4CSRA 3WTPD 3WA9B 2J8PA 2BYMB 4QLCD 3X1UB 3AFAD 5AV6C 5B0YB 3AZNA 3UTAD 4Z5TB 3X1TA 3A1IA 1P3GC 3UTBA 5F99B 3TU4B 1KX4C 5B2IA 2UWXA 4YM6A 3REJC 1P3PB 3X1SB 1M18C 3W96D 5CPID 3MGRD 4NFTA 3O62A 4R8PD 3KWQA 3AZGA 5DNMA 5AVCA 2AROA 3EPLA 1R4VA 2ZY5A 4YS3D 5GT0C 3LELC 3WA9A 2F8ND 2BYMA 3X1UA 1AOIC 2JSSA 5GT3C 1P3GB 3MVDC 3V9RB 5AV9C 3REJB 4LD9A 3AZEA 4Z5TA 3AV1B 5B24A 4Z66D 3C1BB 2Y2OA 3X1SA 4KUDD 2Y2PA 3KXBC 3B6FB 3AZLB 5AVBC 4DRBA 4WU8C 1HTAA 4E45A 3MGPA 3B0BA 5B1LD 5GT0B 3LELB 4KGCA 1H3OB 4EO5B 5E5AD 3MVDB 5AV9B 2FJ7C 1P3GA 5B2JD 1M18D 3V9RA 3REJA 3LZ1C 5DNND 3AV1A 2HUEB 3KXBB 4J8UA 3C1BA 5AVBB 4H9SA 1ULYA 5GXQC 4WU8B 1N1JB 2IO5C 3MNNB 3AZLA 3B6FA 1B6WA 2RVQD 3LZ0C 5BNXA 1P3OC 1P3LD 1W2EA 5GT0A 4X23D 5B40D 2FJ7B 3AYWD 5JRGB 3LZ1B 5CPKC 5B32G 2CV5C 5B31C 5CPJD 2IO5B 1PZRA 3F6TA 3W99C 4XZQC 4WU8A 3LZ0B 4J8WD 1S32D 3MNNA 3X1VC 1P3OB 3AZKC 3AZJD 3W97D 1ID3D 5B33C 2HIOA 3KUYA 3LJAD 1P3FC 3AZMC 1TZYA 2RIQA 2PYOC 2FJ7A 2VQRA 5B0ZD 3MGSC 3W98B 3EG5B 5B1MA 5B32C 5JRGA 5CPKB 3LZ1A 5B31B 3AZHC 3A6NC 5BT1D 1P3KC 3REKC 4XZQB 2YFVA 1Q9CA 2G5HC 3X1VB 2YFWB 3AZKB 3AZIA 1M19D 1U35A 1P3OA 4QLCC 3AFAC 4UUZB 3R45B 4ZUXD 2Y2JA 3UTAC 1P3FB 3AZMB 3MGQD 2PYOB 3MGSB 3NQJB 3W96C 5B32B 5CPIC 3W98A 1P3IC 3MGRC 3AZHB 3A6NB 5BO0B 5CPKA 5JA4B 5AY8B 1P3KB 4H9QB 3WAAD 4J8VA 3EPHA 1BH9B 1P3BD 1EQZD 3WTPB 5AV5D 3B6GD 3X1VA 2YFWA 4YS3C 4QLCB 3AFAB 3AZKA 3WKJD 3R45A 1P3FA 3AZMA 4XUJA 3W96B 2PYOA 4Z66C 5CPIB 4KUDC 5B32A 4Z2MG 4R8PB 3REHD 3AZHA 4NE6A 1P3MD 5AY8A 2BG1A 5JA4A 1P3KA 5C3IB 4H9QA 1BH9A 1M1AD 4YS3B 5B1LC 3WTPA 5FUGA 1KX5D 3AN2B 5E5AC 2ZY3A 4QLCA 3AFAA 3EPJA 3C1CD 3A1KA 5B2JC 1JFIB 1F66D 5DNNC 3W96A 5CPIA 1P3ID 2NZDB 2Y2IA 4R8PA 2RVQC 3H0MC 3RELA 1P3LC 4Z2MH 5E5AB 5AV6B 4YS3A 4X23C 4DRAA 5B40C 3AN2A 3AYWC 5GSUD 5B2JB 5B0YA 3AZND 2CWEA 1M18B 1KX4B 5DNNB 3TU4A 5F99A 3UTBD 3VH6A 4YM6D 1P3PA 1JFIA 2ZM5A 1WWIA 2Y2KA 5CPJC 2NZDA 4WNNB 3KWQD 4J8WC 1S32C 2AROD 3AZJC 3P5JB 3W97C 1ID3C 2LY8A 3VH6T 3KSYA 4X23B 5B40B 3AYWB 3LJAC 5GT3B 5AV6A 1AOIB 3WA9D 3UT9D 5B0ZC 3X1UD 2F8NK 5B2JA 1M18A 1KX4A 4LD9D 1F1EA 4Z5TD 3AZED 5DNNA 1T3UA 5B24D 5CPJB 5BT1C 4NE3A 3AV2D 1HQ3D 4J8WB 1S32B 5B31G 2NQBD 2W8SA 1M19C 3AZJB 3W97B 3MGPD 4HGAC 4J8XC 4ZUXC 3LELA 4KGCD 4X23A 3MGQC 1H3OA 4WV4B 5B0ZB 3AYWA 5GT3A 1AOIA 3MVDA 5AV9A 3NQUB 4NE5A 4H9RB 3AV1D 5GXQB 3KXBA 4J8UD 3WAAC 5CPJA 3C1BD 5AVBA 1P3BC 1N1JA 1M19B 1EQZC 5AV5C 3B6FD 1S32A 3AZLD 3B6GC 4HGAB 4G91C 3WKJC 2Y2LA 5B0ZA 2G5IC 2L5AA 2BYKB 4CAYB 3REHC 2CV5B 1P3MC 3NQUA 3WAAB 2ZY4A 1BFMA 4H9RA 1Z2CB 3W99B 5GXQA 1EQZB 5AV5B 1M1AC 3REIC 1M19A 3LZ0A 4G91B 5B33B 1KX5C 3MNND 3WKJB 4J8XD 3WTPE 2HIOD 3KUYD 3C1CC 2F8NG 1F66C 1TZYD 5BNVB 1P3AD 3KFUG 3REHB 5B1MD 4KHAB 1P3MB 2BYKA 5JRGD 4WU9D 4CAYA 3REKB 3B0CT 2CV5A 5B31A 3WAAA 1M1AB 3W99A 4XZQA 1KX5B 3AZID 1U35D 5B33A 1P34D 3UTAB 3B0DC 1ZLAD 4UUZA 4ZBJC 5GSUC 3AZNC 5KDMB 3MGSA 3UTBC 4H9PB 3NQJA 3MGRB 4YM6C 1P3IB 3EPKA 5BNVA 3W98D
chains in the Genus database with same CATH topology
4KHAA 3A6NA 5BO0A 3KWQC 3VH6W 3REKA 3AZGC 4J8VD 2AROC 5AV8D 4JJND 3REID 1KX5A 5CP6D 3B0DB 2F8NB 4ZBJB 5GSUB 1KX3D 3WA9C 3AZNB 3UT9C 3UTAA 1TAFB 3X1UC 3AZFD 1WWSA 4Z66B 3UTBB 1KU5A 2XD5A 4LD9C 5KDMA 4Z5TC 4XUJD 3AZEC 4KUDB 5B24C 4H9PA 1P3IA 3MGRA 2JE5A 3KWQB 3AV2C 1HQ3C 2NQBC 5AY8D 2AROB 3VH5A 5B1LB 2Y2QA 4H9OB 3MGPC 4KGCC 3UT9B 2F8NA 5CHLB 5GSUA 3X1TD 1TAFA 3AZEB 3VH5T 4LD9B 5B24B 4Z66A 5B2ID 2Y2NA 4KUDA 3AV1C 3AV2B 1HQ3B 4J8UC 3O62D 3C1BC 2FFFB 4H9SC 2NQBB 3AZGD 3B6FC 5DNMD 5AVCD 4UPKA 3MGPB 3AZLC 1P3LB 5B1LA 3RELD 4KGCB 4H9OA 5E5AA 3UT9A 3AN2D 4EO5C 5B0YD 1A7WA 3TU4D 5F99D 1B67A 4J8UB 1P3PD 3X1SD 2HUEC 3AV2A 1HQ3A 2NZDD 4WNNA 2NQBA 4G92C 1ID3B 5BNXB 3MNNC 1P3LA 2Y2GA 3LJAB 2HIOC 3KUYC 5B40A 5AV6D 1TZYC 3B0CW 4H9NB 1P3AC 1P3GD 1KX4D 5B1MC 3REJD 5JRGC 4WJ3C 4WU9C 4G92B 2ZY2A 2Y2HA 4J8WA 3AZIC 3AZJA 4J8XB 1U35C 3W97A 4ZUXB 1ID3A 1P34C 1BH8B 2HIOB 3KUYB 3MGQB 1ZLAC 3LJAA 5GT0D 3LELD 2DQNC 1TZYB 1P3AB 1AOID 5GT3D 3MVDD 5B1MB 5AV9D 5BS7C 4H9NA 4WU9B 3W98C 3IP4C 1P3BB 4M6BA 3KXBD 2JCHA 2YFVB 4J8VC 3B6GB 5AVBD 5AV8C 4JJNC 3AZIB 4WU8D 1U35B 1P34B 5CP6C 1ZLAB 4J8XA 1KX3C 4ZUXA 1BH8A 3MGQA 3AZFC 3AL0C 4XUJC 2FJ7D 1P3AA 2DF4C 3LZ1D 4WU9A 2Y2MA 5G49B 4J8VB 5AY8C 5AV8B 4JJNB 3REIB 5GXQD 1P3BA 1EQZA 5AV5A 3B6GA 5CP6B 4WZSB 3LZ0D 1KX3B 3VH5W 3WTPC 3H0LC 1P34A 1P3OD 1ZLAA 3WKJA 3C1CB 3AZFB 3FDDA 3X1TC 1F66B 4XUJB 4E44A 5B2IC 5BS7A 3REHA 2XD1A 3O62C 5CPKD 1P3MA 4R8PC 2F8NH 2CV5D 5B31D 5DNMC 5G49A 5AVCC 1M1AA 4AWLC 5AV8A 3H0RC 3W99D 5C3IC 4CSRB 4XZQD 4JJNA 3REIA 3RELC 5FUGB 3X1VD 5CP6A 3AZKD 1KX3A 5B33D 3AN2C 3X1TB 3C1CA 3AZFA 5B0YC 4DQYB 5B2IB 4YM6B 1P3FD 3AZMD 1F66A 2PYOD 3MGSD 5F99C 3TU4C 1P3PC 3O62B 5B32D 3X1SC 3AZGB 3AZHD 2NZDC 5AVCB 3A6ND 2F2AC 5DNMB 1P3KD 4AWLB 3REKD 3RELB 4CSRA 3WTPD 3WA9B 2J8PA 2BYMB 4QLCD 3X1UB 3AFAD 5AV6C 5B0YB 3AZNA 3UTAD 4Z5TB 3X1TA 3A1IA 1P3GC 3UTBA 5F99B 3TU4B 1KX4C 5B2IA 2UWXA 4YM6A 3REJC 1P3PB 3X1SB 1M18C 3W96D 5CPID 3MGRD 4NFTA 3O62A 4R8PD 3KWQA 3AZGA 5DNMA 5AVCA 2AROA 3EPLA 1R4VA 2ZY5A 4YS3D 5GT0C 3LELC 3WA9A 2F8ND 2BYMA 3X1UA 1AOIC 2JSSA 5GT3C 1P3GB 3MVDC 3V9RB 5AV9C 3REJB 4LD9A 3AZEA 4Z5TA 3AV1B 5B24A 4Z66D 3C1BB 2Y2OA 3X1SA 4KUDD 2Y2PA 3KXBC 3B6FB 3AZLB 5AVBC 4DRBA 4WU8C 1HTAA 4E45A 3MGPA 3B0BA 5B1LD 5GT0B 3LELB 4KGCA 1H3OB 4EO5B 5E5AD 3MVDB 5AV9B 2FJ7C 1P3GA 5B2JD 1M18D 3V9RA 3REJA 3LZ1C 5DNND 3AV1A 2HUEB 3KXBB 4J8UA 3C1BA 5AVBB 4H9SA 1ULYA 5GXQC 4WU8B 1N1JB 2IO5C 3MNNB 3AZLA 3B6FA 1B6WA 2RVQD 3LZ0C 5BNXA 1P3OC 1P3LD 1W2EA 5GT0A 4X23D 5B40D 2FJ7B 3AYWD 5JRGB 3LZ1B 5CPKC 5B32G 2CV5C 5B31C 5CPJD 2IO5B 1PZRA 3F6TA 3W99C 4XZQC 4WU8A 3LZ0B 4J8WD 1S32D 3MNNA 3X1VC 1P3OB 3AZKC 3AZJD 3W97D 1ID3D 5B33C 2HIOA 3KUYA 3LJAD 1P3FC 3AZMC 1TZYA 2RIQA 2PYOC 2FJ7A 2VQRA 5B0ZD 3MGSC 3W98B 3EG5B 5B1MA 5B32C 5JRGA 5CPKB 3LZ1A 5B31B 3AZHC 3A6NC 5BT1D 1P3KC 3REKC 4XZQB 2YFVA 1Q9CA 2G5HC 3X1VB 2YFWB 3AZKB 3AZIA 1M19D 1U35A 1P3OA 4QLCC 3AFAC 4UUZB 3R45B 4ZUXD 2Y2JA 3UTAC 1P3FB 3AZMB 3MGQD 2PYOB 3MGSB 3NQJB 3W96C 5B32B 5CPIC 3W98A 1P3IC 3MGRC 3AZHB 3A6NB 5BO0B 5CPKA 5JA4B 5AY8B 1P3KB 4H9QB 3WAAD 4J8VA 3EPHA 1BH9B 1P3BD 1EQZD 3WTPB 5AV5D 3B6GD 3X1VA 2YFWA 4YS3C 4QLCB 3AFAB 3AZKA 3WKJD 3R45A 1P3FA 3AZMA 4XUJA 3W96B 2PYOA 4Z66C 5CPIB 4KUDC 5B32A 4Z2MG 4R8PB 3REHD 3AZHA 4NE6A 1P3MD 5AY8A 2BG1A 5JA4A 1P3KA 5C3IB 4H9QA 1BH9A 1M1AD 4YS3B 5B1LC 3WTPA 5FUGA 1KX5D 3AN2B 5E5AC 2ZY3A 4QLCA 3AFAA 3EPJA 3C1CD 3A1KA 5B2JC 1JFIB 1F66D 5DNNC 3W96A 5CPIA 1P3ID 2NZDB 2Y2IA 4R8PA 2RVQC 3H0MC 3RELA 1P3LC 4Z2MH 5E5AB 5AV6B 4YS3A 4X23C 4DRAA 5B40C 3AN2A 3AYWC 5GSUD 5B2JB 5B0YA 3AZND 2CWEA 1M18B 1KX4B 5DNNB 3TU4A 5F99A 3UTBD 3VH6A 4YM6D 1P3PA 1JFIA 2ZM5A 1WWIA 2Y2KA 5CPJC 2NZDA 4WNNB 3KWQD 4J8WC 1S32C 2AROD 3AZJC 3P5JB 3W97C 1ID3C 2LY8A 3VH6T 3KSYA 4X23B 5B40B 3AYWB 3LJAC 5GT3B 5AV6A 1AOIB 3WA9D 3UT9D 5B0ZC 3X1UD 2F8NK 5B2JA 1M18A 1KX4A 4LD9D 1F1EA 4Z5TD 3AZED 5DNNA 1T3UA 5B24D 5CPJB 5BT1C 4NE3A 3AV2D 1HQ3D 4J8WB 1S32B 5B31G 2NQBD 2W8SA 1M19C 3AZJB 3W97B 3MGPD 4HGAC 4J8XC 4ZUXC 3LELA 4KGCD 4X23A 3MGQC 1H3OA 4WV4B 5B0ZB 3AYWA 5GT3A 1AOIA 3MVDA 5AV9A 3NQUB 4NE5A 4H9RB 3AV1D 5GXQB 3KXBA 4J8UD 3WAAC 5CPJA 3C1BD 5AVBA 1P3BC 1N1JA 1M19B 1EQZC 5AV5C 3B6FD 1S32A 3AZLD 3B6GC 4HGAB 4G91C 3WKJC 2Y2LA 5B0ZA 2G5IC 2L5AA 2BYKB 4CAYB 3REHC 2CV5B 1P3MC 3NQUA 3WAAB 2ZY4A 1BFMA 4H9RA 1Z2CB 3W99B 5GXQA 1EQZB 5AV5B 1M1AC 3REIC 1M19A 3LZ0A 4G91B 5B33B 1KX5C 3MNND 3WKJB 4J8XD 3WTPE 2HIOD 3KUYD 3C1CC 2F8NG 1F66C 1TZYD 5BNVB 1P3AD 3KFUG 3REHB 5B1MD 4KHAB 1P3MB 2BYKA 5JRGD 4WU9D 4CAYA 3REKB 3B0CT 2CV5A 5B31A 3WAAA 1M1AB 3W99A 4XZQA 1KX5B 3AZID 1U35D 5B33A 1P34D 3UTAB 3B0DC 1ZLAD 4UUZA 4ZBJC 5GSUC 3AZNC 5KDMB 3MGSA 3UTBC 4H9PB 3NQJA 3MGRB 4YM6C 1P3IB 3EPKA 5BNVA 3W98D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KHA A;  3A6N A;  5BO0 A;  3KWQ C;  3VH6 W;  3REK A;  3AZG C;  4J8V D;  2ARO C;  5AV8 D;  4JJN D;  3REI D;  1KX5 A;  5CP6 D;  3B0D B;  2F8N B;  4ZBJ B;  5GSU B;  1KX3 D;  3WA9 C;  3AZN B;  3UT9 C;  3UTA A;  1TAF B;  3X1U C;  3AZF D;  1WWS A;  4Z66 B;  3UTB B;  1KU5 A;  4LD9 C;  5KDM A;  4Z5T C;  4XUJ D;  3AZE C;  4KUD B;  5B24 C;  4H9P A;  1P3I A;  3MGR A;  3KWQ B;  3AV2 C;  1HQ3 C;  2NQB C;  5AY8 D;  2ARO B;  3VH5 A;  5B1L B;  4H9O B;  3MGP C;  4KGC C;  3UT9 B;  2F8N A;  5CHL B;  5GSU A;  3X1T D;  1TAF A;  3AZE B;  3VH5 T;  4LD9 B;  5B24 B;  4Z66 A;  5B2I D;  4KUD A;  3AV1 C;  3AV2 B;  1HQ3 B;  4J8U C;  3O62 D;  3C1B C;  4H9S C;  2NQB B;  3AZG D;  3B6F C;  5DNM D;  5AVC D;  3MGP B;  3AZL C;  1P3L B;  5B1L A;  3REL D;  4KGC B;  4H9O A;  5E5A A;  3UT9 A;  3AN2 D;  4EO5 C;  5B0Y D;  1A7W A;  3TU4 D;  5F99 D;  1B67 A;  4J8U B;  1P3P D;  3X1S D;  2HUE C;  3AV2 A;  1HQ3 A;  2NZD D;  4WNN A;  2NQB A;  4G92 C;  1ID3 B;  5BNX B;  3MNN C;  1P3L A;  3LJA B;  2HIO C;  3KUY C;  5B40 A;  5AV6 D;  1TZY C;  3B0C W;  4H9N B;  1P3A C;  1P3G D;  1KX4 D;  5B1M C;  3REJ D;  5JRG C;  4WU9 C;  4G92 B;  4J8W A;  3AZI C;  3AZJ A;  4J8X B;  1U35 C;  3W97 A;  4ZUX B;  1ID3 A;  1P34 C;  1BH8 B;  2HIO B;  3KUY B;  3MGQ B;  1ZLA C;  3LJA A;  5GT0 D;  3LEL D;  1TZY B;  1P3A B;  1AOI D;  5GT3 D;  3MVD D;  5B1M B;  5AV9 D;  5BS7 C;  4H9N A;  4WU9 B;  3W98 C;  1P3B B;  4M6B A;  3KXB D;  2YFV B;  4J8V C;  3B6G B;  5AVB D;  5AV8 C;  4JJN C;  3AZI B;  4WU8 D;  1U35 B;  1P34 B;  5CP6 C;  1ZLA B;  4J8X A;  1KX3 C;  4ZUX A;  1BH8 A;  3MGQ A;  3AZF C;  4XUJ C;  2FJ7 D;  1P3A A;  3LZ1 D;  4WU9 A;  5G49 B;  4J8V B;  5AY8 C;  5AV8 B;  4JJN B;  3REI B;  5GXQ D;  1P3B A;  1EQZ A;  5AV5 A;  3B6G A;  5CP6 B;  4WZS B;  3LZ0 D;  1KX3 B;  3VH5 W;  3WTP C;  1P34 A;  1P3O D;  1ZLA A;  3WKJ A;  3C1C B;  3AZF B;  3X1T C;  1F66 B;  4XUJ B;  4E44 A;  5B2I C;  5BS7 A;  3REH A;  3O62 C;  1P3M A;  5CPK D;  4R8P C;  2F8N H;  2CV5 D;  5B31 D;  5DNM C;  5G49 A;  5AVC C;  1M1A A;  4AWL C;  5AV8 A;  4JJN A;  3W99 D;  5C3I C;  4CSR B;  4XZQ D;  3REI A;  3REL C;  5FUG B;  3X1V D;  5CP6 A;  3AZK D;  1KX3 A;  5B33 D;  3AN2 C;  3X1T B;  3C1C A;  3AZF A;  5B0Y C;  5B2I B;  4YM6 B;  1P3F D;  3AZM D;  1F66 A;  2PYO D;  3MGS D;  5F99 C;  3TU4 C;  1P3P C;  3O62 B;  5B32 D;  3X1S C;  3AZG B;  3AZH D;  2NZD C;  5AVC B;  3A6N D;  5DNM B;  1P3K D;  4AWL B;  3REK D;  3REL B;  4CSR A;  3WTP D;  3WA9 B;  2BYM B;  4QLC D;  3X1U B;  3AFA D;  5AV6 C;  5B0Y B;  3AZN A;  3UTA D;  4Z5T B;  3X1T A;  1P3G C;  3UTB A;  5F99 B;  3TU4 B;  1KX4 C;  5B2I A;  4YM6 A;  3REJ C;  1P3P B;  1M18 C;  3X1S B;  3W96 D;  5CPI D;  3MGR D;  4NFT A;  3O62 A;  4R8P D;  3KWQ A;  3AZG A;  5DNM A;  5AVC A;  2ARO A;  1R4V A;  4YS3 D;  5GT0 C;  3LEL C;  3WA9 A;  2F8N D;  2BYM A;  3X1U A;  1AOI C;  2JSS A;  5GT3 C;  1P3G B;  3MVD C;  3V9R B;  5AV9 C;  3REJ B;  4LD9 A;  3AZE A;  4Z5T A;  3AV1 B;  5B24 A;  4Z66 D;  3C1B B;  4KUD D;  3X1S A;  3KXB C;  3B6F B;  3AZL B;  5AVB C;  4DRB A;  4WU8 C;  1HTA A;  4E45 A;  3MGP A;  3B0B A;  5B1L D;  5GT0 B;  3LEL B;  4KGC A;  1H3O B;  4EO5 B;  5E5A D;  3MVD B;  5AV9 B;  2FJ7 C;  1P3G A;  5B2J D;  1M18 D;  3V9R A;  3REJ A;  3LZ1 C;  5DNN D;  3AV1 A;  2HUE B;  3KXB B;  4J8U A;  3C1B A;  5AVB B;  4H9S A;  1ULY A;  5GXQ C;  4WU8 B;  1N1J B;  2IO5 C;  3MNN B;  3AZL A;  3B6F A;  1B6W A;  2RVQ D;  3LZ0 C;  5BNX A;  1P3O C;  1P3L D;  5GT0 A;  4X23 D;  5B40 D;  2FJ7 B;  3AYW D;  5JRG B;  3LZ1 B;  5CPK C;  5B32 G;  2CV5 C;  5B31 C;  5CPJ D;  2IO5 B;  3W99 C;  4XZQ C;  4WU8 A;  3LZ0 B;  4J8W D;  1S32 D;  3MNN A;  3X1V C;  1P3O B;  3AZK C;  3AZJ D;  3W97 D;  1ID3 D;  5B33 C;  2HIO A;  3KUY A;  3LJA D;  1P3F C;  3AZM C;  1TZY A;  2PYO C;  2FJ7 A;  5B0Z D;  3MGS C;  3W98 B;  5B1M A;  5B32 C;  5JRG A;  5CPK B;  3LZ1 A;  5B31 B;  3AZH C;  3A6N C;  5BT1 D;  1P3K C;  3REK C;  4XZQ B;  2YFV A;  1Q9C A;  3X1V B;  2YFW B;  3AZK B;  3AZI A;  1M19 D;  1U35 A;  1P3O A;  4QLC C;  3AFA C;  4UUZ B;  3R45 B;  4ZUX D;  3UTA C;  1P3F B;  3AZM B;  3MGQ D;  2PYO B;  3MGS B;  3NQJ B;  3W96 C;  5B32 B;  5CPI C;  3W98 A;  1P3I C;  3MGR C;  3AZH B;  3A6N B;  5BO0 B;  5CPK A;  5JA4 B;  5AY8 B;  1P3K B;  4H9Q B;  3WAA D;  4J8V A;  1BH9 B;  1P3B D;  1EQZ D;  3WTP B;  5AV5 D;  3B6G D;  3X1V A;  2YFW A;  4YS3 C;  4QLC B;  3AFA B;  3AZK A;  3WKJ D;  3R45 A;  1P3F A;  3AZM A;  4XUJ A;  3W96 B;  2PYO A;  4Z66 C;  5CPI B;  4KUD C;  5B32 A;  4Z2M G;  4R8P B;  3REH D;  3AZH A;  4NE6 A;  1P3M D;  5AY8 A;  5JA4 A;  1P3K A;  5C3I B;  4H9Q A;  1BH9 A;  1M1A D;  4YS3 B;  5B1L C;  3WTP A;  5FUG A;  1KX5 D;  3AN2 B;  5E5A C;  4QLC A;  3AFA A;  3C1C D;  5B2J C;  1JFI B;  1F66 D;  5DNN C;  3W96 A;  5CPI A;  1P3I D;  2NZD B;  4R8P A;  2RVQ C;  3REL A;  1P3L C;  4Z2M H;  5E5A B;  5AV6 B;  4YS3 A;  4X23 C;  4DRA A;  5B40 C;  3AN2 A;  3AYW C;  5GSU D;  5B2J B;  5B0Y A;  3AZN D;  2CWE A;  1M18 B;  1KX4 B;  5DNN B;  3TU4 A;  5F99 A;  3UTB D;  3VH6 A;  4YM6 D;  1P3P A;  1JFI A;  1WWI A;  5CPJ C;  2NZD A;  4WNN B;  3KWQ D;  4J8W C;  1S32 C;  2ARO D;  3AZJ C;  3W97 C;  1ID3 C;  2LY8 A;  3VH6 T;  3KSY A;  4X23 B;  5B40 B;  3AYW B;  3LJA C;  5GT3 B;  5AV6 A;  1AOI B;  3WA9 D;  3UT9 D;  5B0Z C;  3X1U D;  2F8N K;  5B2J A;  1M18 A;  1KX4 A;  4LD9 D;  1F1E A;  4Z5T D;  3AZE D;  5DNN A;  5B24 D;  5CPJ B;  5BT1 C;  4NE3 A;  3AV2 D;  1HQ3 D;  4J8W B;  1S32 B;  5B31 G;  2NQB D;  1M19 C;  3AZJ B;  3W97 B;  3MGP D;  4HGA C;  4J8X C;  4ZUX C;  3LEL A;  4KGC D;  4X23 A;  3MGQ C;  1H3O A;  4WV4 B;  5B0Z B;  3AYW A;  5GT3 A;  1AOI A;  3MVD A;  5AV9 A;  3NQU B;  4NE5 A;  4H9R B;  3AV1 D;  5GXQ B;  3KXB A;  4J8U D;  3WAA C;  5CPJ A;  3C1B D;  5AVB A;  1P3B C;  1N1J A;  1M19 B;  1EQZ C;  5AV5 C;  3B6F D;  1S32 A;  3AZL D;  3B6G C;  4HGA B;  4G91 C;  3WKJ C;  5B0Z A;  2L5A A;  2BYK B;  4CAY B;  3REH C;  2CV5 B;  1P3M C;  3NQU A;  3WAA B;  1BFM A;  4H9R A;  3W99 B;  5GXQ A;  1EQZ B;  5AV5 B;  1M1A C;  3REI C;  1M19 A;  3LZ0 A;  4G91 B;  5B33 B;  1KX5 C;  3MNN D;  3WKJ B;  4J8X D;  3WTP E;  2HIO D;  3KUY D;  3C1C C;  2F8N G;  1F66 C;  1TZY D;  5BNV B;  1P3A D;  3REH B;  5B1M D;  4KHA B;  1P3M B;  2BYK A;  5JRG D;  4WU9 D;  4CAY A;  3REK B;  3B0C T;  2CV5 A;  5B31 A;  3WAA A;  1M1A B;  3W99 A;  4XZQ A;  1KX5 B;  3AZI D;  1U35 D;  5B33 A;  1P34 D;  3UTA B;  3B0D C;  1ZLA D;  4UUZ A;  4ZBJ C;  5GSU C;  3AZN C;  5KDM B;  3MGS A;  3UTB C;  4H9P B;  3NQJ A;  3MGR B;  4YM6 C;  1P3I B;  5BNV A;  3W98 D; 
#chains in the Genus database with same CATH topology
 4KHA A;  3A6N A;  5BO0 A;  3KWQ C;  3VH6 W;  3REK A;  3AZG C;  4J8V D;  2ARO C;  5AV8 D;  4JJN D;  3REI D;  1KX5 A;  5CP6 D;  3B0D B;  2F8N B;  4ZBJ B;  5GSU B;  1KX3 D;  3WA9 C;  3AZN B;  3UT9 C;  3UTA A;  1TAF B;  3X1U C;  3AZF D;  1WWS A;  4Z66 B;  3UTB B;  1KU5 A;  2XD5 A;  4LD9 C;  5KDM A;  4Z5T C;  4XUJ D;  3AZE C;  4KUD B;  5B24 C;  4H9P A;  1P3I A;  3MGR A;  2JE5 A;  3KWQ B;  3AV2 C;  1HQ3 C;  2NQB C;  5AY8 D;  2ARO B;  3VH5 A;  5B1L B;  2Y2Q A;  4H9O B;  3MGP C;  4KGC C;  3UT9 B;  2F8N A;  5CHL B;  5GSU A;  3X1T D;  1TAF A;  3AZE B;  3VH5 T;  4LD9 B;  5B24 B;  4Z66 A;  5B2I D;  2Y2N A;  4KUD A;  3AV1 C;  3AV2 B;  1HQ3 B;  4J8U C;  3O62 D;  3C1B C;  2FFF B;  4H9S C;  2NQB B;  3AZG D;  3B6F C;  5DNM D;  5AVC D;  4UPK A;  3MGP B;  3AZL C;  1P3L B;  5B1L A;  3REL D;  4KGC B;  4H9O A;  5E5A A;  3UT9 A;  3AN2 D;  4EO5 C;  5B0Y D;  1A7W A;  3TU4 D;  5F99 D;  1B67 A;  4J8U B;  1P3P D;  3X1S D;  2HUE C;  3AV2 A;  1HQ3 A;  2NZD D;  4WNN A;  2NQB A;  4G92 C;  1ID3 B;  5BNX B;  3MNN C;  1P3L A;  2Y2G A;  3LJA B;  2HIO C;  3KUY C;  5B40 A;  5AV6 D;  1TZY C;  3B0C W;  4H9N B;  1P3A C;  1P3G D;  1KX4 D;  5B1M C;  3REJ D;  5JRG C;  4WJ3 C;  4WU9 C;  4G92 B;  2ZY2 A;  2Y2H A;  4J8W A;  3AZI C;  3AZJ A;  4J8X B;  1U35 C;  3W97 A;  4ZUX B;  1ID3 A;  1P34 C;  1BH8 B;  2HIO B;  3KUY B;  3MGQ B;  1ZLA C;  3LJA A;  5GT0 D;  3LEL D;  2DQN C;  1TZY B;  1P3A B;  1AOI D;  5GT3 D;  3MVD D;  5B1M B;  5AV9 D;  5BS7 C;  4H9N A;  4WU9 B;  3W98 C;  3IP4 C;  1P3B B;  4M6B A;  3KXB D;  2JCH A;  2YFV B;  4J8V C;  3B6G B;  5AVB D;  5AV8 C;  4JJN C;  3AZI B;  4WU8 D;  1U35 B;  1P34 B;  5CP6 C;  1ZLA B;  4J8X A;  1KX3 C;  4ZUX A;  1BH8 A;  3MGQ A;  3AZF C;  3AL0 C;  4XUJ C;  2FJ7 D;  1P3A A;  2DF4 C;  3LZ1 D;  4WU9 A;  2Y2M A;  5G49 B;  4J8V B;  5AY8 C;  5AV8 B;  4JJN B;  3REI B;  5GXQ D;  1P3B A;  1EQZ A;  5AV5 A;  3B6G A;  5CP6 B;  4WZS B;  3LZ0 D;  1KX3 B;  3VH5 W;  3WTP C;  3H0L C;  1P34 A;  1P3O D;  1ZLA A;  3WKJ A;  3C1C B;  3AZF B;  3FDD A;  3X1T C;  1F66 B;  4XUJ B;  4E44 A;  5B2I C;  5BS7 A;  3REH A;  2XD1 A;  3O62 C;  5CPK D;  1P3M A;  4R8P C;  2F8N H;  2CV5 D;  5B31 D;  5DNM C;  5G49 A;  5AVC C;  1M1A A;  4AWL C;  5AV8 A;  3H0R C;  3W99 D;  5C3I C;  4CSR B;  4XZQ D;  4JJN A;  3REI A;  3REL C;  5FUG B;  3X1V D;  5CP6 A;  3AZK D;  1KX3 A;  5B33 D;  3AN2 C;  3X1T B;  3C1C A;  3AZF A;  5B0Y C;  4DQY B;  5B2I B;  4YM6 B;  1P3F D;  3AZM D;  1F66 A;  2PYO D;  3MGS D;  5F99 C;  3TU4 C;  1P3P C;  3O62 B;  5B32 D;  3X1S C;  3AZG B;  3AZH D;  2NZD C;  5AVC B;  3A6N D;  2F2A C;  5DNM B;  1P3K D;  4AWL B;  3REK D;  3REL B;  4CSR A;  3WTP D;  3WA9 B;  2J8P A;  2BYM B;  4QLC D;  3X1U B;  3AFA D;  5AV6 C;  5B0Y B;  3AZN A;  3UTA D;  4Z5T B;  3X1T A;  3A1I A;  1P3G C;  3UTB A;  5F99 B;  3TU4 B;  1KX4 C;  5B2I A;  2UWX A;  4YM6 A;  3REJ C;  1P3P B;  3X1S B;  1M18 C;  3W96 D;  5CPI D;  3MGR D;  4NFT A;  3O62 A;  4R8P D;  3KWQ A;  3AZG A;  5DNM A;  5AVC A;  2ARO A;  3EPL A;  1R4V A;  2ZY5 A;  4YS3 D;  5GT0 C;  3LEL C;  3WA9 A;  2F8N D;  2BYM A;  3X1U A;  1AOI C;  2JSS A;  5GT3 C;  1P3G B;  3MVD C;  3V9R B;  5AV9 C;  3REJ B;  4LD9 A;  3AZE A;  4Z5T A;  3AV1 B;  5B24 A;  4Z66 D;  3C1B B;  2Y2O A;  3X1S A;  4KUD D;  2Y2P A;  3KXB C;  3B6F B;  3AZL B;  5AVB C;  4DRB A;  4WU8 C;  1HTA A;  4E45 A;  3MGP A;  3B0B A;  5B1L D;  5GT0 B;  3LEL B;  4KGC A;  1H3O B;  4EO5 B;  5E5A D;  3MVD B;  5AV9 B;  2FJ7 C;  1P3G A;  5B2J D;  1M18 D;  3V9R A;  3REJ A;  3LZ1 C;  5DNN D;  3AV1 A;  2HUE B;  3KXB B;  4J8U A;  3C1B A;  5AVB B;  4H9S A;  1ULY A;  5GXQ C;  4WU8 B;  1N1J B;  2IO5 C;  3MNN B;  3AZL A;  3B6F A;  1B6W A;  2RVQ D;  3LZ0 C;  5BNX A;  1P3O C;  1P3L D;  1W2E A;  5GT0 A;  4X23 D;  5B40 D;  2FJ7 B;  3AYW D;  5JRG B;  3LZ1 B;  5CPK C;  5B32 G;  2CV5 C;  5B31 C;  5CPJ D;  2IO5 B;  1PZR A;  3F6T A;  3W99 C;  4XZQ C;  4WU8 A;  3LZ0 B;  4J8W D;  1S32 D;  3MNN A;  3X1V C;  1P3O B;  3AZK C;  3AZJ D;  3W97 D;  1ID3 D;  5B33 C;  2HIO A;  3KUY A;  3LJA D;  1P3F C;  3AZM C;  1TZY A;  2RIQ A;  2PYO C;  2FJ7 A;  2VQR A;  5B0Z D;  3MGS C;  3W98 B;  3EG5 B;  5B1M A;  5B32 C;  5JRG A;  5CPK B;  3LZ1 A;  5B31 B;  3AZH C;  3A6N C;  5BT1 D;  1P3K C;  3REK C;  4XZQ B;  2YFV A;  1Q9C A;  2G5H C;  3X1V B;  2YFW B;  3AZK B;  3AZI A;  1M19 D;  1U35 A;  1P3O A;  4QLC C;  3AFA C;  4UUZ B;  3R45 B;  4ZUX D;  2Y2J A;  3UTA C;  1P3F B;  3AZM B;  3MGQ D;  2PYO B;  3MGS B;  3NQJ B;  3W96 C;  5B32 B;  5CPI C;  3W98 A;  1P3I C;  3MGR C;  3AZH B;  3A6N B;  5BO0 B;  5CPK A;  5JA4 B;  5AY8 B;  1P3K B;  4H9Q B;  3WAA D;  4J8V A;  3EPH A;  1BH9 B;  1P3B D;  1EQZ D;  3WTP B;  5AV5 D;  3B6G D;  3X1V A;  2YFW A;  4YS3 C;  4QLC B;  3AFA B;  3AZK A;  3WKJ D;  3R45 A;  1P3F A;  3AZM A;  4XUJ A;  3W96 B;  2PYO A;  4Z66 C;  5CPI B;  4KUD C;  5B32 A;  4Z2M G;  4R8P B;  3REH D;  3AZH A;  4NE6 A;  1P3M D;  5AY8 A;  2BG1 A;  5JA4 A;  1P3K A;  5C3I B;  4H9Q A;  1BH9 A;  1M1A D;  4YS3 B;  5B1L C;  3WTP A;  5FUG A;  1KX5 D;  3AN2 B;  5E5A C;  2ZY3 A;  4QLC A;  3AFA A;  3EPJ A;  3C1C D;  3A1K A;  5B2J C;  1JFI B;  1F66 D;  5DNN C;  3W96 A;  5CPI A;  1P3I D;  2NZD B;  2Y2I A;  4R8P A;  2RVQ C;  3H0M C;  3REL A;  1P3L C;  4Z2M H;  5E5A B;  5AV6 B;  4YS3 A;  4X23 C;  4DRA A;  5B40 C;  3AN2 A;  3AYW C;  5GSU D;  5B2J B;  5B0Y A;  3AZN D;  2CWE A;  1M18 B;  1KX4 B;  5DNN B;  3TU4 A;  5F99 A;  3UTB D;  3VH6 A;  4YM6 D;  1P3P A;  1JFI A;  2ZM5 A;  1WWI A;  2Y2K A;  5CPJ C;  2NZD A;  4WNN B;  3KWQ D;  4J8W C;  1S32 C;  2ARO D;  3AZJ C;  3P5J B;  3W97 C;  1ID3 C;  2LY8 A;  3VH6 T;  3KSY A;  4X23 B;  5B40 B;  3AYW B;  3LJA C;  5GT3 B;  5AV6 A;  1AOI B;  3WA9 D;  3UT9 D;  5B0Z C;  3X1U D;  2F8N K;  5B2J A;  1M18 A;  1KX4 A;  4LD9 D;  1F1E A;  4Z5T D;  3AZE D;  5DNN A;  1T3U A;  5B24 D;  5CPJ B;  5BT1 C;  4NE3 A;  3AV2 D;  1HQ3 D;  4J8W B;  1S32 B;  5B31 G;  2NQB D;  2W8S A;  1M19 C;  3AZJ B;  3W97 B;  3MGP D;  4HGA C;  4J8X C;  4ZUX C;  3LEL A;  4KGC D;  4X23 A;  3MGQ C;  1H3O A;  4WV4 B;  5B0Z B;  3AYW A;  5GT3 A;  1AOI A;  3MVD A;  5AV9 A;  3NQU B;  4NE5 A;  4H9R B;  3AV1 D;  5GXQ B;  3KXB A;  4J8U D;  3WAA C;  5CPJ A;  3C1B D;  5AVB A;  1P3B C;  1N1J A;  1M19 B;  1EQZ C;  5AV5 C;  3B6F D;  1S32 A;  3AZL D;  3B6G C;  4HGA B;  4G91 C;  3WKJ C;  2Y2L A;  5B0Z A;  2G5I C;  2L5A A;  2BYK B;  4CAY B;  3REH C;  2CV5 B;  1P3M C;  3NQU A;  3WAA B;  2ZY4 A;  1BFM A;  4H9R A;  1Z2C B;  3W99 B;  5GXQ A;  1EQZ B;  5AV5 B;  1M1A C;  3REI C;  1M19 A;  3LZ0 A;  4G91 B;  5B33 B;  1KX5 C;  3MNN D;  3WKJ B;  4J8X D;  3WTP E;  2HIO D;  3KUY D;  3C1C C;  2F8N G;  1F66 C;  1TZY D;  5BNV B;  1P3A D;  3KFU G;  3REH B;  5B1M D;  4KHA B;  1P3M B;  2BYK A;  5JRG D;  4WU9 D;  4CAY A;  3REK B;  3B0C T;  2CV5 A;  5B31 A;  3WAA A;  1M1A B;  3W99 A;  4XZQ A;  1KX5 B;  3AZI D;  1U35 D;  5B33 A;  1P34 D;  3UTA B;  3B0D C;  1ZLA D;  4UUZ A;  4ZBJ C;  5GSU C;  3AZN C;  5KDM B;  3MGS A;  3UTB C;  4H9P B;  3NQJ A;  3MGR B;  4YM6 C;  1P3I B;  3EPK A;  5BNV A;  3W98 D; 
#chains in the Genus database with same CATH homology
 4KHA A;  3A6N A;  5BO0 A;  3KWQ C;  3VH6 W;  3REK A;  3AZG C;  4J8V D;  2ARO C;  5AV8 D;  4JJN D;  3REI D;  1KX5 A;  5CP6 D;  3B0D B;  2F8N B;  4ZBJ B;  5GSU B;  1KX3 D;  3WA9 C;  3AZN B;  3UT9 C;  3UTA A;  1TAF B;  3X1U C;  3AZF D;  1WWS A;  4Z66 B;  3UTB B;  1KU5 A;  2XD5 A;  4LD9 C;  5KDM A;  4Z5T C;  4XUJ D;  3AZE C;  4KUD B;  5B24 C;  4H9P A;  1P3I A;  3MGR A;  2JE5 A;  3KWQ B;  3AV2 C;  1HQ3 C;  2NQB C;  5AY8 D;  2ARO B;  3VH5 A;  5B1L B;  2Y2Q A;  4H9O B;  3MGP C;  4KGC C;  3UT9 B;  2F8N A;  5CHL B;  5GSU A;  3X1T D;  1TAF A;  3AZE B;  3VH5 T;  4LD9 B;  5B24 B;  4Z66 A;  5B2I D;  2Y2N A;  4KUD A;  3AV1 C;  3AV2 B;  1HQ3 B;  4J8U C;  3O62 D;  3C1B C;  2FFF B;  4H9S C;  2NQB B;  3AZG D;  3B6F C;  5DNM D;  5AVC D;  4UPK A;  3MGP B;  3AZL C;  1P3L B;  5B1L A;  3REL D;  4KGC B;  4H9O A;  5E5A A;  3UT9 A;  3AN2 D;  4EO5 C;  5B0Y D;  1A7W A;  3TU4 D;  5F99 D;  1B67 A;  4J8U B;  1P3P D;  3X1S D;  2HUE C;  3AV2 A;  1HQ3 A;  2NZD D;  4WNN A;  2NQB A;  4G92 C;  1ID3 B;  5BNX B;  3MNN C;  1P3L A;  2Y2G A;  3LJA B;  2HIO C;  3KUY C;  5B40 A;  5AV6 D;  1TZY C;  3B0C W;  4H9N B;  1P3A C;  1P3G D;  1KX4 D;  5B1M C;  3REJ D;  5JRG C;  4WJ3 C;  4WU9 C;  4G92 B;  2ZY2 A;  2Y2H A;  4J8W A;  3AZI C;  3AZJ A;  4J8X B;  1U35 C;  3W97 A;  4ZUX B;  1ID3 A;  1P34 C;  1BH8 B;  2HIO B;  3KUY B;  3MGQ B;  1ZLA C;  3LJA A;  5GT0 D;  3LEL D;  2DQN C;  1TZY B;  1P3A B;  1AOI D;  5GT3 D;  3MVD D;  5B1M B;  5AV9 D;  5BS7 C;  4H9N A;  4WU9 B;  3W98 C;  3IP4 C;  1P3B B;  4M6B A;  3KXB D;  2JCH A;  2YFV B;  4J8V C;  3B6G B;  5AVB D;  5AV8 C;  4JJN C;  3AZI B;  4WU8 D;  1U35 B;  1P34 B;  5CP6 C;  1ZLA B;  4J8X A;  1KX3 C;  4ZUX A;  1BH8 A;  3MGQ A;  3AZF C;  3AL0 C;  4XUJ C;  2FJ7 D;  1P3A A;  2DF4 C;  3LZ1 D;  4WU9 A;  2Y2M A;  5G49 B;  4J8V B;  5AY8 C;  5AV8 B;  4JJN B;  3REI B;  5GXQ D;  1P3B A;  1EQZ A;  5AV5 A;  3B6G A;  5CP6 B;  4WZS B;  3LZ0 D;  1KX3 B;  3VH5 W;  3WTP C;  3H0L C;  1P34 A;  1P3O D;  1ZLA A;  3WKJ A;  3C1C B;  3AZF B;  3FDD A;  3X1T C;  1F66 B;  4XUJ B;  4E44 A;  5B2I C;  5BS7 A;  3REH A;  2XD1 A;  3O62 C;  5CPK D;  1P3M A;  4R8P C;  2F8N H;  2CV5 D;  5B31 D;  5DNM C;  5G49 A;  5AVC C;  1M1A A;  4AWL C;  5AV8 A;  3H0R C;  3W99 D;  5C3I C;  4CSR B;  4XZQ D;  4JJN A;  3REI A;  3REL C;  5FUG B;  3X1V D;  5CP6 A;  3AZK D;  1KX3 A;  5B33 D;  3AN2 C;  3X1T B;  3C1C A;  3AZF A;  5B0Y C;  4DQY B;  5B2I B;  4YM6 B;  1P3F D;  3AZM D;  1F66 A;  2PYO D;  3MGS D;  5F99 C;  3TU4 C;  1P3P C;  3O62 B;  5B32 D;  3X1S C;  3AZG B;  3AZH D;  2NZD C;  5AVC B;  3A6N D;  2F2A C;  5DNM B;  1P3K D;  4AWL B;  3REK D;  3REL B;  4CSR A;  3WTP D;  3WA9 B;  2J8P A;  2BYM B;  4QLC D;  3X1U B;  3AFA D;  5AV6 C;  5B0Y B;  3AZN A;  3UTA D;  4Z5T B;  3X1T A;  3A1I A;  1P3G C;  3UTB A;  5F99 B;  3TU4 B;  1KX4 C;  5B2I A;  2UWX A;  4YM6 A;  3REJ C;  1P3P B;  3X1S B;  1M18 C;  3W96 D;  5CPI D;  3MGR D;  4NFT A;  3O62 A;  4R8P D;  3KWQ A;  3AZG A;  5DNM A;  5AVC A;  2ARO A;  3EPL A;  1R4V A;  2ZY5 A;  4YS3 D;  5GT0 C;  3LEL C;  3WA9 A;  2F8N D;  2BYM A;  3X1U A;  1AOI C;  2JSS A;  5GT3 C;  1P3G B;  3MVD C;  3V9R B;  5AV9 C;  3REJ B;  4LD9 A;  3AZE A;  4Z5T A;  3AV1 B;  5B24 A;  4Z66 D;  3C1B B;  2Y2O A;  3X1S A;  4KUD D;  2Y2P A;  3KXB C;  3B6F B;  3AZL B;  5AVB C;  4DRB A;  4WU8 C;  1HTA A;  4E45 A;  3MGP A;  3B0B A;  5B1L D;  5GT0 B;  3LEL B;  4KGC A;  1H3O B;  4EO5 B;  5E5A D;  3MVD B;  5AV9 B;  2FJ7 C;  1P3G A;  5B2J D;  1M18 D;  3V9R A;  3REJ A;  3LZ1 C;  5DNN D;  3AV1 A;  2HUE B;  3KXB B;  4J8U A;  3C1B A;  5AVB B;  4H9S A;  1ULY A;  5GXQ C;  4WU8 B;  1N1J B;  2IO5 C;  3MNN B;  3AZL A;  3B6F A;  1B6W A;  2RVQ D;  3LZ0 C;  5BNX A;  1P3O C;  1P3L D;  1W2E A;  5GT0 A;  4X23 D;  5B40 D;  2FJ7 B;  3AYW D;  5JRG B;  3LZ1 B;  5CPK C;  5B32 G;  2CV5 C;  5B31 C;  5CPJ D;  2IO5 B;  1PZR A;  3F6T A;  3W99 C;  4XZQ C;  4WU8 A;  3LZ0 B;  4J8W D;  1S32 D;  3MNN A;  3X1V C;  1P3O B;  3AZK C;  3AZJ D;  3W97 D;  1ID3 D;  5B33 C;  2HIO A;  3KUY A;  3LJA D;  1P3F C;  3AZM C;  1TZY A;  2RIQ A;  2PYO C;  2FJ7 A;  2VQR A;  5B0Z D;  3MGS C;  3W98 B;  3EG5 B;  5B1M A;  5B32 C;  5JRG A;  5CPK B;  3LZ1 A;  5B31 B;  3AZH C;  3A6N C;  5BT1 D;  1P3K C;  3REK C;  4XZQ B;  2YFV A;  1Q9C A;  2G5H C;  3X1V B;  2YFW B;  3AZK B;  3AZI A;  1M19 D;  1U35 A;  1P3O A;  4QLC C;  3AFA C;  4UUZ B;  3R45 B;  4ZUX D;  2Y2J A;  3UTA C;  1P3F B;  3AZM B;  3MGQ D;  2PYO B;  3MGS B;  3NQJ B;  3W96 C;  5B32 B;  5CPI C;  3W98 A;  1P3I C;  3MGR C;  3AZH B;  3A6N B;  5BO0 B;  5CPK A;  5JA4 B;  5AY8 B;  1P3K B;  4H9Q B;  3WAA D;  4J8V A;  3EPH A;  1BH9 B;  1P3B D;  1EQZ D;  3WTP B;  5AV5 D;  3B6G D;  3X1V A;  2YFW A;  4YS3 C;  4QLC B;  3AFA B;  3AZK A;  3WKJ D;  3R45 A;  1P3F A;  3AZM A;  4XUJ A;  3W96 B;  2PYO A;  4Z66 C;  5CPI B;  4KUD C;  5B32 A;  4Z2M G;  4R8P B;  3REH D;  3AZH A;  4NE6 A;  1P3M D;  5AY8 A;  2BG1 A;  5JA4 A;  1P3K A;  5C3I B;  4H9Q A;  1BH9 A;  1M1A D;  4YS3 B;  5B1L C;  3WTP A;  5FUG A;  1KX5 D;  3AN2 B;  5E5A C;  2ZY3 A;  4QLC A;  3AFA A;  3EPJ A;  3C1C D;  3A1K A;  5B2J C;  1JFI B;  1F66 D;  5DNN C;  3W96 A;  5CPI A;  1P3I D;  2NZD B;  2Y2I A;  4R8P A;  2RVQ C;  3H0M C;  3REL A;  1P3L C;  4Z2M H;  5E5A B;  5AV6 B;  4YS3 A;  4X23 C;  4DRA A;  5B40 C;  3AN2 A;  3AYW C;  5GSU D;  5B2J B;  5B0Y A;  3AZN D;  2CWE A;  1M18 B;  1KX4 B;  5DNN B;  3TU4 A;  5F99 A;  3UTB D;  3VH6 A;  4YM6 D;  1P3P A;  1JFI A;  2ZM5 A;  1WWI A;  2Y2K A;  5CPJ C;  2NZD A;  4WNN B;  3KWQ D;  4J8W C;  1S32 C;  2ARO D;  3AZJ C;  3P5J B;  3W97 C;  1ID3 C;  2LY8 A;  3VH6 T;  3KSY A;  4X23 B;  5B40 B;  3AYW B;  3LJA C;  5GT3 B;  5AV6 A;  1AOI B;  3WA9 D;  3UT9 D;  5B0Z C;  3X1U D;  2F8N K;  5B2J A;  1M18 A;  1KX4 A;  4LD9 D;  1F1E A;  4Z5T D;  3AZE D;  5DNN A;  1T3U A;  5B24 D;  5CPJ B;  5BT1 C;  4NE3 A;  3AV2 D;  1HQ3 D;  4J8W B;  1S32 B;  5B31 G;  2NQB D;  2W8S A;  1M19 C;  3AZJ B;  3W97 B;  3MGP D;  4HGA C;  4J8X C;  4ZUX C;  3LEL A;  4KGC D;  4X23 A;  3MGQ C;  1H3O A;  4WV4 B;  5B0Z B;  3AYW A;  5GT3 A;  1AOI A;  3MVD A;  5AV9 A;  3NQU B;  4NE5 A;  4H9R B;  3AV1 D;  5GXQ B;  3KXB A;  4J8U D;  3WAA C;  5CPJ A;  3C1B D;  5AVB A;  1P3B C;  1N1J A;  1M19 B;  1EQZ C;  5AV5 C;  3B6F D;  1S32 A;  3AZL D;  3B6G C;  4HGA B;  4G91 C;  3WKJ C;  2Y2L A;  5B0Z A;  2G5I C;  2L5A A;  2BYK B;  4CAY B;  3REH C;  2CV5 B;  1P3M C;  3NQU A;  3WAA B;  2ZY4 A;  1BFM A;  4H9R A;  1Z2C B;  3W99 B;  5GXQ A;  1EQZ B;  5AV5 B;  1M1A C;  3REI C;  1M19 A;  3LZ0 A;  4G91 B;  5B33 B;  1KX5 C;  3MNN D;  3WKJ B;  4J8X D;  3WTP E;  2HIO D;  3KUY D;  3C1C C;  2F8N G;  1F66 C;  1TZY D;  5BNV B;  1P3A D;  3KFU G;  3REH B;  5B1M D;  4KHA B;  1P3M B;  2BYK A;  5JRG D;  4WU9 D;  4CAY A;  3REK B;  3B0C T;  2CV5 A;  5B31 A;  3WAA A;  1M1A B;  3W99 A;  4XZQ A;  1KX5 B;  3AZI D;  1U35 D;  5B33 A;  1P34 D;  3UTA B;  3B0D C;  1ZLA D;  4UUZ A;  4ZBJ C;  5GSU C;  3AZN C;  5KDM B;  3MGS A;  3UTB C;  4H9P B;  3NQJ A;  3MGR B;  4YM6 C;  1P3I B;  3EPK A;  5BNV A;  3W98 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...