3A6NB

The nucleosome containing a testis-specific histone variant, human h3t
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
81
structure length
81
Chain Sequence
b'LRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1t
publication title Structural basis of instability of the nucleosome containing a testis-specific histone variant, human H3T
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 26
structure length 81
sequence length 81
chains with identical sequence F
ec nomenclature
pdb deposition date 2009-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3a6nB00
3A6ND 1H3OB 4AWLB 3AZKC 1S32D 4YM6A 3LZ1B 3X1SD 4Z66D 5CPKC 3KWQC 1P3MD 1EQZC 3AYWC 4QLCA 4H9QB 1TAFA 3B0DB 2CWEA 4WZSB 3MGSA 5AV6B 3UTBA 3W97A 3REHC 2CV5C 2YFVA 3A6NB 3AZHD 1S32B 4CAYA 3R45B 4Z66B 3X1SB 3NQUB 3C1BB 5AV9D 5B31G 3O62D 3AZGC 3MGQA 1P3MB 5AV5C 5B0YC 3AZFC 3WKJC 4KGCC 4AWLC 2AROD 1P3OC 3W96C 3AZMD 3REKC 2FJ7A 4X23C 3C1CC 5CP6A 3AZEC 3AV2D 4HGAB 3AZHB 5B32G 1HQ3D 4J8UC 5CPID 5AVBA 5AV9B 5KDMB 3O62B 1P3LD 5B1MA 3X1TD 2AROB 1S32C 1M1AA 5GT0C 3AV1D 4Z66C 1R4VA 5B33D 5B2IC 3LJAA 3KXBD 4ZUXD 3AV2B 1F66D 3AFAD 5AV8A 1B67A 5CPIB 4YS3A 1P34A 1P3LB 1KX5D 3X1TB 3AZHC 3AV1B 5B33B 4H9NB 4ZUXB 3KXBB 5FUGA 4JJND 1F66B 1KX3D 3KSYA 3B6GA 3AFAB 4CSRB 2AROC 1TZYA 4XZQD 4NE6A 5JA4A 5B1LD 3AZMC 4XUJA 1ZLAD 2PYOA 3AN2A 1KX5B 5CPJB 3UT9D 3B6FA 1M19C 1AOIA 4R8PD 5F99B 1HQ3C 2LY8A 4H9OA 3KUYD 5AVCA 5CPIC 5B24D 5BT1D 4J8VD 4WV4B 4LD9A 2F8NA 4JJNB 4WU9D 1A7WA 1P3AD 4KUDA 4XZQB 4J8WD 5B1LB 1ZLAB 5GXQA 1EQZD 1P3BD 3AYWD 4ZUXC 3AZID 1F66C 3UT9B 3V9RB 4R8PB 4G91B 3KUYB 1P3FA 5B24B 4J8VB 4E45A 1JFIB 4WU9B 1M18D 1KX5C 3MVDA 1P3AB 5DNNA 3LELA 5CPKB 4J8WB 5E5AA 3AZGD 5JRGD 5AV5D 3LZ0A 1EQZB 3X1VD 1P3BB 5B0ZD 3AYWB 4JJNC 3AZIB 1KX3C 3TU4D 1P3OD 3W96D 3REKD 3MGRD 1BFMA 2BYKA 2F8NK 4XZQC 5GT3A 3C1CD 3AZED 1ZLAC 3REJD 5B2JD 1M18B 3VH6A 3UT9C 3WTPA 4G91C 3NQJA 4QLCD 3KUYC 5JRGB 5AV5B 5B24C 4WU8A 3B0BA 3UTAD 3AZGB 5BT1C 5B0ZB 4J8VC 3X1VB 5DNMA 4WU9C 4DRBA 3MGSD 1P3OB 5BNXB 5GT0D 3W96B 1P3AC 3REKB 5B2ID 3MGRB 5BS7A 4X23B 3REHA 4J8WC 4KHAB 3C1CB 3AZEB 5GSUA 4E44A 3AZLA 1P3BC 4NE5A 5B2JB 3REJB 1P3PA 1BH9A 4J8UB 3AZIC 3VH5A 3MGQD 4NE3A 5AY8D 3UTAB 3WTPE 3AZNA 4KGCA 4J8XC 1H3OA 1TAFB 5B31A 5B40C 2FJ7D 3LZ1A 1M18C 5GT0B 3REIC 5CP6D 2YFVB 1HTAA 5B2IB 3WA9C 2JSSA 1U35A 4CAYB 5JRGC 3B0CT 4DRAA 5BO0A 3X1VC 4H9QA 5B0ZC 3X1UD 3TU4C 3MGQB 3W98D 3AZJA 5B32A 5AV6A 5AY8B 3MGRC 3VH5W 3A6NA 4YM6C 1P3KA 1S32A 3REJC 5B2JC 1M19D 1BH8A 3R45A 3X1SA 3LJAD 3NQUA 5CP6B 3C1BA 1P3MA 4QLCC 3UTAC 4G92C 3X1UB 3W98B 3MGSC 3UTBC 3AZMB 3W97C 5CHLB 4Z5TA 3MNND 4H9SA 3B0CW 1M19B 1HQ3B 3LJAB 3MGQC 5AV9A 3O62A 3B6GD 4H9PB 5AY8C 2HUEC 4Z2MH 1TZYD 5G49B 2RVQD 5BNVA 2FJ7C 4XUJD 5CP6C 3MNNB 1AOID 3AV2A 1Q9CA 3WAAD 5AVBC 1KX4D 5CPIA 2F8ND 3X1UC 2NQBA 3W98C 4ZBJB 3B6GB 5B1MC 3MGPD 1P3LA 4KUDD 1M1AC 3X1TA 1P3ID 4XUJB 3RELD 5GXQD 3AV1A 3LJAC 5B33A 1F1EA 4H9NA 4ZUXA 3KXBA 1AOIB 3WAAB 1WWIA 1KX3B 5AV8C 2HIOD 1P3FD 3AFAA 1KX4B 4CSRA 2F8NB 3W99A 1N1JA 1P34C 3MGPB 3MNNC 1KX5A 5CPJA 4KUDB 5E5AD 1P3IB 3LZ0D 3RELB 5F99A 1P3GA 4H9RB 1ID3D 4ZBJC 3B6GC 4J8XD 5B40D 2HIOB 1TZYC 2RVQC 3REID 3WA9D 4XUJC 5B1LA 2F8NH 2NZDA 3WTPD 1AOIC 3WAAC 5E5AB 3UT9A 4R8PA 3LZ0B 4WU8D 1KX4C 3VH6T 3KUYA 4LD9C 5DNMD 1ID3B 4J8XB 4YM6D 3MGPC 3AZKA 4WU9A 1JFIA 5B40B 4KUDC 1P3AA 3REIB 3WA9B 1P3IC 2BYMB 3KWQA 3RELC 5GXQC 5CPKA 1P3PD 1EQZA 4UUZB 5C3IB 1P3BA 3AYWA 3WTPB 3TU4B 3NQJB 2HIOC 1P3FC 4WU8B 3UTBD 4WNNB 3W97D 5DNMB 3VH5T 5B31D 2CV5A 4YM6B 3MVDC 2YFWA 2IO5B 5DNNC 3LELC 5E5AC 1U35D 3LZ0C 3AZGA 4QLCB 5AV5A 1P3PB 1ID3C 5B0YA 1BH9B 3VH6W 4G92B 3AZFA 3WKJA 3AZJD 5B32D 5BNXA 3W96A 3MGSB 1P3OA 3UTBB 3REKA 5GT3C 3W97B 3MGRA 4EO5C 4X23A 5B31B 1P3KD 4KHAA 3C1CA 3AZEA 5C3IC 3REJA 5B2JA 5AVBD 3C1BD 3WTPC 4J8UA 1U35B 4WU8C 5BO0B 5B1MD 3UTAA 5DNMC 2HUEB 1M1AD 3AZJB 2FJ7B 2IO5C 5B32B 5GT0A 4Z5TD 5BS7C 4Z66A 5B2IA 5GSUC 1P3KB 3AZLC 1P3PC 1WWSA 1BH8B 5AV8D 5AVBB 4YS3D 1P34D 3AZNC 5B1MB 5AY8A 5B31C 3LZ1C 1M1AB 3AZHA 4Z5TB 1U35C 5KDMA 5AV8B 2NQBD 1B6WA 3B0DC 3AZJC 4YS3B 3X1UA 2AROA 4Z2MG 3W98A 1P34B 5B32C 5AV6C 2PYOD 3AZMA 3AN2D 3A6NC 5BNVB 1P3KC 3B6FD 3X1SC 5AVCD 1M19A 3C1BC 1HQ3A 4LD9D 1P3MC 5FUGB 4H9PA 4M6BA 2NQBB 3W99D 5G49A 1TZYB 5JA4B 4Z5TC 2PYOB 5CPJD 3AN2B 4H9SC 4HGAC 3MNNA 3B6FB 5F99D 1F66A 4H9OB 1P3GD 5AVCB 5AV9C 4YS3C 3O62C 4LD9B 1KU5A 3MVDD 3W99B 1N1JB 5DNND 3LELD 2NZDD 5GXQB 3AV2C 4JJNA 3WAAA 1KX3A 1P3GB 2NQBC 1P3FB 1KX4A 5GT3D 4XZQA 3AZKD 1P3LC 2PYOC 3MGPA 1ZLAA 3AN2C 3X1TC 3MVDB 3B6FC 5CPKD 3KWQD 5DNNB 3LELB 3AV1C 2F8NG 1P3IA 4NFTA 5AVCC 3RELA 3V9RA 5B33C 2NZDB 4H9RA 3KXBC 5B24A 4J8VA 3AFAC 2HIOA 3W99C 2BYKB 3REHD 5GT3B 2CV5D 4EO5B 3AZKB 5GSUD 4J8WA 3AZLD 5CPJC 3KWQB 3AZIA 2L5AA 5F99C 1P3GC 1ULYA 5B0YD 3AZND 3AZFD 3WKJD 4KGCD 1ID3A 4J8XA 3LZ1D 5B40A 1M18A 4X23D 5B1LC 3REHB 3REIA 2CV5B 3WA9A 2BYMA 2NZDC 5GSUB 2YFWB 3AZLB 5JRGA 4UUZA 4J8UD 3X1VA 5B0ZA 4R8PC 3TU4A 5AV6D 5B0YB 4WNNA 3AZNB 3AZFB 3WKJB 4KGCB
chains in the Genus database with same CATH superfamily
3A6ND 1H3OB 4AWLB 3AZKC 1S32D 4YM6A 3LZ1B 3X1SD 4Z66D 5CPKC 3KWQC 1P3MD 2Y2OA 1EQZC 3AYWC 4QLCA 4H9QB 1TAFA 3B0DB 2CWEA 2ZY4A 4WZSB 3MGSA 5AV6B 3UTBA 3W97A 3REHC 2CV5C 2YFVA 3A6NB 3AZHD 1S32B 4CAYA 3R45B 3EPKA 4Z66B 3X1SB 3NQUB 3C1BB 5AV9D 3F6TA 5B31G 3O62D 3AZGC 3MGQA 1P3MB 5AV5C 5B0YC 3AZFC 3WKJC 4KGCC 4AWLC 2AROD 1P3OC 3W96C 3AZMD 3REKC 2FJ7A 4X23C 3C1CC 5CP6A 3AZEC 3AV2D 4HGAB 3AZHB 2Y2GA 2Y2IA 5B32G 1HQ3D 4J8UC 5CPID 5AVBA 5AV9B 5KDMB 3O62B 1P3LD 5B1MA 2XD1A 3X1TD 2AROB 1S32C 1M1AA 5GT0C 3AV1D 4Z66C 1R4VA 5B33D 5B2IC 3LJAA 3KXBD 4ZUXD 3EPJA 3AV2B 1F66D 2ZY5A 3AFAD 5AV8A 1B67A 5CPIB 4YS3A 1P34A 1P3LB 3A1IA 1KX5D 2G5HC 3X1TB 3AZHC 3AV1B 2Y2LA 5B33B 4H9NB 4ZUXB 3KXBB 5FUGA 4JJND 1F66B 1KX3D 3KSYA 3B6GA 3AFAB 4CSRB 2AROC 1TZYA 4XZQD 4NE6A 5JA4A 5B1LD 3AZMC 4XUJA 1ZLAD 2PYOA 3AN2A 1KX5B 3P5JB 5CPJB 3UT9D 3B6FA 1M19C 1AOIA 4R8PD 5F99B 1HQ3C 2LY8A 4H9OA 3KUYD 5AVCA 5CPIC 5B24D 5BT1D 4J8VD 4WV4B 4LD9A 2F8NA 4JJNB 4WU9D 1A7WA 1P3AD 4KUDA 4XZQB 4J8WD 5B1LB 1ZLAB 5GXQA 1EQZD 1P3BD 3AYWD 4ZUXC 3AZID 2Y2HA 1F66C 3UT9B 3V9RB 4R8PB 4G91B 3KUYB 1P3FA 5B24B 4J8VB 4E45A 1JFIB 4WU9B 1M18D 1KX5C 3MVDA 1P3AB 5DNNA 3LELA 5CPKB 4J8WB 5E5AA 3AZGD 5JRGD 5AV5D 3LZ0A 1EQZB 3X1VD 1P3BB 5B0ZD 3AYWB 4JJNC 3AZIB 1KX3C 3TU4D 4UPKA 3H0LC 1P3OD 3W96D 3REKD 3MGRD 1BFMA 2BYKA 2F8NK 4XZQC 5GT3A 3C1CD 3AZED 1ZLAC 3REJD 5B2JD 1M18B 3AL0C 2UWXA 3VH6A 3UT9C 3WTPA 4G91C 3NQJA 4QLCD 3KUYC 5JRGB 5AV5B 5B24C 4WU8A 3B0BA 3UTAD 3AZGB 5BT1C 5B0ZB 4J8VC 3X1VB 2XD5A 5DNMA 3H0RC 4WU9C 4DRBA 3MGSD 1P3OB 5BNXB 5GT0D 3W96B 4WJ3C 1P3AC 3REKB 5B2ID 3MGRB 5BS7A 4X23B 3REHA 4J8WC 4KHAB 3C1CB 3AZEB 5GSUA 4E44A 3AZLA 1P3BC 4NE5A 5B2JB 3REJB 1P3PA 1BH9A 4J8UB 3AZIC 3VH5A 3MGQD 4NE3A 5AY8D 3UTAB 3WTPE 2W8SA 3AZNA 4KGCA 4J8XC 1H3OA 1TAFB 5B31A 5B40C 2FJ7D 3LZ1A 1M18C 5GT0B 3REIC 5CP6D 2YFVB 1HTAA 5B2IB 3WA9C 2JSSA 1U35A 4CAYB 5JRGC 3B0CT 4DRAA 5BO0A 3X1VC 4H9QA 2Y2MA 5B0ZC 3X1UD 3TU4C 3MGQB 3W98D 3AZJA 3EPLA 5B32A 5AV6A 5AY8B 3MGRC 3VH5W 3A6NA 4YM6C 1P3KA 1S32A 3REJC 5B2JC 1M19D 1BH8A 3R45A 3X1SA 3LJAD 3NQUA 5CP6B 3C1BA 1P3MA 4QLCC 3UTAC 4G92C 3FDDA 3X1UB 3W98B 3MGSC 3UTBC 3AZMB 3W97C 5CHLB 4Z5TA 3MNND 4H9SA 2Y2NA 3B0CW 1M19B 1HQ3B 3LJAB 3MGQC 5AV9A 3O62A 3B6GD 4H9PB 5AY8C 2HUEC 4Z2MH 1TZYD 5G49B 2RVQD 5BNVA 2FJ7C 4XUJD 3IP4C 1PZRA 2VQRA 5CP6C 3MNNB 1AOID 3AV2A 1Q9CA 3WAAD 5AVBC 1KX4D 5CPIA 2F8ND 3X1UC 2NQBA 3W98C 4ZBJB 3B6GB 5B1MC 3MGPD 1P3LA 4KUDD 2F2AC 1M1AC 3X1TA 1P3ID 4XUJB 3RELD 5GXQD 3AV1A 3LJAC 5B33A 1F1EA 4H9NA 4ZUXA 3KXBA 1AOIB 3WAAB 1WWIA 1KX3B 5AV8C 2HIOD 1P3FD 3AFAA 1KX4B 1W2EA 4CSRA 2F8NB 3W99A 1N1JA 1P34C 2ZY3A 3MGPB 3MNNC 1KX5A 5CPJA 4KUDB 3EPHA 5E5AD 1P3IB 3LZ0D 3RELB 5F99A 1P3GA 4H9RB 1ID3D 4ZBJC 3B6GC 4J8XD 5B40D 2HIOB 1TZYC 2RVQC 3REID 3WA9D 4XUJC 5B1LA 2F8NH 2NZDA 3WTPD 1AOIC 3WAAC 5E5AB 3UT9A 4R8PA 3LZ0B 4WU8D 1KX4C 3VH6T 3KUYA 4LD9C 1T3UA 5DNMD 1ID3B 4J8XB 4YM6D 3MGPC 3AZKA 4WU9A 3H0MC 5B40B 1JFIA 4KUDC 1P3AA 3REIB 3WA9B 1P3IC 2BYMB 3KWQA 3RELC 5GXQC 5CPKA 1P3PD 1EQZA 4UUZB 5C3IB 1P3BA 3AYWA 2ZY2A 3WTPB 2BG1A 3TU4B 3NQJB 2HIOC 1P3FC 4WU8B 3UTBD 4WNNB 3W97D 5DNMB 3VH5T 5B31D 2CV5A 4YM6B 3MVDC 2YFWA 2IO5B 5DNNC 3LELC 5E5AC 1U35D 3LZ0C 3AZGA 4QLCB 5AV5A 1P3PB 1ID3C 5B0YA 1BH9B 3VH6W 4G92B 3AZFA 3WKJA 3AZJD 5B32D 5BNXA 3W96A 3MGSB 1P3OA 3UTBB 3REKA 5GT3C 3W97B 3MGRA 4EO5C 4X23A 5B31B 1P3KD 4KHAA 3C1CA 3AZEA 5C3IC 3REJA 2JCHA 5B2JA 5AVBD 3C1BD 2Y2PA 3WTPC 4J8UA 1U35B 4WU8C 5BO0B 5B1MD 3UTAA 3KFUG 5DNMC 2HUEB 1M1AD 3AZJB 2FJ7B 2IO5C 5B32B 5GT0A 4Z5TD 5BS7C 4Z66A 1Z2CB 5B2IA 5GSUC 1P3KB 3AZLC 1P3PC 1WWSA 1BH8B 5AV8D 5AVBB 4YS3D 1P34D 2J8PA 3EG5B 3AZNC 5B1MB 5AY8A 5B31C 3LZ1C 1M1AB 3AZHA 4Z5TB 1U35C 5KDMA 5AV8B 2NQBD 1B6WA 3B0DC 3AZJC 4YS3B 3X1UA 2AROA 4Z2MG 3W98A 1P34B 5B32C 5AV6C 2PYOD 3AZMA 3AN2D 3A6NC 5BNVB 1P3KC 3B6FD 3X1SC 5AVCD 1M19A 3C1BC 1HQ3A 2RIQA 4LD9D 1P3MC 3A1KA 5FUGB 4H9PA 4M6BA 2NQBB 3W99D 5G49A 1TZYB 5JA4B 4Z5TC 2PYOB 5CPJD 3AN2B 4H9SC 4HGAC 3MNNA 3B6FB 5F99D 1F66A 4H9OB 1P3GD 5AVCB 5AV9C 4YS3C 3O62C 4LD9B 1KU5A 3MVDD 3W99B 1N1JB 5DNND 3LELD 2Y2KA 2NZDD 2JE5A 5GXQB 3AV2C 4JJNA 3WAAA 1KX3A 1P3GB 2NQBC 1P3FB 1KX4A 5GT3D 4XZQA 3AZKD 1P3LC 2PYOC 3MGPA 1ZLAA 3AN2C 3X1TC 3MVDB 3B6FC 5CPKD 2DF4C 5DNNB 3KWQD 3LELB 3AV1C 2F8NG 4DQYB 4NFTA 1P3IA 5AVCC 3RELA 3V9RA 5B33C 2NZDB 4H9RA 3KXBC 5B24A 4J8VA 2FFFB 2G5IC 3AFAC 2Y2JA 2HIOA 3W99C 2BYKB 3REHD 5GT3B 2CV5D 4EO5B 3AZKB 5GSUD 4J8WA 3AZLD 5CPJC 3KWQB 3AZIA 2L5AA 5F99C 1P3GC 1ULYA 5B0YD 2ZM5A 3AZND 3AZFD 2DQNC 3WKJD 4KGCD 1ID3A 4J8XA 3LZ1D 5B40A 1M18A 2Y2QA 4X23D 5B1LC 3REHB 3REIA 2CV5B 3WA9A 2BYMA 2NZDC 5GSUB 2YFWB 3AZLB 5JRGA 4UUZA 4J8UD 3X1VA 5B0ZA 4R8PC 3TU4A 5AV6D 5B0YB 4WNNA 3AZNB 3AZFB 3WKJB 4KGCB
chains in the Genus database with same CATH topology
3A6ND 1H3OB 4AWLB 3AZKC 1S32D 4YM6A 3LZ1B 3X1SD 4Z66D 5CPKC 3KWQC 1P3MD 2Y2OA 1EQZC 3AYWC 4QLCA 4H9QB 1TAFA 3B0DB 2CWEA 2ZY4A 4WZSB 3MGSA 5AV6B 3UTBA 3W97A 3REHC 2CV5C 2YFVA 3A6NB 3AZHD 1S32B 4CAYA 3R45B 3EPKA 4Z66B 3X1SB 3NQUB 3C1BB 5AV9D 3F6TA 5B31G 3O62D 3AZGC 3MGQA 1P3MB 5AV5C 5B0YC 3AZFC 3WKJC 4KGCC 4AWLC 2AROD 1P3OC 3W96C 3AZMD 3REKC 2FJ7A 4X23C 3C1CC 5CP6A 3AZEC 3AV2D 4HGAB 3AZHB 2Y2GA 2Y2IA 5B32G 1HQ3D 4J8UC 5CPID 5AVBA 5AV9B 5KDMB 3O62B 1P3LD 5B1MA 2XD1A 3X1TD 2AROB 1S32C 1M1AA 5GT0C 3AV1D 4Z66C 1R4VA 5B33D 5B2IC 3LJAA 3KXBD 4ZUXD 3EPJA 3AV2B 1F66D 2ZY5A 3AFAD 5AV8A 1B67A 5CPIB 4YS3A 1P34A 1P3LB 3A1IA 1KX5D 2G5HC 3X1TB 3AZHC 3AV1B 2Y2LA 5B33B 4H9NB 4ZUXB 3KXBB 5FUGA 4JJND 1F66B 1KX3D 3KSYA 3B6GA 3AFAB 4CSRB 2AROC 1TZYA 4XZQD 4NE6A 5JA4A 5B1LD 3AZMC 4XUJA 1ZLAD 2PYOA 3AN2A 1KX5B 3P5JB 5CPJB 3UT9D 3B6FA 1M19C 1AOIA 4R8PD 5F99B 1HQ3C 2LY8A 4H9OA 3KUYD 5AVCA 5CPIC 5B24D 5BT1D 4J8VD 4WV4B 4LD9A 2F8NA 4JJNB 4WU9D 1A7WA 1P3AD 4KUDA 4XZQB 4J8WD 5B1LB 1ZLAB 5GXQA 1EQZD 1P3BD 3AYWD 4ZUXC 3AZID 2Y2HA 1F66C 3UT9B 3V9RB 4R8PB 4G91B 3KUYB 1P3FA 5B24B 4J8VB 4E45A 1JFIB 4WU9B 1M18D 1KX5C 3MVDA 1P3AB 5DNNA 3LELA 5CPKB 4J8WB 5E5AA 3AZGD 5JRGD 5AV5D 3LZ0A 1EQZB 3X1VD 1P3BB 5B0ZD 3AYWB 4JJNC 3AZIB 1KX3C 3TU4D 4UPKA 3H0LC 1P3OD 3W96D 3REKD 3MGRD 1BFMA 2BYKA 2F8NK 4XZQC 5GT3A 3C1CD 3AZED 1ZLAC 3REJD 5B2JD 1M18B 3AL0C 2UWXA 3VH6A 3UT9C 3WTPA 4G91C 3NQJA 4QLCD 3KUYC 5JRGB 5AV5B 5B24C 4WU8A 3B0BA 3UTAD 3AZGB 5BT1C 5B0ZB 4J8VC 3X1VB 2XD5A 5DNMA 3H0RC 4WU9C 4DRBA 3MGSD 1P3OB 5BNXB 5GT0D 3W96B 4WJ3C 1P3AC 3REKB 5B2ID 3MGRB 5BS7A 4X23B 3REHA 4J8WC 4KHAB 3C1CB 3AZEB 5GSUA 4E44A 3AZLA 1P3BC 4NE5A 5B2JB 3REJB 1P3PA 1BH9A 4J8UB 3AZIC 3VH5A 3MGQD 4NE3A 5AY8D 3UTAB 3WTPE 2W8SA 3AZNA 4KGCA 4J8XC 1H3OA 1TAFB 5B31A 5B40C 2FJ7D 3LZ1A 1M18C 5GT0B 3REIC 5CP6D 2YFVB 1HTAA 5B2IB 3WA9C 2JSSA 1U35A 4CAYB 5JRGC 3B0CT 4DRAA 5BO0A 3X1VC 4H9QA 2Y2MA 5B0ZC 3X1UD 3TU4C 3MGQB 3W98D 3AZJA 3EPLA 5B32A 5AV6A 5AY8B 3MGRC 3VH5W 3A6NA 4YM6C 1P3KA 1S32A 3REJC 5B2JC 1M19D 1BH8A 3R45A 3X1SA 3LJAD 3NQUA 5CP6B 3C1BA 1P3MA 4QLCC 3UTAC 4G92C 3FDDA 3X1UB 3W98B 3MGSC 3UTBC 3AZMB 3W97C 5CHLB 4Z5TA 3MNND 4H9SA 2Y2NA 3B0CW 1M19B 1HQ3B 3LJAB 3MGQC 5AV9A 3O62A 3B6GD 4H9PB 5AY8C 2HUEC 4Z2MH 1TZYD 5G49B 2RVQD 5BNVA 2FJ7C 4XUJD 3IP4C 1PZRA 2VQRA 5CP6C 3MNNB 1AOID 3AV2A 1Q9CA 3WAAD 5AVBC 1KX4D 5CPIA 2F8ND 3X1UC 2NQBA 3W98C 4ZBJB 3B6GB 5B1MC 3MGPD 1P3LA 4KUDD 2F2AC 1M1AC 3X1TA 1P3ID 4XUJB 3RELD 5GXQD 3AV1A 3LJAC 5B33A 1F1EA 4H9NA 4ZUXA 3KXBA 1AOIB 3WAAB 1WWIA 1KX3B 5AV8C 2HIOD 1P3FD 3AFAA 1KX4B 1W2EA 4CSRA 2F8NB 3W99A 1N1JA 1P34C 2ZY3A 3MGPB 3MNNC 1KX5A 5CPJA 4KUDB 3EPHA 5E5AD 1P3IB 3LZ0D 3RELB 5F99A 1P3GA 4H9RB 1ID3D 4ZBJC 3B6GC 4J8XD 5B40D 2HIOB 1TZYC 2RVQC 3REID 3WA9D 4XUJC 5B1LA 2F8NH 2NZDA 3WTPD 1AOIC 3WAAC 5E5AB 3UT9A 4R8PA 3LZ0B 4WU8D 1KX4C 3VH6T 3KUYA 4LD9C 1T3UA 5DNMD 1ID3B 4J8XB 4YM6D 3MGPC 3AZKA 4WU9A 3H0MC 5B40B 1JFIA 4KUDC 1P3AA 3REIB 3WA9B 1P3IC 2BYMB 3KWQA 3RELC 5GXQC 5CPKA 1P3PD 1EQZA 4UUZB 5C3IB 1P3BA 3AYWA 2ZY2A 3WTPB 2BG1A 3TU4B 3NQJB 2HIOC 1P3FC 4WU8B 3UTBD 4WNNB 3W97D 5DNMB 3VH5T 5B31D 2CV5A 4YM6B 3MVDC 2YFWA 2IO5B 5DNNC 3LELC 5E5AC 1U35D 3LZ0C 3AZGA 4QLCB 5AV5A 1P3PB 1ID3C 5B0YA 1BH9B 3VH6W 4G92B 3AZFA 3WKJA 3AZJD 5B32D 5BNXA 3W96A 3MGSB 1P3OA 3UTBB 3REKA 5GT3C 3W97B 3MGRA 4EO5C 4X23A 5B31B 1P3KD 4KHAA 3C1CA 3AZEA 5C3IC 3REJA 2JCHA 5B2JA 5AVBD 3C1BD 2Y2PA 3WTPC 4J8UA 1U35B 4WU8C 5BO0B 5B1MD 3UTAA 3KFUG 5DNMC 2HUEB 1M1AD 3AZJB 2FJ7B 2IO5C 5B32B 5GT0A 4Z5TD 5BS7C 4Z66A 1Z2CB 5B2IA 5GSUC 1P3KB 3AZLC 1P3PC 1WWSA 1BH8B 5AV8D 5AVBB 4YS3D 1P34D 2J8PA 3EG5B 3AZNC 5B1MB 5AY8A 5B31C 3LZ1C 1M1AB 3AZHA 4Z5TB 1U35C 5KDMA 5AV8B 2NQBD 1B6WA 3B0DC 3AZJC 4YS3B 3X1UA 2AROA 4Z2MG 3W98A 1P34B 5B32C 5AV6C 2PYOD 3AZMA 3AN2D 3A6NC 5BNVB 1P3KC 3B6FD 3X1SC 5AVCD 1M19A 3C1BC 1HQ3A 2RIQA 4LD9D 1P3MC 3A1KA 5FUGB 4H9PA 4M6BA 2NQBB 3W99D 5G49A 1TZYB 5JA4B 4Z5TC 2PYOB 5CPJD 3AN2B 4H9SC 4HGAC 3MNNA 3B6FB 5F99D 1F66A 4H9OB 1P3GD 5AVCB 5AV9C 4YS3C 3O62C 4LD9B 1KU5A 3MVDD 3W99B 1N1JB 5DNND 3LELD 2Y2KA 2NZDD 2JE5A 5GXQB 3AV2C 4JJNA 3WAAA 1KX3A 1P3GB 2NQBC 1P3FB 1KX4A 5GT3D 4XZQA 3AZKD 1P3LC 2PYOC 3MGPA 1ZLAA 3AN2C 3X1TC 3MVDB 3B6FC 5CPKD 2DF4C 5DNNB 3KWQD 3LELB 3AV1C 2F8NG 4DQYB 4NFTA 1P3IA 5AVCC 3RELA 3V9RA 5B33C 2NZDB 4H9RA 3KXBC 5B24A 4J8VA 2FFFB 2G5IC 3AFAC 2Y2JA 2HIOA 3W99C 2BYKB 3REHD 5GT3B 2CV5D 4EO5B 3AZKB 5GSUD 4J8WA 3AZLD 5CPJC 3KWQB 3AZIA 2L5AA 5F99C 1P3GC 1ULYA 5B0YD 2ZM5A 3AZND 3AZFD 2DQNC 3WKJD 4KGCD 1ID3A 4J8XA 3LZ1D 5B40A 1M18A 2Y2QA 4X23D 5B1LC 3REHB 3REIA 2CV5B 3WA9A 2BYMA 2NZDC 5GSUB 2YFWB 3AZLB 5JRGA 4UUZA 4J8UD 3X1VA 5B0ZA 4R8PC 3TU4A 5AV6D 5B0YB 4WNNA 3AZNB 3AZFB 3WKJB 4KGCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A6N D;  1H3O B;  4AWL B;  3AZK C;  1S32 D;  4YM6 A;  3LZ1 B;  3X1S D;  4Z66 D;  5CPK C;  3KWQ C;  1P3M D;  1EQZ C;  3AYW C;  4QLC A;  4H9Q B;  1TAF A;  3B0D B;  2CWE A;  4WZS B;  3MGS A;  5AV6 B;  3UTB A;  3W97 A;  3REH C;  2CV5 C;  2YFV A;  3A6N B;  3AZH D;  1S32 B;  4CAY A;  3R45 B;  4Z66 B;  3X1S B;  3NQU B;  3C1B B;  5AV9 D;  5B31 G;  3O62 D;  3AZG C;  3MGQ A;  1P3M B;  5AV5 C;  5B0Y C;  3AZF C;  3WKJ C;  4KGC C;  4AWL C;  2ARO D;  1P3O C;  3W96 C;  3AZM D;  3REK C;  2FJ7 A;  4X23 C;  3C1C C;  5CP6 A;  3AZE C;  3AV2 D;  4HGA B;  3AZH B;  5B32 G;  1HQ3 D;  4J8U C;  5CPI D;  5AVB A;  5AV9 B;  5KDM B;  3O62 B;  1P3L D;  5B1M A;  3X1T D;  2ARO B;  1S32 C;  1M1A A;  5GT0 C;  3AV1 D;  4Z66 C;  1R4V A;  5B33 D;  5B2I C;  3LJA A;  3KXB D;  4ZUX D;  3AV2 B;  1F66 D;  3AFA D;  5AV8 A;  1B67 A;  5CPI B;  4YS3 A;  1P34 A;  1P3L B;  1KX5 D;  3X1T B;  3AZH C;  3AV1 B;  5B33 B;  4H9N B;  4ZUX B;  3KXB B;  5FUG A;  4JJN D;  1F66 B;  1KX3 D;  3KSY A;  3B6G A;  3AFA B;  4CSR B;  2ARO C;  1TZY A;  4XZQ D;  4NE6 A;  5JA4 A;  5B1L D;  3AZM C;  4XUJ A;  1ZLA D;  2PYO A;  3AN2 A;  1KX5 B;  5CPJ B;  3UT9 D;  3B6F A;  1M19 C;  1AOI A;  4R8P D;  5F99 B;  1HQ3 C;  2LY8 A;  4H9O A;  3KUY D;  5AVC A;  5CPI C;  5B24 D;  5BT1 D;  4J8V D;  4WV4 B;  4LD9 A;  2F8N A;  4JJN B;  4WU9 D;  1A7W A;  1P3A D;  4KUD A;  4XZQ B;  4J8W D;  5B1L B;  1ZLA B;  5GXQ A;  1EQZ D;  1P3B D;  3AYW D;  4ZUX C;  3AZI D;  1F66 C;  3UT9 B;  3V9R B;  4R8P B;  4G91 B;  3KUY B;  1P3F A;  5B24 B;  4J8V B;  4E45 A;  1JFI B;  4WU9 B;  1M18 D;  1KX5 C;  3MVD A;  1P3A B;  5DNN A;  3LEL A;  5CPK B;  4J8W B;  5E5A A;  3AZG D;  5JRG D;  5AV5 D;  3LZ0 A;  1EQZ B;  3X1V D;  1P3B B;  5B0Z D;  3AYW B;  4JJN C;  3AZI B;  1KX3 C;  3TU4 D;  1P3O D;  3W96 D;  3REK D;  3MGR D;  1BFM A;  2BYK A;  2F8N K;  4XZQ C;  5GT3 A;  3C1C D;  3AZE D;  1ZLA C;  3REJ D;  5B2J D;  1M18 B;  3VH6 A;  3UT9 C;  3WTP A;  4G91 C;  3NQJ A;  4QLC D;  3KUY C;  5JRG B;  5AV5 B;  5B24 C;  4WU8 A;  3B0B A;  3UTA D;  3AZG B;  5BT1 C;  5B0Z B;  4J8V C;  3X1V B;  5DNM A;  4WU9 C;  4DRB A;  3MGS D;  1P3O B;  5BNX B;  5GT0 D;  3W96 B;  1P3A C;  3REK B;  5B2I D;  3MGR B;  5BS7 A;  4X23 B;  3REH A;  4J8W C;  4KHA B;  3C1C B;  3AZE B;  5GSU A;  4E44 A;  3AZL A;  1P3B C;  4NE5 A;  5B2J B;  3REJ B;  1P3P A;  1BH9 A;  4J8U B;  3AZI C;  3VH5 A;  3MGQ D;  4NE3 A;  5AY8 D;  3UTA B;  3WTP E;  3AZN A;  4KGC A;  4J8X C;  1H3O A;  1TAF B;  5B31 A;  5B40 C;  2FJ7 D;  3LZ1 A;  1M18 C;  5GT0 B;  3REI C;  5CP6 D;  2YFV B;  1HTA A;  5B2I B;  3WA9 C;  2JSS A;  1U35 A;  4CAY B;  5JRG C;  3B0C T;  4DRA A;  5BO0 A;  3X1V C;  4H9Q A;  5B0Z C;  3X1U D;  3TU4 C;  3MGQ B;  3W98 D;  3AZJ A;  5B32 A;  5AV6 A;  5AY8 B;  3MGR C;  3VH5 W;  3A6N A;  4YM6 C;  1P3K A;  1S32 A;  3REJ C;  5B2J C;  1M19 D;  1BH8 A;  3R45 A;  3X1S A;  3LJA D;  3NQU A;  5CP6 B;  3C1B A;  1P3M A;  4QLC C;  3UTA C;  4G92 C;  3X1U B;  3W98 B;  3MGS C;  3UTB C;  3AZM B;  3W97 C;  5CHL B;  4Z5T A;  3MNN D;  4H9S A;  3B0C W;  1M19 B;  1HQ3 B;  3LJA B;  3MGQ C;  5AV9 A;  3O62 A;  3B6G D;  4H9P B;  5AY8 C;  2HUE C;  4Z2M H;  1TZY D;  5G49 B;  2RVQ D;  5BNV A;  2FJ7 C;  4XUJ D;  5CP6 C;  3MNN B;  1AOI D;  3AV2 A;  1Q9C A;  3WAA D;  5AVB C;  1KX4 D;  5CPI A;  2F8N D;  3X1U C;  2NQB A;  3W98 C;  4ZBJ B;  3B6G B;  5B1M C;  3MGP D;  1P3L A;  4KUD D;  1M1A C;  3X1T A;  1P3I D;  4XUJ B;  3REL D;  5GXQ D;  3AV1 A;  3LJA C;  5B33 A;  1F1E A;  4H9N A;  4ZUX A;  3KXB A;  1AOI B;  3WAA B;  1WWI A;  1KX3 B;  5AV8 C;  2HIO D;  1P3F D;  3AFA A;  1KX4 B;  4CSR A;  2F8N B;  3W99 A;  1N1J A;  1P34 C;  3MGP B;  3MNN C;  1KX5 A;  5CPJ A;  4KUD B;  5E5A D;  1P3I B;  3LZ0 D;  3REL B;  5F99 A;  1P3G A;  4H9R B;  1ID3 D;  4ZBJ C;  3B6G C;  4J8X D;  5B40 D;  2HIO B;  1TZY C;  2RVQ C;  3REI D;  3WA9 D;  4XUJ C;  5B1L A;  2F8N H;  2NZD A;  3WTP D;  1AOI C;  3WAA C;  5E5A B;  3UT9 A;  4R8P A;  3LZ0 B;  4WU8 D;  1KX4 C;  3VH6 T;  3KUY A;  4LD9 C;  5DNM D;  1ID3 B;  4J8X B;  4YM6 D;  3MGP C;  3AZK A;  4WU9 A;  1JFI A;  5B40 B;  4KUD C;  1P3A A;  3REI B;  3WA9 B;  1P3I C;  2BYM B;  3KWQ A;  3REL C;  5GXQ C;  5CPK A;  1P3P D;  1EQZ A;  4UUZ B;  5C3I B;  1P3B A;  3AYW A;  3WTP B;  3TU4 B;  3NQJ B;  2HIO C;  1P3F C;  4WU8 B;  3UTB D;  4WNN B;  3W97 D;  5DNM B;  3VH5 T;  5B31 D;  2CV5 A;  4YM6 B;  3MVD C;  2YFW A;  2IO5 B;  5DNN C;  3LEL C;  5E5A C;  1U35 D;  3LZ0 C;  3AZG A;  4QLC B;  5AV5 A;  1P3P B;  1ID3 C;  5B0Y A;  1BH9 B;  3VH6 W;  4G92 B;  3AZF A;  3WKJ A;  3AZJ D;  5B32 D;  5BNX A;  3W96 A;  3MGS B;  1P3O A;  3UTB B;  3REK A;  5GT3 C;  3W97 B;  3MGR A;  4EO5 C;  4X23 A;  5B31 B;  1P3K D;  4KHA A;  3C1C A;  3AZE A;  5C3I C;  3REJ A;  5B2J A;  5AVB D;  3C1B D;  3WTP C;  4J8U A;  1U35 B;  4WU8 C;  5BO0 B;  5B1M D;  3UTA A;  5DNM C;  2HUE B;  1M1A D;  3AZJ B;  2FJ7 B;  2IO5 C;  5B32 B;  5GT0 A;  4Z5T D;  5BS7 C;  4Z66 A;  5B2I A;  5GSU C;  1P3K B;  3AZL C;  1P3P C;  1WWS A;  1BH8 B;  5AV8 D;  5AVB B;  4YS3 D;  1P34 D;  3AZN C;  5B1M B;  5AY8 A;  5B31 C;  3LZ1 C;  1M1A B;  3AZH A;  4Z5T B;  1U35 C;  5KDM A;  5AV8 B;  2NQB D;  1B6W A;  3B0D C;  3AZJ C;  4YS3 B;  3X1U A;  2ARO A;  4Z2M G;  3W98 A;  1P34 B;  5B32 C;  5AV6 C;  2PYO D;  3AZM A;  3AN2 D;  3A6N C;  5BNV B;  1P3K C;  3B6F D;  3X1S C;  5AVC D;  1M19 A;  3C1B C;  1HQ3 A;  4LD9 D;  1P3M C;  5FUG B;  4H9P A;  4M6B A;  2NQB B;  3W99 D;  5G49 A;  1TZY B;  5JA4 B;  4Z5T C;  2PYO B;  5CPJ D;  3AN2 B;  4H9S C;  4HGA C;  3MNN A;  3B6F B;  5F99 D;  1F66 A;  4H9O B;  1P3G D;  5AVC B;  5AV9 C;  4YS3 C;  3O62 C;  4LD9 B;  1KU5 A;  3MVD D;  3W99 B;  1N1J B;  5DNN D;  3LEL D;  2NZD D;  5GXQ B;  3AV2 C;  4JJN A;  3WAA A;  1KX3 A;  1P3G B;  2NQB C;  1P3F B;  1KX4 A;  5GT3 D;  4XZQ A;  3AZK D;  1P3L C;  2PYO C;  3MGP A;  1ZLA A;  3AN2 C;  3X1T C;  3MVD B;  3B6F C;  5CPK D;  3KWQ D;  5DNN B;  3LEL B;  3AV1 C;  2F8N G;  1P3I A;  4NFT A;  5AVC C;  3REL A;  3V9R A;  5B33 C;  2NZD B;  4H9R A;  3KXB C;  5B24 A;  4J8V A;  3AFA C;  2HIO A;  3W99 C;  2BYK B;  3REH D;  5GT3 B;  2CV5 D;  4EO5 B;  3AZK B;  5GSU D;  4J8W A;  3AZL D;  5CPJ C;  3KWQ B;  3AZI A;  2L5A A;  5F99 C;  1P3G C;  1ULY A;  5B0Y D;  3AZN D;  3AZF D;  3WKJ D;  4KGC D;  1ID3 A;  4J8X A;  3LZ1 D;  5B40 A;  1M18 A;  4X23 D;  5B1L C;  3REH B;  3REI A;  2CV5 B;  3WA9 A;  2BYM A;  2NZD C;  5GSU B;  2YFW B;  3AZL B;  5JRG A;  4UUZ A;  4J8U D;  3X1V A;  5B0Z A;  4R8P C;  3TU4 A;  5AV6 D;  5B0Y B;  4WNN A;  3AZN B;  3AZF B;  3WKJ B;  4KGC B; 
#chains in the Genus database with same CATH topology
 3A6N D;  1H3O B;  4AWL B;  3AZK C;  1S32 D;  4YM6 A;  3LZ1 B;  3X1S D;  4Z66 D;  5CPK C;  3KWQ C;  1P3M D;  2Y2O A;  1EQZ C;  3AYW C;  4QLC A;  4H9Q B;  1TAF A;  3B0D B;  2CWE A;  2ZY4 A;  4WZS B;  3MGS A;  5AV6 B;  3UTB A;  3W97 A;  3REH C;  2CV5 C;  2YFV A;  3A6N B;  3AZH D;  1S32 B;  4CAY A;  3R45 B;  3EPK A;  4Z66 B;  3X1S B;  3NQU B;  3C1B B;  5AV9 D;  3F6T A;  5B31 G;  3O62 D;  3AZG C;  3MGQ A;  1P3M B;  5AV5 C;  5B0Y C;  3AZF C;  3WKJ C;  4KGC C;  4AWL C;  2ARO D;  1P3O C;  3W96 C;  3AZM D;  3REK C;  2FJ7 A;  4X23 C;  3C1C C;  5CP6 A;  3AZE C;  3AV2 D;  4HGA B;  3AZH B;  2Y2G A;  2Y2I A;  5B32 G;  1HQ3 D;  4J8U C;  5CPI D;  5AVB A;  5AV9 B;  5KDM B;  3O62 B;  1P3L D;  5B1M A;  2XD1 A;  3X1T D;  2ARO B;  1S32 C;  1M1A A;  5GT0 C;  3AV1 D;  4Z66 C;  1R4V A;  5B33 D;  5B2I C;  3LJA A;  3KXB D;  4ZUX D;  3EPJ A;  3AV2 B;  1F66 D;  2ZY5 A;  3AFA D;  5AV8 A;  1B67 A;  5CPI B;  4YS3 A;  1P34 A;  1P3L B;  3A1I A;  1KX5 D;  2G5H C;  3X1T B;  3AZH C;  3AV1 B;  2Y2L A;  5B33 B;  4H9N B;  4ZUX B;  3KXB B;  5FUG A;  4JJN D;  1F66 B;  1KX3 D;  3KSY A;  3B6G A;  3AFA B;  4CSR B;  2ARO C;  1TZY A;  4XZQ D;  4NE6 A;  5JA4 A;  5B1L D;  3AZM C;  4XUJ A;  1ZLA D;  2PYO A;  3AN2 A;  1KX5 B;  3P5J B;  5CPJ B;  3UT9 D;  3B6F A;  1M19 C;  1AOI A;  4R8P D;  5F99 B;  1HQ3 C;  2LY8 A;  4H9O A;  3KUY D;  5AVC A;  5CPI C;  5B24 D;  5BT1 D;  4J8V D;  4WV4 B;  4LD9 A;  2F8N A;  4JJN B;  4WU9 D;  1A7W A;  1P3A D;  4KUD A;  4XZQ B;  4J8W D;  5B1L B;  1ZLA B;  5GXQ A;  1EQZ D;  1P3B D;  3AYW D;  4ZUX C;  3AZI D;  2Y2H A;  1F66 C;  3UT9 B;  3V9R B;  4R8P B;  4G91 B;  3KUY B;  1P3F A;  5B24 B;  4J8V B;  4E45 A;  1JFI B;  4WU9 B;  1M18 D;  1KX5 C;  3MVD A;  1P3A B;  5DNN A;  3LEL A;  5CPK B;  4J8W B;  5E5A A;  3AZG D;  5JRG D;  5AV5 D;  3LZ0 A;  1EQZ B;  3X1V D;  1P3B B;  5B0Z D;  3AYW B;  4JJN C;  3AZI B;  1KX3 C;  3TU4 D;  4UPK A;  3H0L C;  1P3O D;  3W96 D;  3REK D;  3MGR D;  1BFM A;  2BYK A;  2F8N K;  4XZQ C;  5GT3 A;  3C1C D;  3AZE D;  1ZLA C;  3REJ D;  5B2J D;  1M18 B;  3AL0 C;  2UWX A;  3VH6 A;  3UT9 C;  3WTP A;  4G91 C;  3NQJ A;  4QLC D;  3KUY C;  5JRG B;  5AV5 B;  5B24 C;  4WU8 A;  3B0B A;  3UTA D;  3AZG B;  5BT1 C;  5B0Z B;  4J8V C;  3X1V B;  2XD5 A;  5DNM A;  3H0R C;  4WU9 C;  4DRB A;  3MGS D;  1P3O B;  5BNX B;  5GT0 D;  3W96 B;  4WJ3 C;  1P3A C;  3REK B;  5B2I D;  3MGR B;  5BS7 A;  4X23 B;  3REH A;  4J8W C;  4KHA B;  3C1C B;  3AZE B;  5GSU A;  4E44 A;  3AZL A;  1P3B C;  4NE5 A;  5B2J B;  3REJ B;  1P3P A;  1BH9 A;  4J8U B;  3AZI C;  3VH5 A;  3MGQ D;  4NE3 A;  5AY8 D;  3UTA B;  3WTP E;  2W8S A;  3AZN A;  4KGC A;  4J8X C;  1H3O A;  1TAF B;  5B31 A;  5B40 C;  2FJ7 D;  3LZ1 A;  1M18 C;  5GT0 B;  3REI C;  5CP6 D;  2YFV B;  1HTA A;  5B2I B;  3WA9 C;  2JSS A;  1U35 A;  4CAY B;  5JRG C;  3B0C T;  4DRA A;  5BO0 A;  3X1V C;  4H9Q A;  2Y2M A;  5B0Z C;  3X1U D;  3TU4 C;  3MGQ B;  3W98 D;  3AZJ A;  3EPL A;  5B32 A;  5AV6 A;  5AY8 B;  3MGR C;  3VH5 W;  3A6N A;  4YM6 C;  1P3K A;  1S32 A;  3REJ C;  5B2J C;  1M19 D;  1BH8 A;  3R45 A;  3X1S A;  3LJA D;  3NQU A;  5CP6 B;  3C1B A;  1P3M A;  4QLC C;  3UTA C;  4G92 C;  3FDD A;  3X1U B;  3W98 B;  3MGS C;  3UTB C;  3AZM B;  3W97 C;  5CHL B;  4Z5T A;  3MNN D;  4H9S A;  2Y2N A;  3B0C W;  1M19 B;  1HQ3 B;  3LJA B;  3MGQ C;  5AV9 A;  3O62 A;  3B6G D;  4H9P B;  5AY8 C;  2HUE C;  4Z2M H;  1TZY D;  5G49 B;  2RVQ D;  5BNV A;  2FJ7 C;  4XUJ D;  3IP4 C;  1PZR A;  2VQR A;  5CP6 C;  3MNN B;  1AOI D;  3AV2 A;  1Q9C A;  3WAA D;  5AVB C;  1KX4 D;  5CPI A;  2F8N D;  3X1U C;  2NQB A;  3W98 C;  4ZBJ B;  3B6G B;  5B1M C;  3MGP D;  1P3L A;  4KUD D;  2F2A C;  1M1A C;  3X1T A;  1P3I D;  4XUJ B;  3REL D;  5GXQ D;  3AV1 A;  3LJA C;  5B33 A;  1F1E A;  4H9N A;  4ZUX A;  3KXB A;  1AOI B;  3WAA B;  1WWI A;  1KX3 B;  5AV8 C;  2HIO D;  1P3F D;  3AFA A;  1KX4 B;  1W2E A;  4CSR A;  2F8N B;  3W99 A;  1N1J A;  1P34 C;  2ZY3 A;  3MGP B;  3MNN C;  1KX5 A;  5CPJ A;  4KUD B;  3EPH A;  5E5A D;  1P3I B;  3LZ0 D;  3REL B;  5F99 A;  1P3G A;  4H9R B;  1ID3 D;  4ZBJ C;  3B6G C;  4J8X D;  5B40 D;  2HIO B;  1TZY C;  2RVQ C;  3REI D;  3WA9 D;  4XUJ C;  5B1L A;  2F8N H;  2NZD A;  3WTP D;  1AOI C;  3WAA C;  5E5A B;  3UT9 A;  4R8P A;  3LZ0 B;  4WU8 D;  1KX4 C;  3VH6 T;  3KUY A;  4LD9 C;  1T3U A;  5DNM D;  1ID3 B;  4J8X B;  4YM6 D;  3MGP C;  3AZK A;  4WU9 A;  3H0M C;  5B40 B;  1JFI A;  4KUD C;  1P3A A;  3REI B;  3WA9 B;  1P3I C;  2BYM B;  3KWQ A;  3REL C;  5GXQ C;  5CPK A;  1P3P D;  1EQZ A;  4UUZ B;  5C3I B;  1P3B A;  3AYW A;  2ZY2 A;  3WTP B;  2BG1 A;  3TU4 B;  3NQJ B;  2HIO C;  1P3F C;  4WU8 B;  3UTB D;  4WNN B;  3W97 D;  5DNM B;  3VH5 T;  5B31 D;  2CV5 A;  4YM6 B;  3MVD C;  2YFW A;  2IO5 B;  5DNN C;  3LEL C;  5E5A C;  1U35 D;  3LZ0 C;  3AZG A;  4QLC B;  5AV5 A;  1P3P B;  1ID3 C;  5B0Y A;  1BH9 B;  3VH6 W;  4G92 B;  3AZF A;  3WKJ A;  3AZJ D;  5B32 D;  5BNX A;  3W96 A;  3MGS B;  1P3O A;  3UTB B;  3REK A;  5GT3 C;  3W97 B;  3MGR A;  4EO5 C;  4X23 A;  5B31 B;  1P3K D;  4KHA A;  3C1C A;  3AZE A;  5C3I C;  3REJ A;  2JCH A;  5B2J A;  5AVB D;  3C1B D;  2Y2P A;  3WTP C;  4J8U A;  1U35 B;  4WU8 C;  5BO0 B;  5B1M D;  3UTA A;  3KFU G;  5DNM C;  2HUE B;  1M1A D;  3AZJ B;  2FJ7 B;  2IO5 C;  5B32 B;  5GT0 A;  4Z5T D;  5BS7 C;  4Z66 A;  1Z2C B;  5B2I A;  5GSU C;  1P3K B;  3AZL C;  1P3P C;  1WWS A;  1BH8 B;  5AV8 D;  5AVB B;  4YS3 D;  1P34 D;  2J8P A;  3EG5 B;  3AZN C;  5B1M B;  5AY8 A;  5B31 C;  3LZ1 C;  1M1A B;  3AZH A;  4Z5T B;  1U35 C;  5KDM A;  5AV8 B;  2NQB D;  1B6W A;  3B0D C;  3AZJ C;  4YS3 B;  3X1U A;  2ARO A;  4Z2M G;  3W98 A;  1P34 B;  5B32 C;  5AV6 C;  2PYO D;  3AZM A;  3AN2 D;  3A6N C;  5BNV B;  1P3K C;  3B6F D;  3X1S C;  5AVC D;  1M19 A;  3C1B C;  1HQ3 A;  2RIQ A;  4LD9 D;  1P3M C;  3A1K A;  5FUG B;  4H9P A;  4M6B A;  2NQB B;  3W99 D;  5G49 A;  1TZY B;  5JA4 B;  4Z5T C;  2PYO B;  5CPJ D;  3AN2 B;  4H9S C;  4HGA C;  3MNN A;  3B6F B;  5F99 D;  1F66 A;  4H9O B;  1P3G D;  5AVC B;  5AV9 C;  4YS3 C;  3O62 C;  4LD9 B;  1KU5 A;  3MVD D;  3W99 B;  1N1J B;  5DNN D;  3LEL D;  2Y2K A;  2NZD D;  2JE5 A;  5GXQ B;  3AV2 C;  4JJN A;  3WAA A;  1KX3 A;  1P3G B;  2NQB C;  1P3F B;  1KX4 A;  5GT3 D;  4XZQ A;  3AZK D;  1P3L C;  2PYO C;  3MGP A;  1ZLA A;  3AN2 C;  3X1T C;  3MVD B;  3B6F C;  5CPK D;  2DF4 C;  5DNN B;  3KWQ D;  3LEL B;  3AV1 C;  2F8N G;  4DQY B;  4NFT A;  1P3I A;  5AVC C;  3REL A;  3V9R A;  5B33 C;  2NZD B;  4H9R A;  3KXB C;  5B24 A;  4J8V A;  2FFF B;  2G5I C;  3AFA C;  2Y2J A;  2HIO A;  3W99 C;  2BYK B;  3REH D;  5GT3 B;  2CV5 D;  4EO5 B;  3AZK B;  5GSU D;  4J8W A;  3AZL D;  5CPJ C;  3KWQ B;  3AZI A;  2L5A A;  5F99 C;  1P3G C;  1ULY A;  5B0Y D;  2ZM5 A;  3AZN D;  3AZF D;  2DQN C;  3WKJ D;  4KGC D;  1ID3 A;  4J8X A;  3LZ1 D;  5B40 A;  1M18 A;  2Y2Q A;  4X23 D;  5B1L C;  3REH B;  3REI A;  2CV5 B;  3WA9 A;  2BYM A;  2NZD C;  5GSU B;  2YFW B;  3AZL B;  5JRG A;  4UUZ A;  4J8U D;  3X1V A;  5B0Z A;  4R8P C;  3TU4 A;  5AV6 D;  5B0Y B;  4WNN A;  3AZN B;  3AZF B;  3WKJ B;  4KGC B; 
#chains in the Genus database with same CATH homology
 3A6N D;  1H3O B;  4AWL B;  3AZK C;  1S32 D;  4YM6 A;  3LZ1 B;  3X1S D;  4Z66 D;  5CPK C;  3KWQ C;  1P3M D;  2Y2O A;  1EQZ C;  3AYW C;  4QLC A;  4H9Q B;  1TAF A;  3B0D B;  2CWE A;  2ZY4 A;  4WZS B;  3MGS A;  5AV6 B;  3UTB A;  3W97 A;  3REH C;  2CV5 C;  2YFV A;  3A6N B;  3AZH D;  1S32 B;  4CAY A;  3R45 B;  3EPK A;  4Z66 B;  3X1S B;  3NQU B;  3C1B B;  5AV9 D;  3F6T A;  5B31 G;  3O62 D;  3AZG C;  3MGQ A;  1P3M B;  5AV5 C;  5B0Y C;  3AZF C;  3WKJ C;  4KGC C;  4AWL C;  2ARO D;  1P3O C;  3W96 C;  3AZM D;  3REK C;  2FJ7 A;  4X23 C;  3C1C C;  5CP6 A;  3AZE C;  3AV2 D;  4HGA B;  3AZH B;  2Y2G A;  2Y2I A;  5B32 G;  1HQ3 D;  4J8U C;  5CPI D;  5AVB A;  5AV9 B;  5KDM B;  3O62 B;  1P3L D;  5B1M A;  2XD1 A;  3X1T D;  2ARO B;  1S32 C;  1M1A A;  5GT0 C;  3AV1 D;  4Z66 C;  1R4V A;  5B33 D;  5B2I C;  3LJA A;  3KXB D;  4ZUX D;  3EPJ A;  3AV2 B;  1F66 D;  2ZY5 A;  3AFA D;  5AV8 A;  1B67 A;  5CPI B;  4YS3 A;  1P34 A;  1P3L B;  3A1I A;  1KX5 D;  2G5H C;  3X1T B;  3AZH C;  3AV1 B;  2Y2L A;  5B33 B;  4H9N B;  4ZUX B;  3KXB B;  5FUG A;  4JJN D;  1F66 B;  1KX3 D;  3KSY A;  3B6G A;  3AFA B;  4CSR B;  2ARO C;  1TZY A;  4XZQ D;  4NE6 A;  5JA4 A;  5B1L D;  3AZM C;  4XUJ A;  1ZLA D;  2PYO A;  3AN2 A;  1KX5 B;  3P5J B;  5CPJ B;  3UT9 D;  3B6F A;  1M19 C;  1AOI A;  4R8P D;  5F99 B;  1HQ3 C;  2LY8 A;  4H9O A;  3KUY D;  5AVC A;  5CPI C;  5B24 D;  5BT1 D;  4J8V D;  4WV4 B;  4LD9 A;  2F8N A;  4JJN B;  4WU9 D;  1A7W A;  1P3A D;  4KUD A;  4XZQ B;  4J8W D;  5B1L B;  1ZLA B;  5GXQ A;  1EQZ D;  1P3B D;  3AYW D;  4ZUX C;  3AZI D;  2Y2H A;  1F66 C;  3UT9 B;  3V9R B;  4R8P B;  4G91 B;  3KUY B;  1P3F A;  5B24 B;  4J8V B;  4E45 A;  1JFI B;  4WU9 B;  1M18 D;  1KX5 C;  3MVD A;  1P3A B;  5DNN A;  3LEL A;  5CPK B;  4J8W B;  5E5A A;  3AZG D;  5JRG D;  5AV5 D;  3LZ0 A;  1EQZ B;  3X1V D;  1P3B B;  5B0Z D;  3AYW B;  4JJN C;  3AZI B;  1KX3 C;  3TU4 D;  4UPK A;  3H0L C;  1P3O D;  3W96 D;  3REK D;  3MGR D;  1BFM A;  2BYK A;  2F8N K;  4XZQ C;  5GT3 A;  3C1C D;  3AZE D;  1ZLA C;  3REJ D;  5B2J D;  1M18 B;  3AL0 C;  2UWX A;  3VH6 A;  3UT9 C;  3WTP A;  4G91 C;  3NQJ A;  4QLC D;  3KUY C;  5JRG B;  5AV5 B;  5B24 C;  4WU8 A;  3B0B A;  3UTA D;  3AZG B;  5BT1 C;  5B0Z B;  4J8V C;  3X1V B;  2XD5 A;  5DNM A;  3H0R C;  4WU9 C;  4DRB A;  3MGS D;  1P3O B;  5BNX B;  5GT0 D;  3W96 B;  4WJ3 C;  1P3A C;  3REK B;  5B2I D;  3MGR B;  5BS7 A;  4X23 B;  3REH A;  4J8W C;  4KHA B;  3C1C B;  3AZE B;  5GSU A;  4E44 A;  3AZL A;  1P3B C;  4NE5 A;  5B2J B;  3REJ B;  1P3P A;  1BH9 A;  4J8U B;  3AZI C;  3VH5 A;  3MGQ D;  4NE3 A;  5AY8 D;  3UTA B;  3WTP E;  2W8S A;  3AZN A;  4KGC A;  4J8X C;  1H3O A;  1TAF B;  5B31 A;  5B40 C;  2FJ7 D;  3LZ1 A;  1M18 C;  5GT0 B;  3REI C;  5CP6 D;  2YFV B;  1HTA A;  5B2I B;  3WA9 C;  2JSS A;  1U35 A;  4CAY B;  5JRG C;  3B0C T;  4DRA A;  5BO0 A;  3X1V C;  4H9Q A;  2Y2M A;  5B0Z C;  3X1U D;  3TU4 C;  3MGQ B;  3W98 D;  3AZJ A;  3EPL A;  5B32 A;  5AV6 A;  5AY8 B;  3MGR C;  3VH5 W;  3A6N A;  4YM6 C;  1P3K A;  1S32 A;  3REJ C;  5B2J C;  1M19 D;  1BH8 A;  3R45 A;  3X1S A;  3LJA D;  3NQU A;  5CP6 B;  3C1B A;  1P3M A;  4QLC C;  3UTA C;  4G92 C;  3FDD A;  3X1U B;  3W98 B;  3MGS C;  3UTB C;  3AZM B;  3W97 C;  5CHL B;  4Z5T A;  3MNN D;  4H9S A;  2Y2N A;  3B0C W;  1M19 B;  1HQ3 B;  3LJA B;  3MGQ C;  5AV9 A;  3O62 A;  3B6G D;  4H9P B;  5AY8 C;  2HUE C;  4Z2M H;  1TZY D;  5G49 B;  2RVQ D;  5BNV A;  2FJ7 C;  4XUJ D;  3IP4 C;  1PZR A;  2VQR A;  5CP6 C;  3MNN B;  1AOI D;  3AV2 A;  1Q9C A;  3WAA D;  5AVB C;  1KX4 D;  5CPI A;  2F8N D;  3X1U C;  2NQB A;  3W98 C;  4ZBJ B;  3B6G B;  5B1M C;  3MGP D;  1P3L A;  4KUD D;  2F2A C;  1M1A C;  3X1T A;  1P3I D;  4XUJ B;  3REL D;  5GXQ D;  3AV1 A;  3LJA C;  5B33 A;  1F1E A;  4H9N A;  4ZUX A;  3KXB A;  1AOI B;  3WAA B;  1WWI A;  1KX3 B;  5AV8 C;  2HIO D;  1P3F D;  3AFA A;  1KX4 B;  1W2E A;  4CSR A;  2F8N B;  3W99 A;  1N1J A;  1P34 C;  2ZY3 A;  3MGP B;  3MNN C;  1KX5 A;  5CPJ A;  4KUD B;  3EPH A;  5E5A D;  1P3I B;  3LZ0 D;  3REL B;  5F99 A;  1P3G A;  4H9R B;  1ID3 D;  4ZBJ C;  3B6G C;  4J8X D;  5B40 D;  2HIO B;  1TZY C;  2RVQ C;  3REI D;  3WA9 D;  4XUJ C;  5B1L A;  2F8N H;  2NZD A;  3WTP D;  1AOI C;  3WAA C;  5E5A B;  3UT9 A;  4R8P A;  3LZ0 B;  4WU8 D;  1KX4 C;  3VH6 T;  3KUY A;  4LD9 C;  1T3U A;  5DNM D;  1ID3 B;  4J8X B;  4YM6 D;  3MGP C;  3AZK A;  4WU9 A;  3H0M C;  5B40 B;  1JFI A;  4KUD C;  1P3A A;  3REI B;  3WA9 B;  1P3I C;  2BYM B;  3KWQ A;  3REL C;  5GXQ C;  5CPK A;  1P3P D;  1EQZ A;  4UUZ B;  5C3I B;  1P3B A;  3AYW A;  2ZY2 A;  3WTP B;  2BG1 A;  3TU4 B;  3NQJ B;  2HIO C;  1P3F C;  4WU8 B;  3UTB D;  4WNN B;  3W97 D;  5DNM B;  3VH5 T;  5B31 D;  2CV5 A;  4YM6 B;  3MVD C;  2YFW A;  2IO5 B;  5DNN C;  3LEL C;  5E5A C;  1U35 D;  3LZ0 C;  3AZG A;  4QLC B;  5AV5 A;  1P3P B;  1ID3 C;  5B0Y A;  1BH9 B;  3VH6 W;  4G92 B;  3AZF A;  3WKJ A;  3AZJ D;  5B32 D;  5BNX A;  3W96 A;  3MGS B;  1P3O A;  3UTB B;  3REK A;  5GT3 C;  3W97 B;  3MGR A;  4EO5 C;  4X23 A;  5B31 B;  1P3K D;  4KHA A;  3C1C A;  3AZE A;  5C3I C;  3REJ A;  2JCH A;  5B2J A;  5AVB D;  3C1B D;  2Y2P A;  3WTP C;  4J8U A;  1U35 B;  4WU8 C;  5BO0 B;  5B1M D;  3UTA A;  3KFU G;  5DNM C;  2HUE B;  1M1A D;  3AZJ B;  2FJ7 B;  2IO5 C;  5B32 B;  5GT0 A;  4Z5T D;  5BS7 C;  4Z66 A;  1Z2C B;  5B2I A;  5GSU C;  1P3K B;  3AZL C;  1P3P C;  1WWS A;  1BH8 B;  5AV8 D;  5AVB B;  4YS3 D;  1P34 D;  2J8P A;  3EG5 B;  3AZN C;  5B1M B;  5AY8 A;  5B31 C;  3LZ1 C;  1M1A B;  3AZH A;  4Z5T B;  1U35 C;  5KDM A;  5AV8 B;  2NQB D;  1B6W A;  3B0D C;  3AZJ C;  4YS3 B;  3X1U A;  2ARO A;  4Z2M G;  3W98 A;  1P34 B;  5B32 C;  5AV6 C;  2PYO D;  3AZM A;  3AN2 D;  3A6N C;  5BNV B;  1P3K C;  3B6F D;  3X1S C;  5AVC D;  1M19 A;  3C1B C;  1HQ3 A;  2RIQ A;  4LD9 D;  1P3M C;  3A1K A;  5FUG B;  4H9P A;  4M6B A;  2NQB B;  3W99 D;  5G49 A;  1TZY B;  5JA4 B;  4Z5T C;  2PYO B;  5CPJ D;  3AN2 B;  4H9S C;  4HGA C;  3MNN A;  3B6F B;  5F99 D;  1F66 A;  4H9O B;  1P3G D;  5AVC B;  5AV9 C;  4YS3 C;  3O62 C;  4LD9 B;  1KU5 A;  3MVD D;  3W99 B;  1N1J B;  5DNN D;  3LEL D;  2Y2K A;  2NZD D;  2JE5 A;  5GXQ B;  3AV2 C;  4JJN A;  3WAA A;  1KX3 A;  1P3G B;  2NQB C;  1P3F B;  1KX4 A;  5GT3 D;  4XZQ A;  3AZK D;  1P3L C;  2PYO C;  3MGP A;  1ZLA A;  3AN2 C;  3X1T C;  3MVD B;  3B6F C;  5CPK D;  2DF4 C;  5DNN B;  3KWQ D;  3LEL B;  3AV1 C;  2F8N G;  4DQY B;  4NFT A;  1P3I A;  5AVC C;  3REL A;  3V9R A;  5B33 C;  2NZD B;  4H9R A;  3KXB C;  5B24 A;  4J8V A;  2FFF B;  2G5I C;  3AFA C;  2Y2J A;  2HIO A;  3W99 C;  2BYK B;  3REH D;  5GT3 B;  2CV5 D;  4EO5 B;  3AZK B;  5GSU D;  4J8W A;  3AZL D;  5CPJ C;  3KWQ B;  3AZI A;  2L5A A;  5F99 C;  1P3G C;  1ULY A;  5B0Y D;  2ZM5 A;  3AZN D;  3AZF D;  2DQN C;  3WKJ D;  4KGC D;  1ID3 A;  4J8X A;  3LZ1 D;  5B40 A;  1M18 A;  2Y2Q A;  4X23 D;  5B1L C;  3REH B;  3REI A;  2CV5 B;  3WA9 A;  2BYM A;  2NZD C;  5GSU B;  2YFW B;  3AZL B;  5JRG A;  4UUZ A;  4J8U D;  3X1V A;  5B0Z A;  4R8P C;  3TU4 A;  5AV6 D;  5B0Y B;  4WNN A;  3AZN B;  3AZF B;  3WKJ B;  4KGC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...