3A6NB

The nucleosome containing a testis-specific histone variant, human h3t
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
81
structure length
81
Chain Sequence
LRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1t
publication title Structural basis of instability of the nucleosome containing a testis-specific histone variant, human H3T
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 26
structure length 81
sequence length 81
chains with identical sequence F
ec nomenclature
pdb deposition date 2009-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3a6nB00
2CWEA 3B0DC 3REJD 5B24B 3AZGC 3AFAB 1S32C 4KUDC 3WA9B 5DNNB 4ZUXA 3KUYB 4H9RB 4EO5B 2F8NG 4Z66B 3LZ1C 1KX5D 4G92B 3LZ0A 3AZEB 1KX3D 4WV4B 3R45B 2AROD 4J8UA 1P3BD 4QLCC 1ID3A 5DNMC 2F8ND 4LD9A 3AZNB 5B32A 1KX4D 1JFIB 3W96C 3TU4C 3AZMD 3VH6A 4DRAA 3UT9D 1ZLAC 3AZHA 4XUJA 5JRGB 3B0DB 5B2IA 3AZGB 2F8NH 5BO0A 3X1TB 1P34C 4KUDB 1BH8A 4WU9D 3LELC 4NE3A 4J8VA 3AZLD 1AOIC 3LZ1B 3C1BA 5KDMB 1P3PA 3MVDA 1TZYC 4X23A 4WU8C 5AVBC 3WAAD 4UUZB 1TAFA 3C1CC 5B33C 4E44A 5B2JB 5AV9C 5B0YB 4H9PA 3KWQD 5E5AD 3TU4B 4HGAC 3WKJB 2FJ7C 3MGPD 2NZDC 1N1JA 4J8WC 5GSUB 3NQUB 1P34B 3O62A 3NQJB 1P3OC 4YS3B 5B1LA 3LELB 4JJNA 3WTPA 3REID 4J8VD 3AN2D 1AOIB 5AY8D 5B31C 3C1BD 5AV6C 3X1SD 3X1UD 4YM6A 5AVBB 2IO5B 5B1MC 5AV8A 1P3LC 5FUGA 5AV5D 4XZQA 5GT3C 3C1CB 3AZIA 1P3AD 1P3KA 3REHA 3UTAB 5CPIC 3AV1D 1EQZD 1BH9A 5CP6B 1HQ3C 3MGRC 4HGAB 4E45A 2CV5B 3MGSD 2NZDB 1KX5C 2BYMB 1P3OB 4QLCA 1KX3C 5DNMA 3AZJA 4Z5TD 1P3IA 3WTPD 1P3BC 5GT0A 3KXBD 3MNNC 3LJAC 3W96A 3W98D 3VH5A 3A6ND 5B1MB 1P3LB 1KX4C 1ZLAA 5GT3B 3RELC 5JA4B 3AZID 4M6BA 3UT9C 1HQ3B 4ZBJC 3REJB 4NFTA 4WU9C 1R4VA 1TZYA 5GXQA 4WU8A 4KHAB 1KX5B 3B6FD 1KX3B 5AVCA 3AV2A 2AROB 1P3BB 3WAAC 5GT0D 5AV9A 2F8NB 3REKC 1F66D 1WWIA 3VH6W 4R8PA 1KX4B 3AYWA 3KWQC 2FJ7A 3RELB 5E5AC 3AZMB 3W99D 3WA9C 2YFVB 3UT9B 1P3FA 3UTBD 3MGPC 4H9NA 3KUYC 5CPKD 2PYOD 4EO5C 4G92C 5F99A 4ZBJB 3AZEC 5B31A 1ULYA 4WU9B 5AV6A 1P3GD 3REIC 3AN2C 3AZLB 3WTPE 3X1SC 3B0CW 3W97C 3X1VD 3WAAB 1M19A 1P3AC 2NQBD 3MGRA 5BS7C 3AV1C 5JRGC 3KWQB 1P3MD 5E5AB 3X1TC 5BT1D 3V9RB 1HTAA 2HIOA 3MGPB 1P3FD 5G49B 3MGSC 3MGQD 3AZFC 5F99D 4KGCA 3MNNA 3LJAA 3REIB 2YFWA 4Z5TC 4J8VB 3AN2B 5BNVB 5AY8B 3KXBC 3C1BB 3AZKA 3X1UB 3X1SB 3W98C 5B2JC 3A6NC 3W97B 5B40A 5B0YC 5AV5B 3WKJC 5B0ZA 1P3AB 4J8XD 3AV1B 1U35D 1EQZB 1M18A 5GSUC 1F1EA 4CSRA 3B6GA 4YS3C 5CPJC 4ZUXD 3MGSB 3AZFB 3LZ0D 5B32G 3VH5W 2IO5C 4H9QB 4J8UD 4Z5TB 3WTPB 1ID3D 3KXBB 4LD9D 3UTAC 3W98B 4WNNB 5B32D 3A6NB 5B24A 3AFAA 5CP6C 3WA9A 5DNNA 4CAYB 4H9RA 3AZIB 4Z66A 2CV5C 3AZHD 4XUJD 3R45A 3UTBC 5CPKC 2PYOC 1M18D 5B2ID 5CPJB 3AZNA 1M1AA 1P3GC 1JFIA 1P3PD 3MVDD 4X23D 3B6FB 1Q9CA 3X1VC 5BS7A 5GT0B 5JRGA 1F66B 3AZGA 1S32A 4KUDA 2NQBC 3X1TA 4H9OB 3REJC 3LZ1A 5KDMA 3W99B 3UTBB 5CPKB 2PYOB 3MGQC 4UUZA 3O62D 5B1LD 4DRBA 4JJND 2AROC 1P3GB 5B2JA 1M1AD 5B0YA 4YM6D 3TU4A 3WKJA 5AV8D 3X1VB 4XZQD 3AZMC 1P3KD 3REHD 4NE5A 2NQBB 5GSUA 3NQUA 4J8XC 3AZGD 2RVQD 1S32D 1P34A 3NQJA 1U35C 4YS3A 3LELA 1P3MB 1AOIA 1H3OB 1P3FB 5AVBA 3AZLC 3MGQB 5F99B 4QLCD 3LZ0C 3C1CA 5B33A 5DNMD 3AZJD 2BYKB 3UTAA 1P3ID 5BNXB 3W96D 4LD9C 5B32C 2CV5A 1ZLAD 2NZDA 4J8WA 4J8XB 2BYMA 1P3OA 1U35B 3AZHC 1TZYD 5GXQD 4WU8D 4J8VC 5B1MA 4ZUXB 5CHLB 1P3LA 5AY8C 3C1BC 1P3PC 3X1UC 3LZ0B 5GT3A 4AWLB 5AVCD 5JA4A 5B33D 5CPIA 3AV2D 4J8UB 5AV5C 5AV9D 1HQ3A 1ID3B 4LD9B 1A7WA 1WWSA 5B32B 4R8PD 3REJA 1EQZC 3AYWD 2FJ7D 5B31G 4J8WD 4KHAA 1KX5A 3VH5T 1KX3A 3B0BA 3AZHB 4XUJB 1M18B 2AROA 4H9SC 5B2IB 1P3BA 5BO0B 5B31D 3O62C 1BH8B 5AV6D 2F8NA 4JJNC 3WTPC 1KX4A 1P3PB 3MVDB 4X23B 3RELA 4YM6C 3AZMA 1BFMA 5CPID 2YFVA 3UT9A 1TAFB 2HUEC 4XZQC 1M19D 3AZIC 1P3KC 3REHC 3MGRD 2RVQC 4H9PB 4WU9A 4G91B 3AZLA 2HIOD 1N1JB 3WAAA 4KGCD 3B6FC 3O62B 3MNND 5B1LB 3LJAD 3REKA 3AZJC 4WZSB 4JJNB 1P3IC 1M1AB 5GT0C 3AZKD 1B67A 3KWQA 1KU5A 1F66C 4YM6B 5E5AA 3RELD 5B40D 5AV8B 3V9RA 5FUGB 2HUEB 4XZQB 3MGPA 3KUYA 5B0ZD 5G49A 1P3KB 3REHB 3W99C 3AZEA 1S32B 1BH9B 3REIA 3AN2A 3B6GD 5BNVA 5AY8A 3X1UA 3X1SA 5GXQC 3W97A 5AV5A 4QLCB 5AVCC 1P3AA 5DNMB 3AZJB 3REKD 4NE6A 3AV2C 1P3IB 4Z2MG 3AV1A 1EQZA 3W96B 5B24D 3AFAD 4R8PC 3WA9D 5DNND 3AYWC 2L5AA 1P3MC 1ZLAB 3KUYD 3MGSA 5BT1C 4Z66D 3AZFA 4H9SA 3AZED 1P3FC 4H9QA 4Z5TA 5F99C 3VH6T 3KXBA 3AZND 3W98A 1TZYB 4WNNA 5GXQB 3A6NA 4WU8B 3W97D 4Z2MH 5C3IC 4CAYA 5AVCB 5B33B 3AV2B 1B6WA 5JRGD 5AV9B 1M19C 4KUDD 3X1TD 4R8PB 3AYWB 5CPJA 2FJ7B 2JSSA 3LZ1D 4J8WB 3AZFD 3B0CT 3B6FA 2HIOC 4H9NB 4ZUXC 4AWLC 2LY8A 4KGCC 5B31B 5AV6B 1F66A 4J8UC 5B2JD 2F8NK 5CP6A 4H9OA 1ID3C 5B0YD 5C3IB 3AZKC 3TU4D 3WKJD 5B40C 5CPIB 3W99A 3UTBA 5CPKA 2PYOA 5B0ZC 1M19B 5GSUD 3MGRB 1P34D 4YS3D 4XUJC 3LELD 5CPJD 1M18C 5B2IC 1P3GA 1AOID 3B6GC 2HIOB 5AVBD 3MVDC 3X1VA 4X23C 3C1CD 4KGCB 3MNNB 3LJAB 3UTAD 2NQBA 2YFWB 5CP6D 3AZKB 1P3MA 1H3OA 5B24C 5B40B 3AFAC 2CV5D 4G91C 5DNNC 2NZDD 5B0ZB 3MGQA 4Z66C 1P3OD 2BYKA 4CSRB 3B6GB 5BNXA 5B1LC 3AZNC 1M1AC 5B1MD 1P3LD 5GT3D 3KSYA 5AV8C 3REKB 4J8XA 1U35A 1HQ3D
chains in the Genus database with same CATH superfamily
3H0LC 2CWEA 1PZRA 3B0DC 5B24B 3REJD 3AFAB 3AZGC 1S32C 4KUDC 3WA9B 5DNNB 4ZUXA 3KUYB 4H9RB 4EO5B 2F8NG 4Z66B 3LZ1C 1KX5D 4G92B 3LZ0A 2ZY4A 3AZEB 1KX3D 4WV4B 3R45B 2AROD 4J8UA 1P3BD 4QLCC 1ID3A 5DNMC 2F8ND 4LD9A 3AZNB 5B32A 1KX4D 1JFIB 3A1KA 3W96C 3TU4C 3AZMD 3VH6A 4DRAA 3UT9D 1ZLAC 3AZHA 4XUJA 5JRGB 3B0DB 5B2IA 3AZGB 2F8NH 5BO0A 3X1TB 1P34C 4KUDB 1BH8A 4WU9D 3LELC 4NE3A 4J8VA 3AZLD 1AOIC 3LZ1B 3C1BA 5KDMB 1P3PA 3MVDA 1TZYC 2J8PA 4X23A 4WU8C 5AVBC 2W8SA 3WAAD 4UUZB 1TAFA 2ZY3A 3C1CC 5B33C 4E44A 5B2JB 5AV9C 5B0YB 4H9PA 3KWQD 5E5AD 3TU4B 4HGAC 3WKJB 2FJ7C 3MGPD 2NZDC 1N1JA 4J8WC 2ZY5A 5GSUB 3NQUB 1P34B 3O62A 3NQJB 1P3OC 4YS3B 5B1LA 3LELB 4JJNA 3WTPA 2ZM5A 4J8VD 3REID 3AN2D 1AOIB 5AY8D 5B31C 3C1BD 5AV6C 3X1SD 3X1UD 4YM6A 5AVBB 2IO5B 5B1MC 5AV8A 1P3LC 5FUGA 5AV5D 4XZQA 5GT3C 3C1CB 3AZIA 1P3AD 1P3KA 3REHA 3UTAB 5CPIC 2JCHA 3AV1D 1EQZD 1BH9A 5CP6B 1HQ3C 3MGRC 4HGAB 4E45A 2CV5B 3MGSD 2NZDB 1KX5C 2BYMB 1P3OB 1T3UA 4QLCA 2BG1A 1KX3C 5DNMA 3AZJA 4Z5TD 1P3IA 3WTPD 1P3BC 5GT0A 3KXBD 3MNNC 3LJAC 3W96A 3W98D 3VH5A 3A6ND 2Y2NA 5B1MB 1P3LB 1KX4C 1ZLAA 5GT3B 3RELC 5JA4B 3AZID 4M6BA 3UT9C 1HQ3B 3F6TA 3H0MC 4ZBJC 3EG5B 3REJB 4NFTA 4WU9C 1R4VA 1TZYA 5GXQA 4WU8A 4KHAB 1KX5B 3B6FD 1KX3B 5AVCA 3AV2A 2AROB 1P3BB 3WAAC 2Y2QA 5GT0D 5AV9A 2F8NB 3REKC 1F66D 3FDDA 1WWIA 3VH6W 4R8PA 1KX4B 3AYWA 3KWQC 2FJ7A 3RELB 5E5AC 3AZMB 3W99D 3WA9C 2JE5A 2YFVB 3UT9B 1P3FA 3UTBD 3MGPC 4H9NA 3KUYC 5CPKD 2PYOD 4EO5C 4G92C 5F99A 4ZBJB 3AZEC 5B31A 1ULYA 2XD1A 4WU9B 5AV6A 1P3GD 3REIC 3AN2C 3AZLB 3EPKA 3WTPE 3X1SC 3B0CW 3W97C 3X1VD 3WAAB 1M19A 1P3AC 2NQBD 3MGRA 5BS7C 3AV1C 5JRGC 3KWQB 1P3MD 5E5AB 3X1TC 5BT1D 3V9RB 1HTAA 2HIOA 3MGPB 1P3FD 5G49B 3MGSC 3MGQD 3AZFC 5F99D 4KGCA 3MNNA 3LJAA 3REIB 2YFWA 4Z5TC 4J8VB 3AN2B 5BNVB 5AY8B 3KXBC 3C1BB 3AZKA 3X1UB 3X1SB 3W98C 5B2JC 3A6NC 3W97B 5B40A 5B0YC 5AV5B 3WKJC 5B0ZA 4DQYB 1P3AB 4J8XD 3AV1B 1U35D 1EQZB 2G5HC 1M18A 5GSUC 1F1EA 4CSRA 3B6GA 4YS3C 5CPJC 4ZUXD 3MGSB 3AZFB 3LZ0D 2Y2HA 5B32G 3VH5W 2IO5C 4H9QB 4J8UD 4Z5TB 3WTPB 1ID3D 3P5JB 3KXBB 4LD9D 3UTAC 3W98B 4WNNB 5B32D 3A6NB 5B24A 3AFAA 5CP6C 3WA9A 5DNNA 4CAYB 4H9RA 3AZIB 4Z66A 2CV5C 3AZHD 4XUJD 3R45A 3UTBC 5CPKC 2PYOC 1M18D 5B2ID 5CPJB 3AZNA 1M1AA 1P3GC 1JFIA 1P3PD 3MVDD 4X23D 3B6FB 1Q9CA 3X1VC 5BS7A 5GT0B 5JRGA 3IP4C 1F66B 3AZGA 1S32A 4KUDA 2NQBC 3X1TA 4H9OB 3REJC 3LZ1A 5KDMA 3W99B 3UTBB 5CPKB 2PYOB 3MGQC 4UUZA 3O62D 5B1LD 4DRBA 4JJND 2AROC 1P3GB 5B2JA 1M1AD 5B0YA 4YM6D 3TU4A 3WKJA 5AV8D 3X1VB 4XZQD 2Y2PA 3AZMC 3REHD 4NE5A 1P3KD 2NQBB 5GSUA 3NQUA 4J8XC 3AZGD 2RVQD 1S32D 1P34A 3NQJA 1U35C 4YS3A 3AL0C 3LELA 1P3MB 1AOIA 1H3OB 2Y2OA 1P3FB 5AVBA 3AZLC 3MGQB 5F99B 4QLCD 3LZ0C 2ZY2A 3C1CA 5B33A 5DNMD 3AZJD 2BYKB 3UTAA 1P3ID 5BNXB 3W96D 4LD9C 5B32C 2Y2KA 2CV5A 1ZLAD 2Y2JA 2Y2IA 2NZDA 4J8WA 2UWXA 4J8XB 2BYMA 1P3OA 1U35B 3AZHC 1TZYD 5GXQD 4WU8D 4J8VC 5B1MA 4ZUXB 5CHLB 1P3LA 5AY8C 3C1BC 1P3PC 3X1UC 3LZ0B 5GT3A 4AWLB 5AVCD 5JA4A 5B33D 5CPIA 3AV2D 4J8UB 5AV5C 5AV9D 1HQ3A 1ID3B 4LD9B 1A7WA 1WWSA 5B32B 4R8PD 3REJA 2Y2MA 1EQZC 3AYWD 2FJ7D 5B31G 4J8WD 2G5IC 4KHAA 1KX5A 3VH5T 1KX3A 3B0BA 3AZHB 4XUJB 1M18B 2AROA 4H9SC 5B2IB 3EPJA 1P3BA 2VQRA 5BO0B 5B31D 3O62C 1BH8B 5AV6D 2F8NA 4JJNC 3WTPC 1KX4A 1P3PB 3MVDB 4X23B 3RELA 4YM6C 3AZMA 1BFMA 5CPID 2YFVA 3UT9A 1TAFB 2HUEC 4XZQC 1M19D 3AZIC 1P3KC 2DF4C 3MGRD 3REHC 2RVQC 4H9PB 4WU9A 2RIQA 4G91B 3AZLA 2HIOD 1N1JB 3WAAA 4KGCD 3B6FC 3O62B 3MNND 3EPLA 5B1LB 3LJAD 3REKA 3AZJC 4WZSB 4JJNB 1P3IC 1M1AB 5GT0C 3AZKD 1B67A 3KWQA 1KU5A 1F66C 4YM6B 5E5AA 3RELD 5B40D 5AV8B 3V9RA 5FUGB 2HUEB 4XZQB 3MGPA 3KUYA 5B0ZD 5G49A 1P3KB 3REHB 3W99C 3AZEA 1S32B 1BH9B 3REIA 3AN2A 3B6GD 5BNVA 5AY8A 3X1UA 3X1SA 5GXQC 3W97A 3H0RC 5AV5A 4QLCB 4WJ3C 5AVCC 1P3AA 5DNMB 3AZJB 3REKD 2Y2LA 4NE6A 3AV2C 1P3IB 4Z2MG 3AV1A 1EQZA 3W96B 5B24D 2F2AC 4R8PC 3AFAD 3WA9D 2DQNC 5DNND 2L5AA 3AYWC 1P3MC 1ZLAB 3KUYD 3MGSA 5BT1C 4Z66D 3AZFA 4H9SA 3AZED 1P3FC 4H9QA 4Z5TA 5F99C 3VH6T 3KXBA 3AZND 3W98A 1TZYB 4WNNA 5GXQB 3A6NA 4WU8B 3W97D 4Z2MH 5C3IC 4CAYA 5AVCB 5B33B 3KFUG 3AV2B 1B6WA 5JRGD 5AV9B 1M19C 4KUDD 4UPKA 3X1TD 4R8PB 3AYWB 5CPJA 2FJ7B 2JSSA 3LZ1D 4J8WB 3AZFD 3B0CT 3B6FA 2HIOC 4H9NB 4ZUXC 3EPHA 4AWLC 2LY8A 4KGCC 5B31B 5AV6B 1F66A 4J8UC 5B2JD 2F8NK 5CP6A 4H9OA 1ID3C 5B0YD 5C3IB 3AZKC 3TU4D 3WKJD 3A1IA 5B40C 5CPIB 3W99A 1Z2CB 2FFFB 3UTBA 5CPKA 2PYOA 5B0ZC 1M19B 5GSUD 3MGRB 1P34D 4YS3D 4XUJC 3LELD 5CPJD 1M18C 5B2IC 1P3GA 1AOID 3B6GC 2HIOB 5AVBD 3MVDC 3X1VA 4X23C 3C1CD 4KGCB 3MNNB 3LJAB 3UTAD 2NQBA 2YFWB 5CP6D 3AZKB 1P3MA 1H3OA 5B24C 5B40B 3AFAC 2CV5D 2Y2GA 4G91C 5DNNC 2NZDD 5B0ZB 3MGQA 4Z66C 1P3OD 2BYKA 4CSRB 3B6GB 5BNXA 5B1LC 3AZNC 1M1AC 5B1MD 1P3LD 5GT3D 1W2EA 3KSYA 5AV8C 2XD5A 3REKB 4J8XA 1U35A 1HQ3D
chains in the Genus database with same CATH topology
3H0LC 2CWEA 1PZRA 3B0DC 5B24B 3REJD 3AFAB 3AZGC 1S32C 4KUDC 3WA9B 5DNNB 4ZUXA 3KUYB 4H9RB 4EO5B 2F8NG 4Z66B 3LZ1C 1KX5D 4G92B 3LZ0A 2ZY4A 3AZEB 1KX3D 4WV4B 3R45B 2AROD 4J8UA 1P3BD 4QLCC 1ID3A 5DNMC 2F8ND 4LD9A 3AZNB 5B32A 1KX4D 1JFIB 3A1KA 3W96C 3TU4C 3AZMD 3VH6A 4DRAA 3UT9D 1ZLAC 3AZHA 4XUJA 5JRGB 3B0DB 5B2IA 3AZGB 2F8NH 5BO0A 3X1TB 1P34C 4KUDB 1BH8A 4WU9D 3LELC 4NE3A 4J8VA 3AZLD 1AOIC 3LZ1B 3C1BA 5KDMB 1P3PA 3MVDA 1TZYC 2J8PA 4X23A 4WU8C 5AVBC 2W8SA 3WAAD 4UUZB 1TAFA 2ZY3A 3C1CC 5B33C 4E44A 5B2JB 5AV9C 5B0YB 4H9PA 3KWQD 5E5AD 3TU4B 4HGAC 3WKJB 2FJ7C 3MGPD 2NZDC 1N1JA 4J8WC 2ZY5A 5GSUB 3NQUB 1P34B 3O62A 3NQJB 1P3OC 4YS3B 5B1LA 3LELB 4JJNA 3WTPA 2ZM5A 4J8VD 3REID 3AN2D 1AOIB 5AY8D 5B31C 3C1BD 5AV6C 3X1SD 3X1UD 4YM6A 5AVBB 2IO5B 5B1MC 5AV8A 1P3LC 5FUGA 5AV5D 4XZQA 5GT3C 3C1CB 3AZIA 1P3AD 1P3KA 3REHA 3UTAB 5CPIC 2JCHA 3AV1D 1EQZD 1BH9A 5CP6B 1HQ3C 3MGRC 4HGAB 4E45A 2CV5B 3MGSD 2NZDB 1KX5C 2BYMB 1P3OB 1T3UA 4QLCA 2BG1A 1KX3C 5DNMA 3AZJA 4Z5TD 1P3IA 3WTPD 1P3BC 5GT0A 3KXBD 3MNNC 3LJAC 3W96A 3W98D 3VH5A 3A6ND 2Y2NA 5B1MB 1P3LB 1KX4C 1ZLAA 5GT3B 3RELC 5JA4B 3AZID 4M6BA 3UT9C 1HQ3B 3F6TA 3H0MC 4ZBJC 3EG5B 3REJB 4NFTA 4WU9C 1R4VA 1TZYA 5GXQA 4WU8A 4KHAB 1KX5B 3B6FD 1KX3B 5AVCA 3AV2A 2AROB 1P3BB 3WAAC 2Y2QA 5GT0D 5AV9A 2F8NB 3REKC 1F66D 3FDDA 1WWIA 3VH6W 4R8PA 1KX4B 3AYWA 3KWQC 2FJ7A 3RELB 5E5AC 3AZMB 3W99D 3WA9C 2JE5A 2YFVB 3UT9B 1P3FA 3UTBD 3MGPC 4H9NA 3KUYC 5CPKD 2PYOD 4EO5C 4G92C 5F99A 4ZBJB 3AZEC 5B31A 1ULYA 2XD1A 4WU9B 5AV6A 1P3GD 3REIC 3AN2C 3AZLB 3EPKA 3WTPE 3X1SC 3B0CW 3W97C 3X1VD 3WAAB 1M19A 1P3AC 2NQBD 3MGRA 5BS7C 3AV1C 5JRGC 3KWQB 1P3MD 5E5AB 3X1TC 5BT1D 3V9RB 1HTAA 2HIOA 3MGPB 1P3FD 5G49B 3MGSC 3MGQD 3AZFC 5F99D 4KGCA 3MNNA 3LJAA 3REIB 2YFWA 4Z5TC 4J8VB 3AN2B 5BNVB 5AY8B 3KXBC 3C1BB 3AZKA 3X1UB 3X1SB 3W98C 5B2JC 3A6NC 3W97B 5B40A 5B0YC 5AV5B 3WKJC 5B0ZA 4DQYB 1P3AB 4J8XD 3AV1B 1U35D 1EQZB 2G5HC 1M18A 5GSUC 1F1EA 4CSRA 3B6GA 4YS3C 5CPJC 4ZUXD 3MGSB 3AZFB 3LZ0D 2Y2HA 5B32G 3VH5W 2IO5C 4H9QB 4J8UD 4Z5TB 3WTPB 1ID3D 3P5JB 3KXBB 4LD9D 3UTAC 3W98B 4WNNB 5B32D 3A6NB 5B24A 3AFAA 5CP6C 3WA9A 5DNNA 4CAYB 4H9RA 3AZIB 4Z66A 2CV5C 3AZHD 4XUJD 3R45A 3UTBC 5CPKC 2PYOC 1M18D 5B2ID 5CPJB 3AZNA 1M1AA 1P3GC 1JFIA 1P3PD 3MVDD 4X23D 3B6FB 1Q9CA 3X1VC 5BS7A 5GT0B 5JRGA 3IP4C 1F66B 3AZGA 1S32A 4KUDA 2NQBC 3X1TA 4H9OB 3REJC 3LZ1A 5KDMA 3W99B 3UTBB 5CPKB 2PYOB 3MGQC 4UUZA 3O62D 5B1LD 4DRBA 4JJND 2AROC 1P3GB 5B2JA 1M1AD 5B0YA 4YM6D 3TU4A 3WKJA 5AV8D 3X1VB 4XZQD 2Y2PA 3AZMC 3REHD 4NE5A 1P3KD 2NQBB 5GSUA 3NQUA 4J8XC 3AZGD 2RVQD 1S32D 1P34A 3NQJA 1U35C 4YS3A 3AL0C 3LELA 1P3MB 1AOIA 1H3OB 2Y2OA 1P3FB 5AVBA 3AZLC 3MGQB 5F99B 4QLCD 3LZ0C 2ZY2A 3C1CA 5B33A 5DNMD 3AZJD 2BYKB 3UTAA 1P3ID 5BNXB 3W96D 4LD9C 5B32C 2Y2KA 2CV5A 1ZLAD 2Y2JA 2Y2IA 2NZDA 4J8WA 2UWXA 4J8XB 2BYMA 1P3OA 1U35B 3AZHC 1TZYD 5GXQD 4WU8D 4J8VC 5B1MA 4ZUXB 5CHLB 1P3LA 5AY8C 3C1BC 1P3PC 3X1UC 3LZ0B 5GT3A 4AWLB 5AVCD 5JA4A 5B33D 5CPIA 3AV2D 4J8UB 5AV5C 5AV9D 1HQ3A 1ID3B 4LD9B 1A7WA 1WWSA 5B32B 4R8PD 3REJA 2Y2MA 1EQZC 3AYWD 2FJ7D 5B31G 4J8WD 2G5IC 4KHAA 1KX5A 3VH5T 1KX3A 3B0BA 3AZHB 4XUJB 1M18B 2AROA 4H9SC 5B2IB 3EPJA 1P3BA 2VQRA 5BO0B 5B31D 3O62C 1BH8B 5AV6D 2F8NA 4JJNC 3WTPC 1KX4A 1P3PB 3MVDB 4X23B 3RELA 4YM6C 3AZMA 1BFMA 5CPID 2YFVA 3UT9A 1TAFB 2HUEC 4XZQC 1M19D 3AZIC 1P3KC 2DF4C 3MGRD 3REHC 2RVQC 4H9PB 4WU9A 2RIQA 4G91B 3AZLA 2HIOD 1N1JB 3WAAA 4KGCD 3B6FC 3O62B 3MNND 3EPLA 5B1LB 3LJAD 3REKA 3AZJC 4WZSB 4JJNB 1P3IC 1M1AB 5GT0C 3AZKD 1B67A 3KWQA 1KU5A 1F66C 4YM6B 5E5AA 3RELD 5B40D 5AV8B 3V9RA 5FUGB 2HUEB 4XZQB 3MGPA 3KUYA 5B0ZD 5G49A 1P3KB 3REHB 3W99C 3AZEA 1S32B 1BH9B 3REIA 3AN2A 3B6GD 5BNVA 5AY8A 3X1UA 3X1SA 5GXQC 3W97A 3H0RC 5AV5A 4QLCB 4WJ3C 5AVCC 1P3AA 5DNMB 3AZJB 3REKD 2Y2LA 4NE6A 3AV2C 1P3IB 4Z2MG 3AV1A 1EQZA 3W96B 5B24D 2F2AC 4R8PC 3AFAD 3WA9D 2DQNC 5DNND 2L5AA 3AYWC 1P3MC 1ZLAB 3KUYD 3MGSA 5BT1C 4Z66D 3AZFA 4H9SA 3AZED 1P3FC 4H9QA 4Z5TA 5F99C 3VH6T 3KXBA 3AZND 3W98A 1TZYB 4WNNA 5GXQB 3A6NA 4WU8B 3W97D 4Z2MH 5C3IC 4CAYA 5AVCB 5B33B 3KFUG 3AV2B 1B6WA 5JRGD 5AV9B 1M19C 4KUDD 4UPKA 3X1TD 4R8PB 3AYWB 5CPJA 2FJ7B 2JSSA 3LZ1D 4J8WB 3AZFD 3B0CT 3B6FA 2HIOC 4H9NB 4ZUXC 3EPHA 4AWLC 2LY8A 4KGCC 5B31B 5AV6B 1F66A 4J8UC 5B2JD 2F8NK 5CP6A 4H9OA 1ID3C 5B0YD 5C3IB 3AZKC 3TU4D 3WKJD 3A1IA 5B40C 5CPIB 3W99A 1Z2CB 2FFFB 3UTBA 5CPKA 2PYOA 5B0ZC 1M19B 5GSUD 3MGRB 1P34D 4YS3D 4XUJC 3LELD 5CPJD 1M18C 5B2IC 1P3GA 1AOID 3B6GC 2HIOB 5AVBD 3MVDC 3X1VA 4X23C 3C1CD 4KGCB 3MNNB 3LJAB 3UTAD 2NQBA 2YFWB 5CP6D 3AZKB 1P3MA 1H3OA 5B24C 5B40B 3AFAC 2CV5D 2Y2GA 4G91C 5DNNC 2NZDD 5B0ZB 3MGQA 4Z66C 1P3OD 2BYKA 4CSRB 3B6GB 5BNXA 5B1LC 3AZNC 1M1AC 5B1MD 1P3LD 5GT3D 1W2EA 3KSYA 5AV8C 2XD5A 3REKB 4J8XA 1U35A 1HQ3D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CWE A;  3B0D C;  3REJ D;  5B24 B;  3AZG C;  3AFA B;  1S32 C;  4KUD C;  3WA9 B;  5DNN B;  4ZUX A;  3KUY B;  4H9R B;  4EO5 B;  2F8N G;  4Z66 B;  3LZ1 C;  1KX5 D;  4G92 B;  3LZ0 A;  3AZE B;  1KX3 D;  4WV4 B;  3R45 B;  2ARO D;  4J8U A;  1P3B D;  4QLC C;  1ID3 A;  5DNM C;  2F8N D;  4LD9 A;  3AZN B;  5B32 A;  1KX4 D;  1JFI B;  3W96 C;  3TU4 C;  3AZM D;  3VH6 A;  4DRA A;  3UT9 D;  1ZLA C;  3AZH A;  4XUJ A;  5JRG B;  3B0D B;  5B2I A;  3AZG B;  2F8N H;  5BO0 A;  3X1T B;  1P34 C;  4KUD B;  1BH8 A;  4WU9 D;  3LEL C;  4NE3 A;  4J8V A;  3AZL D;  1AOI C;  3LZ1 B;  3C1B A;  5KDM B;  1P3P A;  3MVD A;  1TZY C;  4X23 A;  4WU8 C;  5AVB C;  3WAA D;  4UUZ B;  1TAF A;  3C1C C;  5B33 C;  4E44 A;  5B2J B;  5AV9 C;  5B0Y B;  4H9P A;  3KWQ D;  5E5A D;  3TU4 B;  4HGA C;  3WKJ B;  2FJ7 C;  3MGP D;  2NZD C;  1N1J A;  4J8W C;  5GSU B;  3NQU B;  1P34 B;  3O62 A;  3NQJ B;  1P3O C;  4YS3 B;  5B1L A;  3LEL B;  4JJN A;  3WTP A;  3REI D;  4J8V D;  3AN2 D;  1AOI B;  5AY8 D;  5B31 C;  3C1B D;  5AV6 C;  3X1S D;  3X1U D;  4YM6 A;  5AVB B;  2IO5 B;  5B1M C;  5AV8 A;  1P3L C;  5FUG A;  5AV5 D;  4XZQ A;  5GT3 C;  3C1C B;  3AZI A;  1P3A D;  1P3K A;  3REH A;  3UTA B;  5CPI C;  3AV1 D;  1EQZ D;  1BH9 A;  5CP6 B;  1HQ3 C;  3MGR C;  4HGA B;  4E45 A;  2CV5 B;  3MGS D;  2NZD B;  1KX5 C;  2BYM B;  1P3O B;  4QLC A;  1KX3 C;  5DNM A;  3AZJ A;  4Z5T D;  1P3I A;  3WTP D;  1P3B C;  5GT0 A;  3KXB D;  3MNN C;  3LJA C;  3W96 A;  3W98 D;  3VH5 A;  3A6N D;  5B1M B;  1P3L B;  1KX4 C;  1ZLA A;  5GT3 B;  3REL C;  5JA4 B;  3AZI D;  4M6B A;  3UT9 C;  1HQ3 B;  4ZBJ C;  3REJ B;  4NFT A;  4WU9 C;  1R4V A;  1TZY A;  5GXQ A;  4WU8 A;  4KHA B;  1KX5 B;  3B6F D;  1KX3 B;  5AVC A;  3AV2 A;  2ARO B;  1P3B B;  3WAA C;  5GT0 D;  5AV9 A;  2F8N B;  3REK C;  1F66 D;  1WWI A;  3VH6 W;  4R8P A;  1KX4 B;  3AYW A;  3KWQ C;  2FJ7 A;  3REL B;  5E5A C;  3AZM B;  3W99 D;  3WA9 C;  2YFV B;  3UT9 B;  1P3F A;  3UTB D;  3MGP C;  4H9N A;  3KUY C;  5CPK D;  2PYO D;  4EO5 C;  4G92 C;  5F99 A;  4ZBJ B;  3AZE C;  5B31 A;  1ULY A;  4WU9 B;  5AV6 A;  1P3G D;  3REI C;  3AN2 C;  3AZL B;  3WTP E;  3X1S C;  3B0C W;  3W97 C;  3X1V D;  3WAA B;  1M19 A;  1P3A C;  2NQB D;  3MGR A;  5BS7 C;  3AV1 C;  5JRG C;  3KWQ B;  1P3M D;  5E5A B;  3X1T C;  5BT1 D;  3V9R B;  1HTA A;  2HIO A;  3MGP B;  1P3F D;  5G49 B;  3MGS C;  3MGQ D;  3AZF C;  5F99 D;  4KGC A;  3MNN A;  3LJA A;  3REI B;  2YFW A;  4Z5T C;  4J8V B;  3AN2 B;  5BNV B;  5AY8 B;  3KXB C;  3C1B B;  3AZK A;  3X1U B;  3X1S B;  3W98 C;  5B2J C;  3A6N C;  3W97 B;  5B40 A;  5B0Y C;  5AV5 B;  3WKJ C;  5B0Z A;  1P3A B;  4J8X D;  3AV1 B;  1U35 D;  1EQZ B;  1M18 A;  5GSU C;  1F1E A;  4CSR A;  3B6G A;  4YS3 C;  5CPJ C;  4ZUX D;  3MGS B;  3AZF B;  3LZ0 D;  5B32 G;  3VH5 W;  2IO5 C;  4H9Q B;  4J8U D;  4Z5T B;  3WTP B;  1ID3 D;  3KXB B;  4LD9 D;  3UTA C;  3W98 B;  4WNN B;  5B32 D;  3A6N B;  5B24 A;  3AFA A;  5CP6 C;  3WA9 A;  5DNN A;  4CAY B;  4H9R A;  3AZI B;  4Z66 A;  2CV5 C;  3AZH D;  4XUJ D;  3R45 A;  3UTB C;  5CPK C;  2PYO C;  1M18 D;  5B2I D;  5CPJ B;  3AZN A;  1M1A A;  1P3G C;  1JFI A;  1P3P D;  3MVD D;  4X23 D;  3B6F B;  1Q9C A;  3X1V C;  5BS7 A;  5GT0 B;  5JRG A;  1F66 B;  3AZG A;  1S32 A;  4KUD A;  2NQB C;  3X1T A;  4H9O B;  3REJ C;  3LZ1 A;  5KDM A;  3W99 B;  3UTB B;  5CPK B;  2PYO B;  3MGQ C;  4UUZ A;  3O62 D;  5B1L D;  4DRB A;  4JJN D;  2ARO C;  1P3G B;  5B2J A;  1M1A D;  5B0Y A;  4YM6 D;  3TU4 A;  3WKJ A;  5AV8 D;  3X1V B;  4XZQ D;  3AZM C;  1P3K D;  3REH D;  4NE5 A;  2NQB B;  5GSU A;  3NQU A;  4J8X C;  3AZG D;  2RVQ D;  1S32 D;  1P34 A;  3NQJ A;  1U35 C;  4YS3 A;  3LEL A;  1P3M B;  1AOI A;  1H3O B;  1P3F B;  5AVB A;  3AZL C;  3MGQ B;  5F99 B;  4QLC D;  3LZ0 C;  3C1C A;  5B33 A;  5DNM D;  3AZJ D;  2BYK B;  3UTA A;  1P3I D;  5BNX B;  3W96 D;  4LD9 C;  5B32 C;  2CV5 A;  1ZLA D;  2NZD A;  4J8W A;  4J8X B;  2BYM A;  1P3O A;  1U35 B;  3AZH C;  1TZY D;  5GXQ D;  4WU8 D;  4J8V C;  5B1M A;  4ZUX B;  5CHL B;  1P3L A;  5AY8 C;  3C1B C;  1P3P C;  3X1U C;  3LZ0 B;  5GT3 A;  4AWL B;  5AVC D;  5JA4 A;  5B33 D;  5CPI A;  3AV2 D;  4J8U B;  5AV5 C;  5AV9 D;  1HQ3 A;  1ID3 B;  4LD9 B;  1A7W A;  1WWS A;  5B32 B;  4R8P D;  3REJ A;  1EQZ C;  3AYW D;  2FJ7 D;  5B31 G;  4J8W D;  4KHA A;  1KX5 A;  3VH5 T;  1KX3 A;  3B0B A;  3AZH B;  4XUJ B;  1M18 B;  2ARO A;  4H9S C;  5B2I B;  1P3B A;  5BO0 B;  5B31 D;  3O62 C;  1BH8 B;  5AV6 D;  2F8N A;  4JJN C;  3WTP C;  1KX4 A;  1P3P B;  3MVD B;  4X23 B;  3REL A;  4YM6 C;  3AZM A;  1BFM A;  5CPI D;  2YFV A;  3UT9 A;  1TAF B;  2HUE C;  4XZQ C;  1M19 D;  3AZI C;  1P3K C;  3REH C;  3MGR D;  2RVQ C;  4H9P B;  4WU9 A;  4G91 B;  3AZL A;  2HIO D;  1N1J B;  3WAA A;  4KGC D;  3B6F C;  3O62 B;  3MNN D;  5B1L B;  3LJA D;  3REK A;  3AZJ C;  4WZS B;  4JJN B;  1P3I C;  1M1A B;  5GT0 C;  3AZK D;  1B67 A;  3KWQ A;  1KU5 A;  1F66 C;  4YM6 B;  5E5A A;  3REL D;  5B40 D;  5AV8 B;  3V9R A;  5FUG B;  2HUE B;  4XZQ B;  3MGP A;  3KUY A;  5B0Z D;  5G49 A;  1P3K B;  3REH B;  3W99 C;  3AZE A;  1S32 B;  1BH9 B;  3REI A;  3AN2 A;  3B6G D;  5BNV A;  5AY8 A;  3X1U A;  3X1S A;  5GXQ C;  3W97 A;  5AV5 A;  4QLC B;  5AVC C;  1P3A A;  5DNM B;  3AZJ B;  3REK D;  4NE6 A;  3AV2 C;  1P3I B;  4Z2M G;  3AV1 A;  1EQZ A;  3W96 B;  5B24 D;  3AFA D;  4R8P C;  3WA9 D;  5DNN D;  3AYW C;  2L5A A;  1P3M C;  1ZLA B;  3KUY D;  3MGS A;  5BT1 C;  4Z66 D;  3AZF A;  4H9S A;  3AZE D;  1P3F C;  4H9Q A;  4Z5T A;  5F99 C;  3VH6 T;  3KXB A;  3AZN D;  3W98 A;  1TZY B;  4WNN A;  5GXQ B;  3A6N A;  4WU8 B;  3W97 D;  4Z2M H;  5C3I C;  4CAY A;  5AVC B;  5B33 B;  3AV2 B;  1B6W A;  5JRG D;  5AV9 B;  1M19 C;  4KUD D;  3X1T D;  4R8P B;  3AYW B;  5CPJ A;  2FJ7 B;  2JSS A;  3LZ1 D;  4J8W B;  3AZF D;  3B0C T;  3B6F A;  2HIO C;  4H9N B;  4ZUX C;  4AWL C;  2LY8 A;  4KGC C;  5B31 B;  5AV6 B;  1F66 A;  4J8U C;  5B2J D;  2F8N K;  5CP6 A;  4H9O A;  1ID3 C;  5B0Y D;  5C3I B;  3AZK C;  3TU4 D;  3WKJ D;  5B40 C;  5CPI B;  3W99 A;  3UTB A;  5CPK A;  2PYO A;  5B0Z C;  1M19 B;  5GSU D;  3MGR B;  1P34 D;  4YS3 D;  4XUJ C;  3LEL D;  5CPJ D;  1M18 C;  5B2I C;  1P3G A;  1AOI D;  3B6G C;  2HIO B;  5AVB D;  3MVD C;  3X1V A;  4X23 C;  3C1C D;  4KGC B;  3MNN B;  3LJA B;  3UTA D;  2NQB A;  2YFW B;  5CP6 D;  3AZK B;  1P3M A;  1H3O A;  5B24 C;  5B40 B;  3AFA C;  2CV5 D;  4G91 C;  5DNN C;  2NZD D;  5B0Z B;  3MGQ A;  4Z66 C;  1P3O D;  2BYK A;  4CSR B;  3B6G B;  5BNX A;  5B1L C;  3AZN C;  1M1A C;  5B1M D;  1P3L D;  5GT3 D;  3KSY A;  5AV8 C;  3REK B;  4J8X A;  1U35 A;  1HQ3 D; 
#chains in the Genus database with same CATH topology
 3H0L C;  2CWE A;  1PZR A;  3B0D C;  5B24 B;  3REJ D;  3AFA B;  3AZG C;  1S32 C;  4KUD C;  3WA9 B;  5DNN B;  4ZUX A;  3KUY B;  4H9R B;  4EO5 B;  2F8N G;  4Z66 B;  3LZ1 C;  1KX5 D;  4G92 B;  3LZ0 A;  2ZY4 A;  3AZE B;  1KX3 D;  4WV4 B;  3R45 B;  2ARO D;  4J8U A;  1P3B D;  4QLC C;  1ID3 A;  5DNM C;  2F8N D;  4LD9 A;  3AZN B;  5B32 A;  1KX4 D;  1JFI B;  3A1K A;  3W96 C;  3TU4 C;  3AZM D;  3VH6 A;  4DRA A;  3UT9 D;  1ZLA C;  3AZH A;  4XUJ A;  5JRG B;  3B0D B;  5B2I A;  3AZG B;  2F8N H;  5BO0 A;  3X1T B;  1P34 C;  4KUD B;  1BH8 A;  4WU9 D;  3LEL C;  4NE3 A;  4J8V A;  3AZL D;  1AOI C;  3LZ1 B;  3C1B A;  5KDM B;  1P3P A;  3MVD A;  1TZY C;  2J8P A;  4X23 A;  4WU8 C;  5AVB C;  2W8S A;  3WAA D;  4UUZ B;  1TAF A;  2ZY3 A;  3C1C C;  5B33 C;  4E44 A;  5B2J B;  5AV9 C;  5B0Y B;  4H9P A;  3KWQ D;  5E5A D;  3TU4 B;  4HGA C;  3WKJ B;  2FJ7 C;  3MGP D;  2NZD C;  1N1J A;  4J8W C;  2ZY5 A;  5GSU B;  3NQU B;  1P34 B;  3O62 A;  3NQJ B;  1P3O C;  4YS3 B;  5B1L A;  3LEL B;  4JJN A;  3WTP A;  2ZM5 A;  4J8V D;  3REI D;  3AN2 D;  1AOI B;  5AY8 D;  5B31 C;  3C1B D;  5AV6 C;  3X1S D;  3X1U D;  4YM6 A;  5AVB B;  2IO5 B;  5B1M C;  5AV8 A;  1P3L C;  5FUG A;  5AV5 D;  4XZQ A;  5GT3 C;  3C1C B;  3AZI A;  1P3A D;  1P3K A;  3REH A;  3UTA B;  5CPI C;  2JCH A;  3AV1 D;  1EQZ D;  1BH9 A;  5CP6 B;  1HQ3 C;  3MGR C;  4HGA B;  4E45 A;  2CV5 B;  3MGS D;  2NZD B;  1KX5 C;  2BYM B;  1P3O B;  1T3U A;  4QLC A;  2BG1 A;  1KX3 C;  5DNM A;  3AZJ A;  4Z5T D;  1P3I A;  3WTP D;  1P3B C;  5GT0 A;  3KXB D;  3MNN C;  3LJA C;  3W96 A;  3W98 D;  3VH5 A;  3A6N D;  2Y2N A;  5B1M B;  1P3L B;  1KX4 C;  1ZLA A;  5GT3 B;  3REL C;  5JA4 B;  3AZI D;  4M6B A;  3UT9 C;  1HQ3 B;  3F6T A;  3H0M C;  4ZBJ C;  3EG5 B;  3REJ B;  4NFT A;  4WU9 C;  1R4V A;  1TZY A;  5GXQ A;  4WU8 A;  4KHA B;  1KX5 B;  3B6F D;  1KX3 B;  5AVC A;  3AV2 A;  2ARO B;  1P3B B;  3WAA C;  2Y2Q A;  5GT0 D;  5AV9 A;  2F8N B;  3REK C;  1F66 D;  3FDD A;  1WWI A;  3VH6 W;  4R8P A;  1KX4 B;  3AYW A;  3KWQ C;  2FJ7 A;  3REL B;  5E5A C;  3AZM B;  3W99 D;  3WA9 C;  2JE5 A;  2YFV B;  3UT9 B;  1P3F A;  3UTB D;  3MGP C;  4H9N A;  3KUY C;  5CPK D;  2PYO D;  4EO5 C;  4G92 C;  5F99 A;  4ZBJ B;  3AZE C;  5B31 A;  1ULY A;  2XD1 A;  4WU9 B;  5AV6 A;  1P3G D;  3REI C;  3AN2 C;  3AZL B;  3EPK A;  3WTP E;  3X1S C;  3B0C W;  3W97 C;  3X1V D;  3WAA B;  1M19 A;  1P3A C;  2NQB D;  3MGR A;  5BS7 C;  3AV1 C;  5JRG C;  3KWQ B;  1P3M D;  5E5A B;  3X1T C;  5BT1 D;  3V9R B;  1HTA A;  2HIO A;  3MGP B;  1P3F D;  5G49 B;  3MGS C;  3MGQ D;  3AZF C;  5F99 D;  4KGC A;  3MNN A;  3LJA A;  3REI B;  2YFW A;  4Z5T C;  4J8V B;  3AN2 B;  5BNV B;  5AY8 B;  3KXB C;  3C1B B;  3AZK A;  3X1U B;  3X1S B;  3W98 C;  5B2J C;  3A6N C;  3W97 B;  5B40 A;  5B0Y C;  5AV5 B;  3WKJ C;  5B0Z A;  4DQY B;  1P3A B;  4J8X D;  3AV1 B;  1U35 D;  1EQZ B;  2G5H C;  1M18 A;  5GSU C;  1F1E A;  4CSR A;  3B6G A;  4YS3 C;  5CPJ C;  4ZUX D;  3MGS B;  3AZF B;  3LZ0 D;  2Y2H A;  5B32 G;  3VH5 W;  2IO5 C;  4H9Q B;  4J8U D;  4Z5T B;  3WTP B;  1ID3 D;  3P5J B;  3KXB B;  4LD9 D;  3UTA C;  3W98 B;  4WNN B;  5B32 D;  3A6N B;  5B24 A;  3AFA A;  5CP6 C;  3WA9 A;  5DNN A;  4CAY B;  4H9R A;  3AZI B;  4Z66 A;  2CV5 C;  3AZH D;  4XUJ D;  3R45 A;  3UTB C;  5CPK C;  2PYO C;  1M18 D;  5B2I D;  5CPJ B;  3AZN A;  1M1A A;  1P3G C;  1JFI A;  1P3P D;  3MVD D;  4X23 D;  3B6F B;  1Q9C A;  3X1V C;  5BS7 A;  5GT0 B;  5JRG A;  3IP4 C;  1F66 B;  3AZG A;  1S32 A;  4KUD A;  2NQB C;  3X1T A;  4H9O B;  3REJ C;  3LZ1 A;  5KDM A;  3W99 B;  3UTB B;  5CPK B;  2PYO B;  3MGQ C;  4UUZ A;  3O62 D;  5B1L D;  4DRB A;  4JJN D;  2ARO C;  1P3G B;  5B2J A;  1M1A D;  5B0Y A;  4YM6 D;  3TU4 A;  3WKJ A;  5AV8 D;  3X1V B;  4XZQ D;  2Y2P A;  3AZM C;  3REH D;  4NE5 A;  1P3K D;  2NQB B;  5GSU A;  3NQU A;  4J8X C;  3AZG D;  2RVQ D;  1S32 D;  1P34 A;  3NQJ A;  1U35 C;  4YS3 A;  3AL0 C;  3LEL A;  1P3M B;  1AOI A;  1H3O B;  2Y2O A;  1P3F B;  5AVB A;  3AZL C;  3MGQ B;  5F99 B;  4QLC D;  3LZ0 C;  2ZY2 A;  3C1C A;  5B33 A;  5DNM D;  3AZJ D;  2BYK B;  3UTA A;  1P3I D;  5BNX B;  3W96 D;  4LD9 C;  5B32 C;  2Y2K A;  2CV5 A;  1ZLA D;  2Y2J A;  2Y2I A;  2NZD A;  4J8W A;  2UWX A;  4J8X B;  2BYM A;  1P3O A;  1U35 B;  3AZH C;  1TZY D;  5GXQ D;  4WU8 D;  4J8V C;  5B1M A;  4ZUX B;  5CHL B;  1P3L A;  5AY8 C;  3C1B C;  1P3P C;  3X1U C;  3LZ0 B;  5GT3 A;  4AWL B;  5AVC D;  5JA4 A;  5B33 D;  5CPI A;  3AV2 D;  4J8U B;  5AV5 C;  5AV9 D;  1HQ3 A;  1ID3 B;  4LD9 B;  1A7W A;  1WWS A;  5B32 B;  4R8P D;  3REJ A;  2Y2M A;  1EQZ C;  3AYW D;  2FJ7 D;  5B31 G;  4J8W D;  2G5I C;  4KHA A;  1KX5 A;  3VH5 T;  1KX3 A;  3B0B A;  3AZH B;  4XUJ B;  1M18 B;  2ARO A;  4H9S C;  5B2I B;  3EPJ A;  1P3B A;  2VQR A;  5BO0 B;  5B31 D;  3O62 C;  1BH8 B;  5AV6 D;  2F8N A;  4JJN C;  3WTP C;  1KX4 A;  1P3P B;  3MVD B;  4X23 B;  3REL A;  4YM6 C;  3AZM A;  1BFM A;  5CPI D;  2YFV A;  3UT9 A;  1TAF B;  2HUE C;  4XZQ C;  1M19 D;  3AZI C;  1P3K C;  2DF4 C;  3MGR D;  3REH C;  2RVQ C;  4H9P B;  4WU9 A;  2RIQ A;  4G91 B;  3AZL A;  2HIO D;  1N1J B;  3WAA A;  4KGC D;  3B6F C;  3O62 B;  3MNN D;  3EPL A;  5B1L B;  3LJA D;  3REK A;  3AZJ C;  4WZS B;  4JJN B;  1P3I C;  1M1A B;  5GT0 C;  3AZK D;  1B67 A;  3KWQ A;  1KU5 A;  1F66 C;  4YM6 B;  5E5A A;  3REL D;  5B40 D;  5AV8 B;  3V9R A;  5FUG B;  2HUE B;  4XZQ B;  3MGP A;  3KUY A;  5B0Z D;  5G49 A;  1P3K B;  3REH B;  3W99 C;  3AZE A;  1S32 B;  1BH9 B;  3REI A;  3AN2 A;  3B6G D;  5BNV A;  5AY8 A;  3X1U A;  3X1S A;  5GXQ C;  3W97 A;  3H0R C;  5AV5 A;  4QLC B;  4WJ3 C;  5AVC C;  1P3A A;  5DNM B;  3AZJ B;  3REK D;  2Y2L A;  4NE6 A;  3AV2 C;  1P3I B;  4Z2M G;  3AV1 A;  1EQZ A;  3W96 B;  5B24 D;  2F2A C;  4R8P C;  3AFA D;  3WA9 D;  2DQN C;  5DNN D;  2L5A A;  3AYW C;  1P3M C;  1ZLA B;  3KUY D;  3MGS A;  5BT1 C;  4Z66 D;  3AZF A;  4H9S A;  3AZE D;  1P3F C;  4H9Q A;  4Z5T A;  5F99 C;  3VH6 T;  3KXB A;  3AZN D;  3W98 A;  1TZY B;  4WNN A;  5GXQ B;  3A6N A;  4WU8 B;  3W97 D;  4Z2M H;  5C3I C;  4CAY A;  5AVC B;  5B33 B;  3KFU G;  3AV2 B;  1B6W A;  5JRG D;  5AV9 B;  1M19 C;  4KUD D;  4UPK A;  3X1T D;  4R8P B;  3AYW B;  5CPJ A;  2FJ7 B;  2JSS A;  3LZ1 D;  4J8W B;  3AZF D;  3B0C T;  3B6F A;  2HIO C;  4H9N B;  4ZUX C;  3EPH A;  4AWL C;  2LY8 A;  4KGC C;  5B31 B;  5AV6 B;  1F66 A;  4J8U C;  5B2J D;  2F8N K;  5CP6 A;  4H9O A;  1ID3 C;  5B0Y D;  5C3I B;  3AZK C;  3TU4 D;  3WKJ D;  3A1I A;  5B40 C;  5CPI B;  3W99 A;  1Z2C B;  2FFF B;  3UTB A;  5CPK A;  2PYO A;  5B0Z C;  1M19 B;  5GSU D;  3MGR B;  1P34 D;  4YS3 D;  4XUJ C;  3LEL D;  5CPJ D;  1M18 C;  5B2I C;  1P3G A;  1AOI D;  3B6G C;  2HIO B;  5AVB D;  3MVD C;  3X1V A;  4X23 C;  3C1C D;  4KGC B;  3MNN B;  3LJA B;  3UTA D;  2NQB A;  2YFW B;  5CP6 D;  3AZK B;  1P3M A;  1H3O A;  5B24 C;  5B40 B;  3AFA C;  2CV5 D;  2Y2G A;  4G91 C;  5DNN C;  2NZD D;  5B0Z B;  3MGQ A;  4Z66 C;  1P3O D;  2BYK A;  4CSR B;  3B6G B;  5BNX A;  5B1L C;  3AZN C;  1M1A C;  5B1M D;  1P3L D;  5GT3 D;  1W2E A;  3KSY A;  5AV8 C;  2XD5 A;  3REK B;  4J8X A;  1U35 A;  1HQ3 D; 
#chains in the Genus database with same CATH homology
 3H0L C;  2CWE A;  1PZR A;  3B0D C;  5B24 B;  3REJ D;  3AFA B;  3AZG C;  1S32 C;  4KUD C;  3WA9 B;  5DNN B;  4ZUX A;  3KUY B;  4H9R B;  4EO5 B;  2F8N G;  4Z66 B;  3LZ1 C;  1KX5 D;  4G92 B;  3LZ0 A;  2ZY4 A;  3AZE B;  1KX3 D;  4WV4 B;  3R45 B;  2ARO D;  4J8U A;  1P3B D;  4QLC C;  1ID3 A;  5DNM C;  2F8N D;  4LD9 A;  3AZN B;  5B32 A;  1KX4 D;  1JFI B;  3A1K A;  3W96 C;  3TU4 C;  3AZM D;  3VH6 A;  4DRA A;  3UT9 D;  1ZLA C;  3AZH A;  4XUJ A;  5JRG B;  3B0D B;  5B2I A;  3AZG B;  2F8N H;  5BO0 A;  3X1T B;  1P34 C;  4KUD B;  1BH8 A;  4WU9 D;  3LEL C;  4NE3 A;  4J8V A;  3AZL D;  1AOI C;  3LZ1 B;  3C1B A;  5KDM B;  1P3P A;  3MVD A;  1TZY C;  2J8P A;  4X23 A;  4WU8 C;  5AVB C;  2W8S A;  3WAA D;  4UUZ B;  1TAF A;  2ZY3 A;  3C1C C;  5B33 C;  4E44 A;  5B2J B;  5AV9 C;  5B0Y B;  4H9P A;  3KWQ D;  5E5A D;  3TU4 B;  4HGA C;  3WKJ B;  2FJ7 C;  3MGP D;  2NZD C;  1N1J A;  4J8W C;  2ZY5 A;  5GSU B;  3NQU B;  1P34 B;  3O62 A;  3NQJ B;  1P3O C;  4YS3 B;  5B1L A;  3LEL B;  4JJN A;  3WTP A;  2ZM5 A;  4J8V D;  3REI D;  3AN2 D;  1AOI B;  5AY8 D;  5B31 C;  3C1B D;  5AV6 C;  3X1S D;  3X1U D;  4YM6 A;  5AVB B;  2IO5 B;  5B1M C;  5AV8 A;  1P3L C;  5FUG A;  5AV5 D;  4XZQ A;  5GT3 C;  3C1C B;  3AZI A;  1P3A D;  1P3K A;  3REH A;  3UTA B;  5CPI C;  2JCH A;  3AV1 D;  1EQZ D;  1BH9 A;  5CP6 B;  1HQ3 C;  3MGR C;  4HGA B;  4E45 A;  2CV5 B;  3MGS D;  2NZD B;  1KX5 C;  2BYM B;  1P3O B;  1T3U A;  4QLC A;  2BG1 A;  1KX3 C;  5DNM A;  3AZJ A;  4Z5T D;  1P3I A;  3WTP D;  1P3B C;  5GT0 A;  3KXB D;  3MNN C;  3LJA C;  3W96 A;  3W98 D;  3VH5 A;  3A6N D;  2Y2N A;  5B1M B;  1P3L B;  1KX4 C;  1ZLA A;  5GT3 B;  3REL C;  5JA4 B;  3AZI D;  4M6B A;  3UT9 C;  1HQ3 B;  3F6T A;  3H0M C;  4ZBJ C;  3EG5 B;  3REJ B;  4NFT A;  4WU9 C;  1R4V A;  1TZY A;  5GXQ A;  4WU8 A;  4KHA B;  1KX5 B;  3B6F D;  1KX3 B;  5AVC A;  3AV2 A;  2ARO B;  1P3B B;  3WAA C;  2Y2Q A;  5GT0 D;  5AV9 A;  2F8N B;  3REK C;  1F66 D;  3FDD A;  1WWI A;  3VH6 W;  4R8P A;  1KX4 B;  3AYW A;  3KWQ C;  2FJ7 A;  3REL B;  5E5A C;  3AZM B;  3W99 D;  3WA9 C;  2JE5 A;  2YFV B;  3UT9 B;  1P3F A;  3UTB D;  3MGP C;  4H9N A;  3KUY C;  5CPK D;  2PYO D;  4EO5 C;  4G92 C;  5F99 A;  4ZBJ B;  3AZE C;  5B31 A;  1ULY A;  2XD1 A;  4WU9 B;  5AV6 A;  1P3G D;  3REI C;  3AN2 C;  3AZL B;  3EPK A;  3WTP E;  3X1S C;  3B0C W;  3W97 C;  3X1V D;  3WAA B;  1M19 A;  1P3A C;  2NQB D;  3MGR A;  5BS7 C;  3AV1 C;  5JRG C;  3KWQ B;  1P3M D;  5E5A B;  3X1T C;  5BT1 D;  3V9R B;  1HTA A;  2HIO A;  3MGP B;  1P3F D;  5G49 B;  3MGS C;  3MGQ D;  3AZF C;  5F99 D;  4KGC A;  3MNN A;  3LJA A;  3REI B;  2YFW A;  4Z5T C;  4J8V B;  3AN2 B;  5BNV B;  5AY8 B;  3KXB C;  3C1B B;  3AZK A;  3X1U B;  3X1S B;  3W98 C;  5B2J C;  3A6N C;  3W97 B;  5B40 A;  5B0Y C;  5AV5 B;  3WKJ C;  5B0Z A;  4DQY B;  1P3A B;  4J8X D;  3AV1 B;  1U35 D;  1EQZ B;  2G5H C;  1M18 A;  5GSU C;  1F1E A;  4CSR A;  3B6G A;  4YS3 C;  5CPJ C;  4ZUX D;  3MGS B;  3AZF B;  3LZ0 D;  2Y2H A;  5B32 G;  3VH5 W;  2IO5 C;  4H9Q B;  4J8U D;  4Z5T B;  3WTP B;  1ID3 D;  3P5J B;  3KXB B;  4LD9 D;  3UTA C;  3W98 B;  4WNN B;  5B32 D;  3A6N B;  5B24 A;  3AFA A;  5CP6 C;  3WA9 A;  5DNN A;  4CAY B;  4H9R A;  3AZI B;  4Z66 A;  2CV5 C;  3AZH D;  4XUJ D;  3R45 A;  3UTB C;  5CPK C;  2PYO C;  1M18 D;  5B2I D;  5CPJ B;  3AZN A;  1M1A A;  1P3G C;  1JFI A;  1P3P D;  3MVD D;  4X23 D;  3B6F B;  1Q9C A;  3X1V C;  5BS7 A;  5GT0 B;  5JRG A;  3IP4 C;  1F66 B;  3AZG A;  1S32 A;  4KUD A;  2NQB C;  3X1T A;  4H9O B;  3REJ C;  3LZ1 A;  5KDM A;  3W99 B;  3UTB B;  5CPK B;  2PYO B;  3MGQ C;  4UUZ A;  3O62 D;  5B1L D;  4DRB A;  4JJN D;  2ARO C;  1P3G B;  5B2J A;  1M1A D;  5B0Y A;  4YM6 D;  3TU4 A;  3WKJ A;  5AV8 D;  3X1V B;  4XZQ D;  2Y2P A;  3AZM C;  3REH D;  4NE5 A;  1P3K D;  2NQB B;  5GSU A;  3NQU A;  4J8X C;  3AZG D;  2RVQ D;  1S32 D;  1P34 A;  3NQJ A;  1U35 C;  4YS3 A;  3AL0 C;  3LEL A;  1P3M B;  1AOI A;  1H3O B;  2Y2O A;  1P3F B;  5AVB A;  3AZL C;  3MGQ B;  5F99 B;  4QLC D;  3LZ0 C;  2ZY2 A;  3C1C A;  5B33 A;  5DNM D;  3AZJ D;  2BYK B;  3UTA A;  1P3I D;  5BNX B;  3W96 D;  4LD9 C;  5B32 C;  2Y2K A;  2CV5 A;  1ZLA D;  2Y2J A;  2Y2I A;  2NZD A;  4J8W A;  2UWX A;  4J8X B;  2BYM A;  1P3O A;  1U35 B;  3AZH C;  1TZY D;  5GXQ D;  4WU8 D;  4J8V C;  5B1M A;  4ZUX B;  5CHL B;  1P3L A;  5AY8 C;  3C1B C;  1P3P C;  3X1U C;  3LZ0 B;  5GT3 A;  4AWL B;  5AVC D;  5JA4 A;  5B33 D;  5CPI A;  3AV2 D;  4J8U B;  5AV5 C;  5AV9 D;  1HQ3 A;  1ID3 B;  4LD9 B;  1A7W A;  1WWS A;  5B32 B;  4R8P D;  3REJ A;  2Y2M A;  1EQZ C;  3AYW D;  2FJ7 D;  5B31 G;  4J8W D;  2G5I C;  4KHA A;  1KX5 A;  3VH5 T;  1KX3 A;  3B0B A;  3AZH B;  4XUJ B;  1M18 B;  2ARO A;  4H9S C;  5B2I B;  3EPJ A;  1P3B A;  2VQR A;  5BO0 B;  5B31 D;  3O62 C;  1BH8 B;  5AV6 D;  2F8N A;  4JJN C;  3WTP C;  1KX4 A;  1P3P B;  3MVD B;  4X23 B;  3REL A;  4YM6 C;  3AZM A;  1BFM A;  5CPI D;  2YFV A;  3UT9 A;  1TAF B;  2HUE C;  4XZQ C;  1M19 D;  3AZI C;  1P3K C;  2DF4 C;  3MGR D;  3REH C;  2RVQ C;  4H9P B;  4WU9 A;  2RIQ A;  4G91 B;  3AZL A;  2HIO D;  1N1J B;  3WAA A;  4KGC D;  3B6F C;  3O62 B;  3MNN D;  3EPL A;  5B1L B;  3LJA D;  3REK A;  3AZJ C;  4WZS B;  4JJN B;  1P3I C;  1M1A B;  5GT0 C;  3AZK D;  1B67 A;  3KWQ A;  1KU5 A;  1F66 C;  4YM6 B;  5E5A A;  3REL D;  5B40 D;  5AV8 B;  3V9R A;  5FUG B;  2HUE B;  4XZQ B;  3MGP A;  3KUY A;  5B0Z D;  5G49 A;  1P3K B;  3REH B;  3W99 C;  3AZE A;  1S32 B;  1BH9 B;  3REI A;  3AN2 A;  3B6G D;  5BNV A;  5AY8 A;  3X1U A;  3X1S A;  5GXQ C;  3W97 A;  3H0R C;  5AV5 A;  4QLC B;  4WJ3 C;  5AVC C;  1P3A A;  5DNM B;  3AZJ B;  3REK D;  2Y2L A;  4NE6 A;  3AV2 C;  1P3I B;  4Z2M G;  3AV1 A;  1EQZ A;  3W96 B;  5B24 D;  2F2A C;  4R8P C;  3AFA D;  3WA9 D;  2DQN C;  5DNN D;  2L5A A;  3AYW C;  1P3M C;  1ZLA B;  3KUY D;  3MGS A;  5BT1 C;  4Z66 D;  3AZF A;  4H9S A;  3AZE D;  1P3F C;  4H9Q A;  4Z5T A;  5F99 C;  3VH6 T;  3KXB A;  3AZN D;  3W98 A;  1TZY B;  4WNN A;  5GXQ B;  3A6N A;  4WU8 B;  3W97 D;  4Z2M H;  5C3I C;  4CAY A;  5AVC B;  5B33 B;  3KFU G;  3AV2 B;  1B6W A;  5JRG D;  5AV9 B;  1M19 C;  4KUD D;  4UPK A;  3X1T D;  4R8P B;  3AYW B;  5CPJ A;  2FJ7 B;  2JSS A;  3LZ1 D;  4J8W B;  3AZF D;  3B0C T;  3B6F A;  2HIO C;  4H9N B;  4ZUX C;  3EPH A;  4AWL C;  2LY8 A;  4KGC C;  5B31 B;  5AV6 B;  1F66 A;  4J8U C;  5B2J D;  2F8N K;  5CP6 A;  4H9O A;  1ID3 C;  5B0Y D;  5C3I B;  3AZK C;  3TU4 D;  3WKJ D;  3A1I A;  5B40 C;  5CPI B;  3W99 A;  1Z2C B;  2FFF B;  3UTB A;  5CPK A;  2PYO A;  5B0Z C;  1M19 B;  5GSU D;  3MGR B;  1P34 D;  4YS3 D;  4XUJ C;  3LEL D;  5CPJ D;  1M18 C;  5B2I C;  1P3G A;  1AOI D;  3B6G C;  2HIO B;  5AVB D;  3MVD C;  3X1V A;  4X23 C;  3C1C D;  4KGC B;  3MNN B;  3LJA B;  3UTA D;  2NQB A;  2YFW B;  5CP6 D;  3AZK B;  1P3M A;  1H3O A;  5B24 C;  5B40 B;  3AFA C;  2CV5 D;  2Y2G A;  4G91 C;  5DNN C;  2NZD D;  5B0Z B;  3MGQ A;  4Z66 C;  1P3O D;  2BYK A;  4CSR B;  3B6G B;  5BNX A;  5B1L C;  3AZN C;  1M1A C;  5B1M D;  1P3L D;  5GT3 D;  1W2E A;  3KSY A;  5AV8 C;  2XD5 A;  3REK B;  4J8X A;  1U35 A;  1HQ3 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...