5GT3B

Crystal structure of nucleosome particle in the presence of human testis-specific histone variant, hth2b
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
81
structure length
81
Chain Sequence
LRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Structural analyses of the nucleosome complexes with human testis-specific histone variants, hTh2a and hTh2b
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 81
sequence length 81
chains with identical sequence F
ec nomenclature
pdb deposition date 2016-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5gt3B00
4Z5TB 3WAAC 5AV9A 2CV5D 2AROA 4G92B 1P3GA 3MGSB 2RVQC 3WKJB 3WAAA 1N1JB 4X23B 3LZ0B 3MNNC 1P3KA 4WU9B 4YS3C 3MGRB 1P3PB 3MNNA 4Z2MH 2NZDB 4Z5TC 2F8NG 3AZIA 4G92C 4YM6A 3AZKD 1M18B 4Z5TA 3MGSC 3WKJC 4X23C 3LZ0C 2LY8A 3O62B 3X1SC 1R4VA 3REJD 3MGSA 3WKJA 3C1CB 2YFVB 3B0BA 1N1JA 4X23A 3LZ0A 3MGRC 3AZLD 1U35B 2NZDC 1HTAA 3WA9C 1M1AB 4WU9A 3MGRA 1P3PA 2NZDA 1B67A 3LJAA 4DRAA 5GSUC 1ZLAA 3B6GB 3O62C 1KX3D 1M18A 3B6FB 5B2IB 3C1CC 1AOIB 1P3ID 2BYKB 3AZED 3AZMD 3O62A 5CP6C 1U35C 3C1CA 3RELB 2YFVA 1M1AC 1P3OD 1ID3A 1U35A 1TZYD 3WTPE 5B24C 3KXBB 3AZFD 1M1AA 5B0ZD 5B1LB 4KUDB 3LELC 3AYWD 5B40D 3B6FC 5B2IC 1AOIC 4J8VD 3B6GA 3UT9B 3AV1D 4LD9B 5B2IA 3RELC 1AOIA 1HQ3A 5B2JB 5DNMC 3RELA 1F66D 4KUDC 3KXBC 5AVCB 1JFIB 5AVBD 3AZGB 5GT0B 4KUDA 3KXBA 3KWQD 5AV5D 5B1LA 2F8NH 1P3MD 4QLCB 3UT9C 5B2JC 1P34D 3UT9A 4LD9A 2NQBB 5E5AD 3AN2C 5B2JA 5AVCC 3AZGC 3X1VB 3AV2B 1H3OB 1P3FB 3MGQB 4J8XD 5C3IC 5AVCA 4M6BA 3REHD 5BT1C 3AZGA 1JFIA 3AZJA 1KX5D 4QLCC 5GT0A 1BH8B 1EQZD 5F99D 2PYOB 3UTAB 4QLCA 3A6ND 4EO5C 5B0YB 5FUGB 5B31B 3X1VC 3AV2C 1P3FC 3MVDD 3AZHD 2NQBA 1P3LD 3X1VA 3AV2A 1H3OA 5CPJD 1P3FA 3MGQA 2YFWB 4XUJB 5AV8D 3C1BB 2PYOC 3UTAC 4Z66C 3REKD 3X1UC 1BH8A 5B0YC 2PYOA 5B31C 3WTPD 3LZ1D 4H9OB 3UTAA 3MGPB 3KSYA 5B0YA 5FUGA 5B31A 1F1EA 4G91B 4KGCB 3AZLB 2HIOD 4ZUXB 5JRGD 3REID 2YFWA 4XUJA 3C1BA 1P3BB 4KHAB 3MGPC 3AZKC 5CPID 4YS3B 4H9OA 3MGPA 1M19B 1KX3B 5CHLB 1WWSA 4G91C 3AFAD 5JA4B 3UTBD 1P3IB 4J8WD 4KGCC 3AZMB 3AZLC 5B33B 4ZUXC 3X1SB 1P3BC 4KGCA 3AZLA 5CPKB 5AY8D 4ZUXA 4WU8B 4JJND 5GT3B 3W97D 1P3BA 3AZFB 5B31G 4KHAA 1M19C 3WA9B 1KX3C 4YS3A 4E44A 5BNVB 1P3IC 2FJ7D 3AZMC 1M19A 5B33C 4ZBJB 5B32D 1KX3A 4CSRB 5GSUB 1S32D 1P3IA 5JA4A 3W98D 5CPKC 5B33A 3X1TD 4XZQB 1KX4B 4E45A 4R8PD 4WU8C 3NQUB 5GT3C 1TZYC 3X1SA 5CP6B 3AZFC 3W99D 5CPKA 4WU8A 5B40C 5GT3A 3KWQB 3AZFA 1P3MB 3WA9A 4ZBJC 3AV1C 5B24B 5BNVA 3LELB 1P34B 4XZQC 1KX4C 4CSRA 5GSUA 5AV9D 2AROD 4J8UB 4UUZB 4XZQA 1P3GD 1KX4A 3WAAD 3NQUA 5CP6A 3KWQC 5DNMB 1P3MC 1P3KD 2RVQD 1P34C 1P3MA 3MNND 5B24A 5DNNB 3LELA 3AZID 1P34A 3TU4B 4YM6D 4J8UC 3B6FA 5GXQD 4Z5TD 3MVDB 2BYKA 4J8UA 1KX5C 4UUZA 3AN2B 3MGSD 3WKJD 4H9PB 4X23D 3LZ0D 3KUYB 5DNMA 3REKB 1P3AB 5C3IB 5DNNC 5AV6B 4WU9D 2BYMB 1P3PD 3TU4C 3LZ1B 3MVDC 3AZHC 3LJAD 5DNNA 1ZLAD 4NE5A 3TU4A 1M18D 3MVDA 4EO5B 3KUYC 3AZNB 3REKC 3AN2A 4H9PA 3C1CD 1P3AC 5AV6C 3KUYA 1ID3D 3LZ1C 3REKA 1U35D 1P3AA 5AV6A 4Z66B 2BYMA 3X1UB 2CV5B 3B6GD 3AZNC 5B2ID 1AOID 1HQ3D 2JSSA 3AZNA 3RELD 4NE6A 2IO5C 5B1MD 4KUDD 3B0CT 4H9RB 4Z66A 2CV5C 1WWIA 5B1LD 3X1UA 3UTBC 3AZKB 4Z2MG 4J8WC 2FJ7B 2CV5A 1S32B 3W98B 3UT9D 3REJB 4LD9D 1KU5A 5B2JD 5AVCD 3AZGD 3AZJD 2FJ7C 5GT0D 4H9RA 5BT1D 1S32C 1BFMA 3W98C 3AZKA 4QLCD 2FJ7A 1B6WA 4H9SC 3REJC 3AZEB 4WV4B 2AROB 4H9SA 4WZSB 3REJA 2NQBD 1P3GB 3B0CW 5BNXB 3AV2D 1P3OB 3MGQD 1TZYB 5B0ZB 3AYWB 5B40B 3W96D 4J8VB 5AV9C 3AZEC 3UTAD 3AZIB 2AROC 3AV1B 5GXQB 1P3GC 5B0YD 3AZEA 3AZMA 5B31D 1P3OC 1F66B 1P3KC 2F8ND 1ULYA 5BNXA 5AVBB 5B0ZC 1P3OA 1A7WA 3AYWC 1TZYA 5B32G 3C1BD 4XUJD 5AV5B 5B0ZA 4J8VC 3AZIC 3AYWA 5B40A 4YM6C 5GXQC 3LJAB 4J8VA 1ZLAB 3V9RB 3AV1A 3MGPD 1F66C 5GXQA 5E5AB 5AVBC 4H9NB 1F66A 4J8XB 5AVBA 5AV5C 3REHB 2L5AA 4WU9C 1KX5B 4KGCD 1ID3B 1P3PC 4ZUXD 3VH6T 1EQZB 3KWQA 3LJAC 5AV5A 5F99B 1P3BD 1ZLAC 3VH6A 3A6NB 5E5AC 1M18C 4YS3D 3V9RA 1M19D 3AZHB 5E5AA 1HQ3B 4J8XC 1P3LB 3REHC 4H9NA 5CPJB 1Q9CA 5B33D 1ID3C 2F8NK 1TAFB 2HUEB 4J8XA 5AV8B 5F99C 3X1SD 3REHA 1EQZC 1KX5A 4NE3A 5CPKD 3A6NC 4WU8D 1EQZA 5B1MB 5GT3D 5F99A 3MGRD 3WTPB 4HGAB 2NZDD 3B6GC 3A6NA 3VH5T 3WA9D 5BO0B 5BS7C 4H9QB 1HQ3C 1P3LC 5CPJC 3VH5A 3AZHA 5BS7A 3VH6W 4AWLB 5GSUD 2HUEC 1P3LA 5AV8C 3O62D 5CPJA 2HIOB 4XZQD 1KX4D 5JRGB 3REIB 5KDMB 1TAFA 5B1MC 5AV8A 5CP6D 3WTPC 4HGAC 5B1LC 3AZJB 5CPIB 1M1AD 5B1MA 3WTPA 3LZ1A 3B0DB 2IO5B 5BO0A 4LD9C 4AWLC 5B24D 4H9QA 3AFAB 3UTBB 3LELD 4J8WB 2HIOC 3B6FD 5JRGC 3REIC 2HIOA 4DRBA 4J8UD 3AZJC 3R45B 5CPIC 4WNNB 3VH5W 5GT0C 5JRGA 5KDMA 5AY8B 4JJNB 3REIA 3W97B 3B0DC 5DNMD 5G49B 5CPIA 3KXBD 3W96B 3AFAC 4CAYB 5B32B 2NQBC 5DNND 3AFAA 3UTBA 4J8WA 3TU4D 3NQJB 3X1TB 5AY8C 4R8PB 3MGQC 4JJNC 2F8NB 3W97C 3W99B 3R45A 5AY8A 4WNNA 3AN2D 3W96C 4JJNA 3W97A 3KUYD 1BH9B 5G49A 5B32C 1P3AD 3W96A 5AV6D 4CAYA 3X1TC 5B32A 4R8PC 5AV9B 1S32A 3W98A 2CWEA 3NQJA 3W99C 3X1TA 4R8PA 3WAAB 2F8NA 3X1VD 3C1BC 4XUJC 1P3FD 3W99A 3AZND 1P3KB 1BH9A 4NFTA 3MNNB 2PYOD 4Z66D 3X1UD 4YM6B
chains in the Genus database with same CATH superfamily
4Z5TB 3WAAC 5AV9A 2CV5D 2AROA 4G92B 1P3GA 3MGSB 2RVQC 3WKJB 3WAAA 1N1JB 4X23B 3LZ0B 3MNNC 1P3KA 4WU9B 4YS3C 3MGRB 1P3PB 3MNNA 4Z2MH 2NZDB 4Z5TC 3F6TA 2F8NG 3AZIA 2Y2JA 4G92C 4YM6A 3AZKD 1M18B 4Z5TA 3MGSC 3WKJC 4X23C 3LZ0C 2LY8A 3O62B 3X1SC 1R4VA 3REJD 3MGSA 3WKJA 2JCHA 3C1CB 1N1JA 2YFVB 3B0BA 3IP4C 4X23A 3LZ0A 3MGRC 3AZLD 1U35B 2NZDC 1HTAA 3WA9C 1M1AB 4WU9A 3MGRA 1P3PA 2NZDA 1B67A 3LJAA 4DRAA 5GSUC 1ZLAA 3B6GB 3O62C 1KX3D 1M18A 3B6FB 5B2IB 3C1CC 1AOIB 1P3ID 2BYKB 3AZED 3AZMD 3O62A 5CP6C 1U35C 3EPKA 3C1CA 3RELB 2YFVA 1M1AC 2Y2NA 1P3OD 1ID3A 4UPKA 1U35A 2FFFB 1TZYD 3WTPE 5B24C 3KXBB 3EPLA 3AZFD 5B0ZD 5B1LB 1M1AA 4KUDB 3LELC 3AYWD 5B40D 3B6FC 5B2IC 1AOIC 4J8VD 3B6GA 2XD5A 2XD1A 3UT9B 3AV1D 4LD9B 5B2IA 3RELC 1AOIA 1HQ3A 5B2JB 5DNMC 3RELA 1F66D 4KUDC 3KXBC 5AVCB 1JFIB 5AVBD 3AZGB 5GT0B 2DF4C 3KXBA 4KUDA 3KWQD 5AV5D 5B1LA 2F8NH 1P3MD 4QLCB 3UT9C 5B2JC 1P34D 3UT9A 4LD9A 2NQBB 5E5AD 3AN2C 5B2JA 5AVCC 3AZGC 3X1VB 3AV2B 1H3OB 1P3FB 3MGQB 3KFUG 4J8XD 5C3IC 5AVCA 4M6BA 3REHD 5BT1C 3AZGA 1JFIA 3AZJA 1KX5D 4QLCC 5GT0A 1BH8B 1EQZD 5F99D 2PYOB 3UTAB 4QLCA 3A6ND 1W2EA 4EO5C 5B0YB 5FUGB 5B31B 3X1VC 3AV2C 1P3FC 3MVDD 3AZHD 2NQBA 1PZRA 1P3LD 2Y2PA 3A1KA 3X1VA 3AV2A 1H3OA 5CPJD 1P3FA 3MGQA 2YFWB 4XUJB 5AV8D 3C1BB 2PYOC 3UTAC 4Z66C 3REKD 3X1UC 1BH8A 5B0YC 2PYOA 5B31C 3WTPD 3LZ1D 4H9OB 3UTAA 3MGPB 3KSYA 5B0YA 5FUGA 5B31A 1F1EA 3AL0C 4G91B 4KGCB 3AZLB 2HIOD 4ZUXB 5JRGD 3REID 2YFWA 4XUJA 3C1BA 1P3BB 2Y2LA 4KHAB 3MGPC 3AZKC 5CPID 2UWXA 4YS3B 4H9OA 3MGPA 1M19B 1KX3B 2VQRA 1WWSA 5CHLB 4G91C 3AFAD 5JA4B 3UTBD 1P3IB 4J8WD 4KGCC 3AZMB 3AZLC 5B33B 4ZUXC 3X1SB 1P3BC 4KGCA 3AZLA 5CPKB 5AY8D 4ZUXA 3EG5B 4WU8B 3P5JB 4JJND 5GT3B 3W97D 1P3BA 3AZFB 5B31G 4KHAA 1M19C 3WA9B 1KX3C 4YS3A 4E44A 5BNVB 1P3IC 2FJ7D 3AZMC 1M19A 5B33C 1T3UA 4ZBJB 5B32D 1KX3A 4CSRB 5GSUB 1S32D 1P3IA 5JA4A 3W98D 5CPKC 5B33A 3X1TD 4XZQB 1KX4B 4E45A 4R8PD 4WU8C 3NQUB 5GT3C 1TZYC 2W8SA 3X1SA 5CP6B 3AZFC 3W99D 5CPKA 2Y2KA 4WU8A 5B40C 5GT3A 3KWQB 3AZFA 1P3MB 3WA9A 4ZBJC 3AV1C 2Y2QA 5B24B 5BNVA 3LELB 1P34B 4XZQC 1KX4C 4CSRA 5GSUA 5AV9D 2AROD 4J8UB 4UUZB 4XZQA 1P3GD 1KX4A 3WAAD 3NQUA 5CP6A 3KWQC 5DNMB 1P3MC 1P3KD 2RVQD 1P34C 1P3MA 3MNND 5B24A 5DNNB 3LELA 3AZID 1P34A 3TU4B 4YM6D 4J8UC 3B6FA 5GXQD 4Z5TD 3MVDB 2BYKA 2ZM5A 4J8UA 1KX5C 4UUZA 3AN2B 2Y2IA 3MGSD 4H9PB 3WKJD 4X23D 3LZ0D 3KUYB 5DNMA 3REKB 1P3AB 5C3IB 5DNNC 5AV6B 4WU9D 2BYMB 1P3PD 3TU4C 3LZ1B 3MVDC 3AZHC 3LJAD 2ZY4A 5DNNA 1ZLAD 3EPHA 4NE5A 3TU4A 2F2AC 1M18D 3MVDA 4EO5B 3KUYC 3AZNB 3REKC 3AN2A 4H9PA 3C1CD 1P3AC 5AV6C 3KUYA 1ID3D 3LZ1C 3REKA 1U35D 1P3AA 5AV6A 4Z66B 2BYMA 3X1UB 2CV5B 3B6GD 3AZNC 5B2ID 1AOID 1HQ3D 3A1IA 2JSSA 3AZNA 3RELD 4NE6A 2JE5A 2IO5C 2G5IC 5B1MD 4KUDD 3B0CT 4H9RB 4Z66A 2CV5C 1WWIA 5B1LD 3H0MC 3X1UA 3UTBC 4Z2MG 4J8WC 3AZKB 2FJ7B 2CV5A 1S32B 2ZY3A 3W98B 3UT9D 3REJB 4LD9D 1KU5A 5B2JD 5AVCD 3AZGD 2J8PA 3AZJD 2FJ7C 5GT0D 4H9RA 5BT1D 1S32C 1BFMA 3W98C 3AZKA 4QLCD 2FJ7A 1B6WA 4H9SC 3REJC 3AZEB 4WV4B 2AROB 4H9SA 4WZSB 3REJA 2NQBD 1P3GB 3B0CW 5BNXB 3AV2D 1P3OB 3MGQD 1TZYB 5B0ZB 3AYWB 2Y2MA 5B40B 3W96D 4J8VB 5AV9C 3AZEC 3UTAD 3AZIB 2AROC 3AV1B 3EPJA 5GXQB 1P3GC 2RIQA 5B0YD 3AZEA 3AZMA 5B31D 1P3OC 1F66B 1P3KC 2F8ND 1ULYA 5BNXA 5AVBB 5B0ZC 1P3OA 1A7WA 2Y2HA 3AYWC 1TZYA 5B32G 3C1BD 4XUJD 5AV5B 5B0ZA 4J8VC 3AZIC 3AYWA 5B40A 4YM6C 5GXQC 3LJAB 4J8VA 1ZLAB 3V9RB 3AV1A 3MGPD 1F66C 5GXQA 5E5AB 5AVBC 4H9NB 3H0LC 1F66A 4J8XB 5AVBA 2BG1A 5AV5C 3REHB 2L5AA 4WU9C 1KX5B 4KGCD 1ID3B 1P3PC 4ZUXD 3VH6T 1EQZB 3KWQA 3LJAC 5AV5A 5F99B 1P3BD 4WJ3C 1ZLAC 3VH6A 3A6NB 5E5AC 1M18C 4YS3D 3V9RA 1M19D 3AZHB 2DQNC 5E5AA 1HQ3B 4J8XC 1P3LB 3REHC 4H9NA 5CPJB 1Q9CA 5B33D 1ID3C 2F8NK 1TAFB 2HUEB 4J8XA 5AV8B 5F99C 3X1SD 3REHA 1EQZC 1KX5A 4NE3A 5CPKD 3A6NC 4WU8D 1EQZA 5B1MB 5GT3D 5F99A 3MGRD 3FDDA 3WTPB 4HGAB 2NZDD 3B6GC 3A6NA 3VH5T 3WA9D 5BO0B 5BS7C 4H9QB 1HQ3C 1P3LC 5CPJC 3VH5A 3AZHA 5BS7A 3VH6W 4AWLB 5GSUD 4DQYB 2HUEC 1P3LA 5AV8C 3O62D 5CPJA 2HIOB 4XZQD 1KX4D 5JRGB 3REIB 5KDMB 1TAFA 5B1MC 5AV8A 5CP6D 3WTPC 4HGAC 2Y2GA 5B1LC 3AZJB 5CPIB 1M1AD 5B1MA 3WTPA 3LZ1A 3B0DB 2IO5B 5BO0A 4LD9C 4AWLC 5B24D 4H9QA 3AFAB 3UTBB 3LELD 4J8WB 2HIOC 3B6FD 5JRGC 3REIC 2HIOA 4DRBA 4J8UD 3AZJC 3R45B 5CPIC 4WNNB 3VH5W 5AY8B 5GT0C 5KDMA 5JRGA 4JJNB 3REIA 3W97B 3B0DC 5DNMD 5G49B 5CPIA 3KXBD 3W96B 3AFAC 2ZY2A 4CAYB 5B32B 2NQBC 5DNND 3AFAA 3UTBA 4J8WA 3TU4D 3NQJB 3X1TB 5AY8C 4R8PB 2Y2OA 3MGQC 4JJNC 2F8NB 3W97C 3W99B 3R45A 5AY8A 4WNNA 3AN2D 3W96C 4JJNA 3W97A 3KUYD 1BH9B 5G49A 1Z2CB 2ZY5A 5B32C 1P3AD 3W96A 5AV6D 4CAYA 3X1TC 5B32A 4R8PC 5AV9B 1S32A 2G5HC 3W98A 2CWEA 3NQJA 3W99C 3X1TA 4R8PA 3WAAB 2F8NA 3X1VD 3C1BC 4XUJC 1P3FD 3W99A 3AZND 1P3KB 1BH9A 4NFTA 3MNNB 3H0RC 2PYOD 4Z66D 3X1UD 4YM6B
chains in the Genus database with same CATH topology
4Z5TB 3WAAC 5AV9A 2CV5D 2AROA 4G92B 1P3GA 3MGSB 2RVQC 3WKJB 3WAAA 1N1JB 4X23B 3LZ0B 3MNNC 1P3KA 4WU9B 4YS3C 3MGRB 1P3PB 3MNNA 4Z2MH 2NZDB 4Z5TC 3F6TA 2F8NG 3AZIA 2Y2JA 4G92C 4YM6A 3AZKD 1M18B 4Z5TA 3MGSC 3WKJC 4X23C 3LZ0C 2LY8A 3O62B 3X1SC 1R4VA 3REJD 3MGSA 3WKJA 2JCHA 3C1CB 1N1JA 2YFVB 3B0BA 3IP4C 4X23A 3LZ0A 3MGRC 3AZLD 1U35B 2NZDC 1HTAA 3WA9C 1M1AB 4WU9A 3MGRA 1P3PA 2NZDA 1B67A 3LJAA 4DRAA 5GSUC 1ZLAA 3B6GB 3O62C 1KX3D 1M18A 3B6FB 5B2IB 3C1CC 1AOIB 1P3ID 2BYKB 3AZED 3AZMD 3O62A 5CP6C 1U35C 3EPKA 3C1CA 3RELB 2YFVA 1M1AC 2Y2NA 1P3OD 1ID3A 4UPKA 1U35A 2FFFB 1TZYD 3WTPE 5B24C 3KXBB 3EPLA 3AZFD 5B0ZD 5B1LB 1M1AA 4KUDB 3LELC 3AYWD 5B40D 3B6FC 5B2IC 1AOIC 4J8VD 3B6GA 2XD5A 2XD1A 3UT9B 3AV1D 4LD9B 5B2IA 3RELC 1AOIA 1HQ3A 5B2JB 5DNMC 3RELA 1F66D 4KUDC 3KXBC 5AVCB 1JFIB 5AVBD 3AZGB 5GT0B 2DF4C 3KXBA 4KUDA 3KWQD 5AV5D 5B1LA 2F8NH 1P3MD 4QLCB 3UT9C 5B2JC 1P34D 3UT9A 4LD9A 2NQBB 5E5AD 3AN2C 5B2JA 5AVCC 3AZGC 3X1VB 3AV2B 1H3OB 1P3FB 3MGQB 3KFUG 4J8XD 5C3IC 5AVCA 4M6BA 3REHD 5BT1C 3AZGA 1JFIA 3AZJA 1KX5D 4QLCC 5GT0A 1BH8B 1EQZD 5F99D 2PYOB 3UTAB 4QLCA 3A6ND 1W2EA 4EO5C 5B0YB 5FUGB 5B31B 3X1VC 3AV2C 1P3FC 3MVDD 3AZHD 2NQBA 1PZRA 1P3LD 2Y2PA 3A1KA 3X1VA 3AV2A 1H3OA 5CPJD 1P3FA 3MGQA 2YFWB 4XUJB 5AV8D 3C1BB 2PYOC 3UTAC 4Z66C 3REKD 3X1UC 1BH8A 5B0YC 2PYOA 5B31C 3WTPD 3LZ1D 4H9OB 3UTAA 3MGPB 3KSYA 5B0YA 5FUGA 5B31A 1F1EA 3AL0C 4G91B 4KGCB 3AZLB 2HIOD 4ZUXB 5JRGD 3REID 2YFWA 4XUJA 3C1BA 1P3BB 2Y2LA 4KHAB 3MGPC 3AZKC 5CPID 2UWXA 4YS3B 4H9OA 3MGPA 1M19B 1KX3B 2VQRA 1WWSA 5CHLB 4G91C 3AFAD 5JA4B 3UTBD 1P3IB 4J8WD 4KGCC 3AZMB 3AZLC 5B33B 4ZUXC 3X1SB 1P3BC 4KGCA 3AZLA 5CPKB 5AY8D 4ZUXA 3EG5B 4WU8B 3P5JB 4JJND 5GT3B 3W97D 1P3BA 3AZFB 5B31G 4KHAA 1M19C 3WA9B 1KX3C 4YS3A 4E44A 5BNVB 1P3IC 2FJ7D 3AZMC 1M19A 5B33C 1T3UA 4ZBJB 5B32D 1KX3A 4CSRB 5GSUB 1S32D 1P3IA 5JA4A 3W98D 5CPKC 5B33A 3X1TD 4XZQB 1KX4B 4E45A 4R8PD 4WU8C 3NQUB 5GT3C 1TZYC 2W8SA 3X1SA 5CP6B 3AZFC 3W99D 5CPKA 2Y2KA 4WU8A 5B40C 5GT3A 3KWQB 3AZFA 1P3MB 3WA9A 4ZBJC 3AV1C 2Y2QA 5B24B 5BNVA 3LELB 1P34B 4XZQC 1KX4C 4CSRA 5GSUA 5AV9D 2AROD 4J8UB 4UUZB 4XZQA 1P3GD 1KX4A 3WAAD 3NQUA 5CP6A 3KWQC 5DNMB 1P3MC 1P3KD 2RVQD 1P34C 1P3MA 3MNND 5B24A 5DNNB 3LELA 3AZID 1P34A 3TU4B 4YM6D 4J8UC 3B6FA 5GXQD 4Z5TD 3MVDB 2BYKA 2ZM5A 4J8UA 1KX5C 4UUZA 3AN2B 2Y2IA 3MGSD 4H9PB 3WKJD 4X23D 3LZ0D 3KUYB 5DNMA 3REKB 1P3AB 5C3IB 5DNNC 5AV6B 4WU9D 2BYMB 1P3PD 3TU4C 3LZ1B 3MVDC 3AZHC 3LJAD 2ZY4A 5DNNA 1ZLAD 3EPHA 4NE5A 3TU4A 2F2AC 1M18D 3MVDA 4EO5B 3KUYC 3AZNB 3REKC 3AN2A 4H9PA 3C1CD 1P3AC 5AV6C 3KUYA 1ID3D 3LZ1C 3REKA 1U35D 1P3AA 5AV6A 4Z66B 2BYMA 3X1UB 2CV5B 3B6GD 3AZNC 5B2ID 1AOID 1HQ3D 3A1IA 2JSSA 3AZNA 3RELD 4NE6A 2JE5A 2IO5C 2G5IC 5B1MD 4KUDD 3B0CT 4H9RB 4Z66A 2CV5C 1WWIA 5B1LD 3H0MC 3X1UA 3UTBC 4Z2MG 4J8WC 3AZKB 2FJ7B 2CV5A 1S32B 2ZY3A 3W98B 3UT9D 3REJB 4LD9D 1KU5A 5B2JD 5AVCD 3AZGD 2J8PA 3AZJD 2FJ7C 5GT0D 4H9RA 5BT1D 1S32C 1BFMA 3W98C 3AZKA 4QLCD 2FJ7A 1B6WA 4H9SC 3REJC 3AZEB 4WV4B 2AROB 4H9SA 4WZSB 3REJA 2NQBD 1P3GB 3B0CW 5BNXB 3AV2D 1P3OB 3MGQD 1TZYB 5B0ZB 3AYWB 2Y2MA 5B40B 3W96D 4J8VB 5AV9C 3AZEC 3UTAD 3AZIB 2AROC 3AV1B 3EPJA 5GXQB 1P3GC 2RIQA 5B0YD 3AZEA 3AZMA 5B31D 1P3OC 1F66B 1P3KC 2F8ND 1ULYA 5BNXA 5AVBB 5B0ZC 1P3OA 1A7WA 2Y2HA 3AYWC 1TZYA 5B32G 3C1BD 4XUJD 5AV5B 5B0ZA 4J8VC 3AZIC 3AYWA 5B40A 4YM6C 5GXQC 3LJAB 4J8VA 1ZLAB 3V9RB 3AV1A 3MGPD 1F66C 5GXQA 5E5AB 5AVBC 4H9NB 3H0LC 1F66A 4J8XB 5AVBA 2BG1A 5AV5C 3REHB 2L5AA 4WU9C 1KX5B 4KGCD 1ID3B 1P3PC 4ZUXD 3VH6T 1EQZB 3KWQA 3LJAC 5AV5A 5F99B 1P3BD 4WJ3C 1ZLAC 3VH6A 3A6NB 5E5AC 1M18C 4YS3D 3V9RA 1M19D 3AZHB 2DQNC 5E5AA 1HQ3B 4J8XC 1P3LB 3REHC 4H9NA 5CPJB 1Q9CA 5B33D 1ID3C 2F8NK 1TAFB 2HUEB 4J8XA 5AV8B 5F99C 3X1SD 3REHA 1EQZC 1KX5A 4NE3A 5CPKD 3A6NC 4WU8D 1EQZA 5B1MB 5GT3D 5F99A 3MGRD 3FDDA 3WTPB 4HGAB 2NZDD 3B6GC 3A6NA 3VH5T 3WA9D 5BO0B 5BS7C 4H9QB 1HQ3C 1P3LC 5CPJC 3VH5A 3AZHA 5BS7A 3VH6W 4AWLB 5GSUD 4DQYB 2HUEC 1P3LA 5AV8C 3O62D 5CPJA 2HIOB 4XZQD 1KX4D 5JRGB 3REIB 5KDMB 1TAFA 5B1MC 5AV8A 5CP6D 3WTPC 4HGAC 2Y2GA 5B1LC 3AZJB 5CPIB 1M1AD 5B1MA 3WTPA 3LZ1A 3B0DB 2IO5B 5BO0A 4LD9C 4AWLC 5B24D 4H9QA 3AFAB 3UTBB 3LELD 4J8WB 2HIOC 3B6FD 5JRGC 3REIC 2HIOA 4DRBA 4J8UD 3AZJC 3R45B 5CPIC 4WNNB 3VH5W 5AY8B 5GT0C 5KDMA 5JRGA 4JJNB 3REIA 3W97B 3B0DC 5DNMD 5G49B 5CPIA 3KXBD 3W96B 3AFAC 2ZY2A 4CAYB 5B32B 2NQBC 5DNND 3AFAA 3UTBA 4J8WA 3TU4D 3NQJB 3X1TB 5AY8C 4R8PB 2Y2OA 3MGQC 4JJNC 2F8NB 3W97C 3W99B 3R45A 5AY8A 4WNNA 3AN2D 3W96C 4JJNA 3W97A 3KUYD 1BH9B 5G49A 1Z2CB 2ZY5A 5B32C 1P3AD 3W96A 5AV6D 4CAYA 3X1TC 5B32A 4R8PC 5AV9B 1S32A 2G5HC 3W98A 2CWEA 3NQJA 3W99C 3X1TA 4R8PA 3WAAB 2F8NA 3X1VD 3C1BC 4XUJC 1P3FD 3W99A 3AZND 1P3KB 1BH9A 4NFTA 3MNNB 3H0RC 2PYOD 4Z66D 3X1UD 4YM6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z5T B;  3WAA C;  5AV9 A;  2CV5 D;  2ARO A;  4G92 B;  1P3G A;  3MGS B;  2RVQ C;  3WKJ B;  3WAA A;  1N1J B;  4X23 B;  3LZ0 B;  3MNN C;  1P3K A;  4WU9 B;  4YS3 C;  3MGR B;  1P3P B;  3MNN A;  4Z2M H;  2NZD B;  4Z5T C;  2F8N G;  3AZI A;  4G92 C;  4YM6 A;  3AZK D;  1M18 B;  4Z5T A;  3MGS C;  3WKJ C;  4X23 C;  3LZ0 C;  2LY8 A;  3O62 B;  3X1S C;  1R4V A;  3REJ D;  3MGS A;  3WKJ A;  3C1C B;  2YFV B;  3B0B A;  1N1J A;  4X23 A;  3LZ0 A;  3MGR C;  3AZL D;  1U35 B;  2NZD C;  1HTA A;  3WA9 C;  1M1A B;  4WU9 A;  3MGR A;  1P3P A;  2NZD A;  1B67 A;  3LJA A;  4DRA A;  5GSU C;  1ZLA A;  3B6G B;  3O62 C;  1KX3 D;  1M18 A;  3B6F B;  5B2I B;  3C1C C;  1AOI B;  1P3I D;  2BYK B;  3AZE D;  3AZM D;  3O62 A;  5CP6 C;  1U35 C;  3C1C A;  3REL B;  2YFV A;  1M1A C;  1P3O D;  1ID3 A;  1U35 A;  1TZY D;  3WTP E;  5B24 C;  3KXB B;  3AZF D;  1M1A A;  5B0Z D;  5B1L B;  4KUD B;  3LEL C;  3AYW D;  5B40 D;  3B6F C;  5B2I C;  1AOI C;  4J8V D;  3B6G A;  3UT9 B;  3AV1 D;  4LD9 B;  5B2I A;  3REL C;  1AOI A;  1HQ3 A;  5B2J B;  5DNM C;  3REL A;  1F66 D;  4KUD C;  3KXB C;  5AVC B;  1JFI B;  5AVB D;  3AZG B;  5GT0 B;  4KUD A;  3KXB A;  3KWQ D;  5AV5 D;  5B1L A;  2F8N H;  1P3M D;  4QLC B;  3UT9 C;  5B2J C;  1P34 D;  3UT9 A;  4LD9 A;  2NQB B;  5E5A D;  3AN2 C;  5B2J A;  5AVC C;  3AZG C;  3X1V B;  3AV2 B;  1H3O B;  1P3F B;  3MGQ B;  4J8X D;  5C3I C;  5AVC A;  4M6B A;  3REH D;  5BT1 C;  3AZG A;  1JFI A;  3AZJ A;  1KX5 D;  4QLC C;  5GT0 A;  1BH8 B;  1EQZ D;  5F99 D;  2PYO B;  3UTA B;  4QLC A;  3A6N D;  4EO5 C;  5B0Y B;  5FUG B;  5B31 B;  3X1V C;  3AV2 C;  1P3F C;  3MVD D;  3AZH D;  2NQB A;  1P3L D;  3X1V A;  3AV2 A;  1H3O A;  5CPJ D;  1P3F A;  3MGQ A;  2YFW B;  4XUJ B;  5AV8 D;  3C1B B;  2PYO C;  3UTA C;  4Z66 C;  3REK D;  3X1U C;  1BH8 A;  5B0Y C;  2PYO A;  5B31 C;  3WTP D;  3LZ1 D;  4H9O B;  3UTA A;  3MGP B;  3KSY A;  5B0Y A;  5FUG A;  5B31 A;  1F1E A;  4G91 B;  4KGC B;  3AZL B;  2HIO D;  4ZUX B;  5JRG D;  3REI D;  2YFW A;  4XUJ A;  3C1B A;  1P3B B;  4KHA B;  3MGP C;  3AZK C;  5CPI D;  4YS3 B;  4H9O A;  3MGP A;  1M19 B;  1KX3 B;  5CHL B;  1WWS A;  4G91 C;  3AFA D;  5JA4 B;  3UTB D;  1P3I B;  4J8W D;  4KGC C;  3AZM B;  3AZL C;  5B33 B;  4ZUX C;  3X1S B;  1P3B C;  4KGC A;  3AZL A;  5CPK B;  5AY8 D;  4ZUX A;  4WU8 B;  4JJN D;  5GT3 B;  3W97 D;  1P3B A;  3AZF B;  5B31 G;  4KHA A;  1M19 C;  3WA9 B;  1KX3 C;  4YS3 A;  4E44 A;  5BNV B;  1P3I C;  2FJ7 D;  3AZM C;  1M19 A;  5B33 C;  4ZBJ B;  5B32 D;  1KX3 A;  4CSR B;  5GSU B;  1S32 D;  1P3I A;  5JA4 A;  3W98 D;  5CPK C;  5B33 A;  3X1T D;  4XZQ B;  1KX4 B;  4E45 A;  4R8P D;  4WU8 C;  3NQU B;  5GT3 C;  1TZY C;  3X1S A;  5CP6 B;  3AZF C;  3W99 D;  5CPK A;  4WU8 A;  5B40 C;  5GT3 A;  3KWQ B;  3AZF A;  1P3M B;  3WA9 A;  4ZBJ C;  3AV1 C;  5B24 B;  5BNV A;  3LEL B;  1P34 B;  4XZQ C;  1KX4 C;  4CSR A;  5GSU A;  5AV9 D;  2ARO D;  4J8U B;  4UUZ B;  4XZQ A;  1P3G D;  1KX4 A;  3WAA D;  3NQU A;  5CP6 A;  3KWQ C;  5DNM B;  1P3M C;  1P3K D;  2RVQ D;  1P34 C;  1P3M A;  3MNN D;  5B24 A;  5DNN B;  3LEL A;  3AZI D;  1P34 A;  3TU4 B;  4YM6 D;  4J8U C;  3B6F A;  5GXQ D;  4Z5T D;  3MVD B;  2BYK A;  4J8U A;  1KX5 C;  4UUZ A;  3AN2 B;  3MGS D;  3WKJ D;  4H9P B;  4X23 D;  3LZ0 D;  3KUY B;  5DNM A;  3REK B;  1P3A B;  5C3I B;  5DNN C;  5AV6 B;  4WU9 D;  2BYM B;  1P3P D;  3TU4 C;  3LZ1 B;  3MVD C;  3AZH C;  3LJA D;  5DNN A;  1ZLA D;  4NE5 A;  3TU4 A;  1M18 D;  3MVD A;  4EO5 B;  3KUY C;  3AZN B;  3REK C;  3AN2 A;  4H9P A;  3C1C D;  1P3A C;  5AV6 C;  3KUY A;  1ID3 D;  3LZ1 C;  3REK A;  1U35 D;  1P3A A;  5AV6 A;  4Z66 B;  2BYM A;  3X1U B;  2CV5 B;  3B6G D;  3AZN C;  5B2I D;  1AOI D;  1HQ3 D;  2JSS A;  3AZN A;  3REL D;  4NE6 A;  2IO5 C;  5B1M D;  4KUD D;  3B0C T;  4H9R B;  4Z66 A;  2CV5 C;  1WWI A;  5B1L D;  3X1U A;  3UTB C;  3AZK B;  4Z2M G;  4J8W C;  2FJ7 B;  2CV5 A;  1S32 B;  3W98 B;  3UT9 D;  3REJ B;  4LD9 D;  1KU5 A;  5B2J D;  5AVC D;  3AZG D;  3AZJ D;  2FJ7 C;  5GT0 D;  4H9R A;  5BT1 D;  1S32 C;  1BFM A;  3W98 C;  3AZK A;  4QLC D;  2FJ7 A;  1B6W A;  4H9S C;  3REJ C;  3AZE B;  4WV4 B;  2ARO B;  4H9S A;  4WZS B;  3REJ A;  2NQB D;  1P3G B;  3B0C W;  5BNX B;  3AV2 D;  1P3O B;  3MGQ D;  1TZY B;  5B0Z B;  3AYW B;  5B40 B;  3W96 D;  4J8V B;  5AV9 C;  3AZE C;  3UTA D;  3AZI B;  2ARO C;  3AV1 B;  5GXQ B;  1P3G C;  5B0Y D;  3AZE A;  3AZM A;  5B31 D;  1P3O C;  1F66 B;  1P3K C;  2F8N D;  1ULY A;  5BNX A;  5AVB B;  5B0Z C;  1P3O A;  1A7W A;  3AYW C;  1TZY A;  5B32 G;  3C1B D;  4XUJ D;  5AV5 B;  5B0Z A;  4J8V C;  3AZI C;  3AYW A;  5B40 A;  4YM6 C;  5GXQ C;  3LJA B;  4J8V A;  1ZLA B;  3V9R B;  3AV1 A;  3MGP D;  1F66 C;  5GXQ A;  5E5A B;  5AVB C;  4H9N B;  1F66 A;  4J8X B;  5AVB A;  5AV5 C;  3REH B;  2L5A A;  4WU9 C;  1KX5 B;  4KGC D;  1ID3 B;  1P3P C;  4ZUX D;  3VH6 T;  1EQZ B;  3KWQ A;  3LJA C;  5AV5 A;  5F99 B;  1P3B D;  1ZLA C;  3VH6 A;  3A6N B;  5E5A C;  1M18 C;  4YS3 D;  3V9R A;  1M19 D;  3AZH B;  5E5A A;  1HQ3 B;  4J8X C;  1P3L B;  3REH C;  4H9N A;  5CPJ B;  1Q9C A;  5B33 D;  1ID3 C;  2F8N K;  1TAF B;  2HUE B;  4J8X A;  5AV8 B;  5F99 C;  3X1S D;  3REH A;  1EQZ C;  1KX5 A;  4NE3 A;  5CPK D;  3A6N C;  4WU8 D;  1EQZ A;  5B1M B;  5GT3 D;  5F99 A;  3MGR D;  3WTP B;  4HGA B;  2NZD D;  3B6G C;  3A6N A;  3VH5 T;  3WA9 D;  5BO0 B;  5BS7 C;  4H9Q B;  1HQ3 C;  1P3L C;  5CPJ C;  3VH5 A;  3AZH A;  5BS7 A;  3VH6 W;  4AWL B;  5GSU D;  2HUE C;  1P3L A;  5AV8 C;  3O62 D;  5CPJ A;  2HIO B;  4XZQ D;  1KX4 D;  5JRG B;  3REI B;  5KDM B;  1TAF A;  5B1M C;  5AV8 A;  5CP6 D;  3WTP C;  4HGA C;  5B1L C;  3AZJ B;  5CPI B;  1M1A D;  5B1M A;  3WTP A;  3LZ1 A;  3B0D B;  2IO5 B;  5BO0 A;  4LD9 C;  4AWL C;  5B24 D;  4H9Q A;  3AFA B;  3UTB B;  3LEL D;  4J8W B;  2HIO C;  3B6F D;  5JRG C;  3REI C;  2HIO A;  4DRB A;  4J8U D;  3AZJ C;  3R45 B;  5CPI C;  4WNN B;  3VH5 W;  5GT0 C;  5JRG A;  5KDM A;  5AY8 B;  4JJN B;  3REI A;  3W97 B;  3B0D C;  5DNM D;  5G49 B;  5CPI A;  3KXB D;  3W96 B;  3AFA C;  4CAY B;  5B32 B;  2NQB C;  5DNN D;  3AFA A;  3UTB A;  4J8W A;  3TU4 D;  3NQJ B;  3X1T B;  5AY8 C;  4R8P B;  3MGQ C;  4JJN C;  2F8N B;  3W97 C;  3W99 B;  3R45 A;  5AY8 A;  4WNN A;  3AN2 D;  3W96 C;  4JJN A;  3W97 A;  3KUY D;  1BH9 B;  5G49 A;  5B32 C;  1P3A D;  3W96 A;  5AV6 D;  4CAY A;  3X1T C;  5B32 A;  4R8P C;  5AV9 B;  1S32 A;  3W98 A;  2CWE A;  3NQJ A;  3W99 C;  3X1T A;  4R8P A;  3WAA B;  2F8N A;  3X1V D;  3C1B C;  4XUJ C;  1P3F D;  3W99 A;  3AZN D;  1P3K B;  1BH9 A;  4NFT A;  3MNN B;  2PYO D;  4Z66 D;  3X1U D;  4YM6 B; 
#chains in the Genus database with same CATH topology
 4Z5T B;  3WAA C;  5AV9 A;  2CV5 D;  2ARO A;  4G92 B;  1P3G A;  3MGS B;  2RVQ C;  3WKJ B;  3WAA A;  1N1J B;  4X23 B;  3LZ0 B;  3MNN C;  1P3K A;  4WU9 B;  4YS3 C;  3MGR B;  1P3P B;  3MNN A;  4Z2M H;  2NZD B;  4Z5T C;  3F6T A;  2F8N G;  3AZI A;  2Y2J A;  4G92 C;  4YM6 A;  3AZK D;  1M18 B;  4Z5T A;  3MGS C;  3WKJ C;  4X23 C;  3LZ0 C;  2LY8 A;  3O62 B;  3X1S C;  1R4V A;  3REJ D;  3MGS A;  3WKJ A;  2JCH A;  3C1C B;  1N1J A;  2YFV B;  3B0B A;  3IP4 C;  4X23 A;  3LZ0 A;  3MGR C;  3AZL D;  1U35 B;  2NZD C;  1HTA A;  3WA9 C;  1M1A B;  4WU9 A;  3MGR A;  1P3P A;  2NZD A;  1B67 A;  3LJA A;  4DRA A;  5GSU C;  1ZLA A;  3B6G B;  3O62 C;  1KX3 D;  1M18 A;  3B6F B;  5B2I B;  3C1C C;  1AOI B;  1P3I D;  2BYK B;  3AZE D;  3AZM D;  3O62 A;  5CP6 C;  1U35 C;  3EPK A;  3C1C A;  3REL B;  2YFV A;  1M1A C;  2Y2N A;  1P3O D;  1ID3 A;  4UPK A;  1U35 A;  2FFF B;  1TZY D;  3WTP E;  5B24 C;  3KXB B;  3EPL A;  3AZF D;  5B0Z D;  5B1L B;  1M1A A;  4KUD B;  3LEL C;  3AYW D;  5B40 D;  3B6F C;  5B2I C;  1AOI C;  4J8V D;  3B6G A;  2XD5 A;  2XD1 A;  3UT9 B;  3AV1 D;  4LD9 B;  5B2I A;  3REL C;  1AOI A;  1HQ3 A;  5B2J B;  5DNM C;  3REL A;  1F66 D;  4KUD C;  3KXB C;  5AVC B;  1JFI B;  5AVB D;  3AZG B;  5GT0 B;  2DF4 C;  3KXB A;  4KUD A;  3KWQ D;  5AV5 D;  5B1L A;  2F8N H;  1P3M D;  4QLC B;  3UT9 C;  5B2J C;  1P34 D;  3UT9 A;  4LD9 A;  2NQB B;  5E5A D;  3AN2 C;  5B2J A;  5AVC C;  3AZG C;  3X1V B;  3AV2 B;  1H3O B;  1P3F B;  3MGQ B;  3KFU G;  4J8X D;  5C3I C;  5AVC A;  4M6B A;  3REH D;  5BT1 C;  3AZG A;  1JFI A;  3AZJ A;  1KX5 D;  4QLC C;  5GT0 A;  1BH8 B;  1EQZ D;  5F99 D;  2PYO B;  3UTA B;  4QLC A;  3A6N D;  1W2E A;  4EO5 C;  5B0Y B;  5FUG B;  5B31 B;  3X1V C;  3AV2 C;  1P3F C;  3MVD D;  3AZH D;  2NQB A;  1PZR A;  1P3L D;  2Y2P A;  3A1K A;  3X1V A;  3AV2 A;  1H3O A;  5CPJ D;  1P3F A;  3MGQ A;  2YFW B;  4XUJ B;  5AV8 D;  3C1B B;  2PYO C;  3UTA C;  4Z66 C;  3REK D;  3X1U C;  1BH8 A;  5B0Y C;  2PYO A;  5B31 C;  3WTP D;  3LZ1 D;  4H9O B;  3UTA A;  3MGP B;  3KSY A;  5B0Y A;  5FUG A;  5B31 A;  1F1E A;  3AL0 C;  4G91 B;  4KGC B;  3AZL B;  2HIO D;  4ZUX B;  5JRG D;  3REI D;  2YFW A;  4XUJ A;  3C1B A;  1P3B B;  2Y2L A;  4KHA B;  3MGP C;  3AZK C;  5CPI D;  2UWX A;  4YS3 B;  4H9O A;  3MGP A;  1M19 B;  1KX3 B;  2VQR A;  1WWS A;  5CHL B;  4G91 C;  3AFA D;  5JA4 B;  3UTB D;  1P3I B;  4J8W D;  4KGC C;  3AZM B;  3AZL C;  5B33 B;  4ZUX C;  3X1S B;  1P3B C;  4KGC A;  3AZL A;  5CPK B;  5AY8 D;  4ZUX A;  3EG5 B;  4WU8 B;  3P5J B;  4JJN D;  5GT3 B;  3W97 D;  1P3B A;  3AZF B;  5B31 G;  4KHA A;  1M19 C;  3WA9 B;  1KX3 C;  4YS3 A;  4E44 A;  5BNV B;  1P3I C;  2FJ7 D;  3AZM C;  1M19 A;  5B33 C;  1T3U A;  4ZBJ B;  5B32 D;  1KX3 A;  4CSR B;  5GSU B;  1S32 D;  1P3I A;  5JA4 A;  3W98 D;  5CPK C;  5B33 A;  3X1T D;  4XZQ B;  1KX4 B;  4E45 A;  4R8P D;  4WU8 C;  3NQU B;  5GT3 C;  1TZY C;  2W8S A;  3X1S A;  5CP6 B;  3AZF C;  3W99 D;  5CPK A;  2Y2K A;  4WU8 A;  5B40 C;  5GT3 A;  3KWQ B;  3AZF A;  1P3M B;  3WA9 A;  4ZBJ C;  3AV1 C;  2Y2Q A;  5B24 B;  5BNV A;  3LEL B;  1P34 B;  4XZQ C;  1KX4 C;  4CSR A;  5GSU A;  5AV9 D;  2ARO D;  4J8U B;  4UUZ B;  4XZQ A;  1P3G D;  1KX4 A;  3WAA D;  3NQU A;  5CP6 A;  3KWQ C;  5DNM B;  1P3M C;  1P3K D;  2RVQ D;  1P34 C;  1P3M A;  3MNN D;  5B24 A;  5DNN B;  3LEL A;  3AZI D;  1P34 A;  3TU4 B;  4YM6 D;  4J8U C;  3B6F A;  5GXQ D;  4Z5T D;  3MVD B;  2BYK A;  2ZM5 A;  4J8U A;  1KX5 C;  4UUZ A;  3AN2 B;  2Y2I A;  3MGS D;  4H9P B;  3WKJ D;  4X23 D;  3LZ0 D;  3KUY B;  5DNM A;  3REK B;  1P3A B;  5C3I B;  5DNN C;  5AV6 B;  4WU9 D;  2BYM B;  1P3P D;  3TU4 C;  3LZ1 B;  3MVD C;  3AZH C;  3LJA D;  2ZY4 A;  5DNN A;  1ZLA D;  3EPH A;  4NE5 A;  3TU4 A;  2F2A C;  1M18 D;  3MVD A;  4EO5 B;  3KUY C;  3AZN B;  3REK C;  3AN2 A;  4H9P A;  3C1C D;  1P3A C;  5AV6 C;  3KUY A;  1ID3 D;  3LZ1 C;  3REK A;  1U35 D;  1P3A A;  5AV6 A;  4Z66 B;  2BYM A;  3X1U B;  2CV5 B;  3B6G D;  3AZN C;  5B2I D;  1AOI D;  1HQ3 D;  3A1I A;  2JSS A;  3AZN A;  3REL D;  4NE6 A;  2JE5 A;  2IO5 C;  2G5I C;  5B1M D;  4KUD D;  3B0C T;  4H9R B;  4Z66 A;  2CV5 C;  1WWI A;  5B1L D;  3H0M C;  3X1U A;  3UTB C;  4Z2M G;  4J8W C;  3AZK B;  2FJ7 B;  2CV5 A;  1S32 B;  2ZY3 A;  3W98 B;  3UT9 D;  3REJ B;  4LD9 D;  1KU5 A;  5B2J D;  5AVC D;  3AZG D;  2J8P A;  3AZJ D;  2FJ7 C;  5GT0 D;  4H9R A;  5BT1 D;  1S32 C;  1BFM A;  3W98 C;  3AZK A;  4QLC D;  2FJ7 A;  1B6W A;  4H9S C;  3REJ C;  3AZE B;  4WV4 B;  2ARO B;  4H9S A;  4WZS B;  3REJ A;  2NQB D;  1P3G B;  3B0C W;  5BNX B;  3AV2 D;  1P3O B;  3MGQ D;  1TZY B;  5B0Z B;  3AYW B;  2Y2M A;  5B40 B;  3W96 D;  4J8V B;  5AV9 C;  3AZE C;  3UTA D;  3AZI B;  2ARO C;  3AV1 B;  3EPJ A;  5GXQ B;  1P3G C;  2RIQ A;  5B0Y D;  3AZE A;  3AZM A;  5B31 D;  1P3O C;  1F66 B;  1P3K C;  2F8N D;  1ULY A;  5BNX A;  5AVB B;  5B0Z C;  1P3O A;  1A7W A;  2Y2H A;  3AYW C;  1TZY A;  5B32 G;  3C1B D;  4XUJ D;  5AV5 B;  5B0Z A;  4J8V C;  3AZI C;  3AYW A;  5B40 A;  4YM6 C;  5GXQ C;  3LJA B;  4J8V A;  1ZLA B;  3V9R B;  3AV1 A;  3MGP D;  1F66 C;  5GXQ A;  5E5A B;  5AVB C;  4H9N B;  3H0L C;  1F66 A;  4J8X B;  5AVB A;  2BG1 A;  5AV5 C;  3REH B;  2L5A A;  4WU9 C;  1KX5 B;  4KGC D;  1ID3 B;  1P3P C;  4ZUX D;  3VH6 T;  1EQZ B;  3KWQ A;  3LJA C;  5AV5 A;  5F99 B;  1P3B D;  4WJ3 C;  1ZLA C;  3VH6 A;  3A6N B;  5E5A C;  1M18 C;  4YS3 D;  3V9R A;  1M19 D;  3AZH B;  2DQN C;  5E5A A;  1HQ3 B;  4J8X C;  1P3L B;  3REH C;  4H9N A;  5CPJ B;  1Q9C A;  5B33 D;  1ID3 C;  2F8N K;  1TAF B;  2HUE B;  4J8X A;  5AV8 B;  5F99 C;  3X1S D;  3REH A;  1EQZ C;  1KX5 A;  4NE3 A;  5CPK D;  3A6N C;  4WU8 D;  1EQZ A;  5B1M B;  5GT3 D;  5F99 A;  3MGR D;  3FDD A;  3WTP B;  4HGA B;  2NZD D;  3B6G C;  3A6N A;  3VH5 T;  3WA9 D;  5BO0 B;  5BS7 C;  4H9Q B;  1HQ3 C;  1P3L C;  5CPJ C;  3VH5 A;  3AZH A;  5BS7 A;  3VH6 W;  4AWL B;  5GSU D;  4DQY B;  2HUE C;  1P3L A;  5AV8 C;  3O62 D;  5CPJ A;  2HIO B;  4XZQ D;  1KX4 D;  5JRG B;  3REI B;  5KDM B;  1TAF A;  5B1M C;  5AV8 A;  5CP6 D;  3WTP C;  4HGA C;  2Y2G A;  5B1L C;  3AZJ B;  5CPI B;  1M1A D;  5B1M A;  3WTP A;  3LZ1 A;  3B0D B;  2IO5 B;  5BO0 A;  4LD9 C;  4AWL C;  5B24 D;  4H9Q A;  3AFA B;  3UTB B;  3LEL D;  4J8W B;  2HIO C;  3B6F D;  5JRG C;  3REI C;  2HIO A;  4DRB A;  4J8U D;  3AZJ C;  3R45 B;  5CPI C;  4WNN B;  3VH5 W;  5AY8 B;  5GT0 C;  5KDM A;  5JRG A;  4JJN B;  3REI A;  3W97 B;  3B0D C;  5DNM D;  5G49 B;  5CPI A;  3KXB D;  3W96 B;  3AFA C;  2ZY2 A;  4CAY B;  5B32 B;  2NQB C;  5DNN D;  3AFA A;  3UTB A;  4J8W A;  3TU4 D;  3NQJ B;  3X1T B;  5AY8 C;  4R8P B;  2Y2O A;  3MGQ C;  4JJN C;  2F8N B;  3W97 C;  3W99 B;  3R45 A;  5AY8 A;  4WNN A;  3AN2 D;  3W96 C;  4JJN A;  3W97 A;  3KUY D;  1BH9 B;  5G49 A;  1Z2C B;  2ZY5 A;  5B32 C;  1P3A D;  3W96 A;  5AV6 D;  4CAY A;  3X1T C;  5B32 A;  4R8P C;  5AV9 B;  1S32 A;  2G5H C;  3W98 A;  2CWE A;  3NQJ A;  3W99 C;  3X1T A;  4R8P A;  3WAA B;  2F8N A;  3X1V D;  3C1B C;  4XUJ C;  1P3F D;  3W99 A;  3AZN D;  1P3K B;  1BH9 A;  4NFT A;  3MNN B;  3H0R C;  2PYO D;  4Z66 D;  3X1U D;  4YM6 B; 
#chains in the Genus database with same CATH homology
 4Z5T B;  3WAA C;  5AV9 A;  2CV5 D;  2ARO A;  4G92 B;  1P3G A;  3MGS B;  2RVQ C;  3WKJ B;  3WAA A;  1N1J B;  4X23 B;  3LZ0 B;  3MNN C;  1P3K A;  4WU9 B;  4YS3 C;  3MGR B;  1P3P B;  3MNN A;  4Z2M H;  2NZD B;  4Z5T C;  3F6T A;  2F8N G;  3AZI A;  2Y2J A;  4G92 C;  4YM6 A;  3AZK D;  1M18 B;  4Z5T A;  3MGS C;  3WKJ C;  4X23 C;  3LZ0 C;  2LY8 A;  3O62 B;  3X1S C;  1R4V A;  3REJ D;  3MGS A;  3WKJ A;  2JCH A;  3C1C B;  1N1J A;  2YFV B;  3B0B A;  3IP4 C;  4X23 A;  3LZ0 A;  3MGR C;  3AZL D;  1U35 B;  2NZD C;  1HTA A;  3WA9 C;  1M1A B;  4WU9 A;  3MGR A;  1P3P A;  2NZD A;  1B67 A;  3LJA A;  4DRA A;  5GSU C;  1ZLA A;  3B6G B;  3O62 C;  1KX3 D;  1M18 A;  3B6F B;  5B2I B;  3C1C C;  1AOI B;  1P3I D;  2BYK B;  3AZE D;  3AZM D;  3O62 A;  5CP6 C;  1U35 C;  3EPK A;  3C1C A;  3REL B;  2YFV A;  1M1A C;  2Y2N A;  1P3O D;  1ID3 A;  4UPK A;  1U35 A;  2FFF B;  1TZY D;  3WTP E;  5B24 C;  3KXB B;  3EPL A;  3AZF D;  5B0Z D;  5B1L B;  1M1A A;  4KUD B;  3LEL C;  3AYW D;  5B40 D;  3B6F C;  5B2I C;  1AOI C;  4J8V D;  3B6G A;  2XD5 A;  2XD1 A;  3UT9 B;  3AV1 D;  4LD9 B;  5B2I A;  3REL C;  1AOI A;  1HQ3 A;  5B2J B;  5DNM C;  3REL A;  1F66 D;  4KUD C;  3KXB C;  5AVC B;  1JFI B;  5AVB D;  3AZG B;  5GT0 B;  2DF4 C;  3KXB A;  4KUD A;  3KWQ D;  5AV5 D;  5B1L A;  2F8N H;  1P3M D;  4QLC B;  3UT9 C;  5B2J C;  1P34 D;  3UT9 A;  4LD9 A;  2NQB B;  5E5A D;  3AN2 C;  5B2J A;  5AVC C;  3AZG C;  3X1V B;  3AV2 B;  1H3O B;  1P3F B;  3MGQ B;  3KFU G;  4J8X D;  5C3I C;  5AVC A;  4M6B A;  3REH D;  5BT1 C;  3AZG A;  1JFI A;  3AZJ A;  1KX5 D;  4QLC C;  5GT0 A;  1BH8 B;  1EQZ D;  5F99 D;  2PYO B;  3UTA B;  4QLC A;  3A6N D;  1W2E A;  4EO5 C;  5B0Y B;  5FUG B;  5B31 B;  3X1V C;  3AV2 C;  1P3F C;  3MVD D;  3AZH D;  2NQB A;  1PZR A;  1P3L D;  2Y2P A;  3A1K A;  3X1V A;  3AV2 A;  1H3O A;  5CPJ D;  1P3F A;  3MGQ A;  2YFW B;  4XUJ B;  5AV8 D;  3C1B B;  2PYO C;  3UTA C;  4Z66 C;  3REK D;  3X1U C;  1BH8 A;  5B0Y C;  2PYO A;  5B31 C;  3WTP D;  3LZ1 D;  4H9O B;  3UTA A;  3MGP B;  3KSY A;  5B0Y A;  5FUG A;  5B31 A;  1F1E A;  3AL0 C;  4G91 B;  4KGC B;  3AZL B;  2HIO D;  4ZUX B;  5JRG D;  3REI D;  2YFW A;  4XUJ A;  3C1B A;  1P3B B;  2Y2L A;  4KHA B;  3MGP C;  3AZK C;  5CPI D;  2UWX A;  4YS3 B;  4H9O A;  3MGP A;  1M19 B;  1KX3 B;  2VQR A;  1WWS A;  5CHL B;  4G91 C;  3AFA D;  5JA4 B;  3UTB D;  1P3I B;  4J8W D;  4KGC C;  3AZM B;  3AZL C;  5B33 B;  4ZUX C;  3X1S B;  1P3B C;  4KGC A;  3AZL A;  5CPK B;  5AY8 D;  4ZUX A;  3EG5 B;  4WU8 B;  3P5J B;  4JJN D;  5GT3 B;  3W97 D;  1P3B A;  3AZF B;  5B31 G;  4KHA A;  1M19 C;  3WA9 B;  1KX3 C;  4YS3 A;  4E44 A;  5BNV B;  1P3I C;  2FJ7 D;  3AZM C;  1M19 A;  5B33 C;  1T3U A;  4ZBJ B;  5B32 D;  1KX3 A;  4CSR B;  5GSU B;  1S32 D;  1P3I A;  5JA4 A;  3W98 D;  5CPK C;  5B33 A;  3X1T D;  4XZQ B;  1KX4 B;  4E45 A;  4R8P D;  4WU8 C;  3NQU B;  5GT3 C;  1TZY C;  2W8S A;  3X1S A;  5CP6 B;  3AZF C;  3W99 D;  5CPK A;  2Y2K A;  4WU8 A;  5B40 C;  5GT3 A;  3KWQ B;  3AZF A;  1P3M B;  3WA9 A;  4ZBJ C;  3AV1 C;  2Y2Q A;  5B24 B;  5BNV A;  3LEL B;  1P34 B;  4XZQ C;  1KX4 C;  4CSR A;  5GSU A;  5AV9 D;  2ARO D;  4J8U B;  4UUZ B;  4XZQ A;  1P3G D;  1KX4 A;  3WAA D;  3NQU A;  5CP6 A;  3KWQ C;  5DNM B;  1P3M C;  1P3K D;  2RVQ D;  1P34 C;  1P3M A;  3MNN D;  5B24 A;  5DNN B;  3LEL A;  3AZI D;  1P34 A;  3TU4 B;  4YM6 D;  4J8U C;  3B6F A;  5GXQ D;  4Z5T D;  3MVD B;  2BYK A;  2ZM5 A;  4J8U A;  1KX5 C;  4UUZ A;  3AN2 B;  2Y2I A;  3MGS D;  4H9P B;  3WKJ D;  4X23 D;  3LZ0 D;  3KUY B;  5DNM A;  3REK B;  1P3A B;  5C3I B;  5DNN C;  5AV6 B;  4WU9 D;  2BYM B;  1P3P D;  3TU4 C;  3LZ1 B;  3MVD C;  3AZH C;  3LJA D;  2ZY4 A;  5DNN A;  1ZLA D;  3EPH A;  4NE5 A;  3TU4 A;  2F2A C;  1M18 D;  3MVD A;  4EO5 B;  3KUY C;  3AZN B;  3REK C;  3AN2 A;  4H9P A;  3C1C D;  1P3A C;  5AV6 C;  3KUY A;  1ID3 D;  3LZ1 C;  3REK A;  1U35 D;  1P3A A;  5AV6 A;  4Z66 B;  2BYM A;  3X1U B;  2CV5 B;  3B6G D;  3AZN C;  5B2I D;  1AOI D;  1HQ3 D;  3A1I A;  2JSS A;  3AZN A;  3REL D;  4NE6 A;  2JE5 A;  2IO5 C;  2G5I C;  5B1M D;  4KUD D;  3B0C T;  4H9R B;  4Z66 A;  2CV5 C;  1WWI A;  5B1L D;  3H0M C;  3X1U A;  3UTB C;  4Z2M G;  4J8W C;  3AZK B;  2FJ7 B;  2CV5 A;  1S32 B;  2ZY3 A;  3W98 B;  3UT9 D;  3REJ B;  4LD9 D;  1KU5 A;  5B2J D;  5AVC D;  3AZG D;  2J8P A;  3AZJ D;  2FJ7 C;  5GT0 D;  4H9R A;  5BT1 D;  1S32 C;  1BFM A;  3W98 C;  3AZK A;  4QLC D;  2FJ7 A;  1B6W A;  4H9S C;  3REJ C;  3AZE B;  4WV4 B;  2ARO B;  4H9S A;  4WZS B;  3REJ A;  2NQB D;  1P3G B;  3B0C W;  5BNX B;  3AV2 D;  1P3O B;  3MGQ D;  1TZY B;  5B0Z B;  3AYW B;  2Y2M A;  5B40 B;  3W96 D;  4J8V B;  5AV9 C;  3AZE C;  3UTA D;  3AZI B;  2ARO C;  3AV1 B;  3EPJ A;  5GXQ B;  1P3G C;  2RIQ A;  5B0Y D;  3AZE A;  3AZM A;  5B31 D;  1P3O C;  1F66 B;  1P3K C;  2F8N D;  1ULY A;  5BNX A;  5AVB B;  5B0Z C;  1P3O A;  1A7W A;  2Y2H A;  3AYW C;  1TZY A;  5B32 G;  3C1B D;  4XUJ D;  5AV5 B;  5B0Z A;  4J8V C;  3AZI C;  3AYW A;  5B40 A;  4YM6 C;  5GXQ C;  3LJA B;  4J8V A;  1ZLA B;  3V9R B;  3AV1 A;  3MGP D;  1F66 C;  5GXQ A;  5E5A B;  5AVB C;  4H9N B;  3H0L C;  1F66 A;  4J8X B;  5AVB A;  2BG1 A;  5AV5 C;  3REH B;  2L5A A;  4WU9 C;  1KX5 B;  4KGC D;  1ID3 B;  1P3P C;  4ZUX D;  3VH6 T;  1EQZ B;  3KWQ A;  3LJA C;  5AV5 A;  5F99 B;  1P3B D;  4WJ3 C;  1ZLA C;  3VH6 A;  3A6N B;  5E5A C;  1M18 C;  4YS3 D;  3V9R A;  1M19 D;  3AZH B;  2DQN C;  5E5A A;  1HQ3 B;  4J8X C;  1P3L B;  3REH C;  4H9N A;  5CPJ B;  1Q9C A;  5B33 D;  1ID3 C;  2F8N K;  1TAF B;  2HUE B;  4J8X A;  5AV8 B;  5F99 C;  3X1S D;  3REH A;  1EQZ C;  1KX5 A;  4NE3 A;  5CPK D;  3A6N C;  4WU8 D;  1EQZ A;  5B1M B;  5GT3 D;  5F99 A;  3MGR D;  3FDD A;  3WTP B;  4HGA B;  2NZD D;  3B6G C;  3A6N A;  3VH5 T;  3WA9 D;  5BO0 B;  5BS7 C;  4H9Q B;  1HQ3 C;  1P3L C;  5CPJ C;  3VH5 A;  3AZH A;  5BS7 A;  3VH6 W;  4AWL B;  5GSU D;  4DQY B;  2HUE C;  1P3L A;  5AV8 C;  3O62 D;  5CPJ A;  2HIO B;  4XZQ D;  1KX4 D;  5JRG B;  3REI B;  5KDM B;  1TAF A;  5B1M C;  5AV8 A;  5CP6 D;  3WTP C;  4HGA C;  2Y2G A;  5B1L C;  3AZJ B;  5CPI B;  1M1A D;  5B1M A;  3WTP A;  3LZ1 A;  3B0D B;  2IO5 B;  5BO0 A;  4LD9 C;  4AWL C;  5B24 D;  4H9Q A;  3AFA B;  3UTB B;  3LEL D;  4J8W B;  2HIO C;  3B6F D;  5JRG C;  3REI C;  2HIO A;  4DRB A;  4J8U D;  3AZJ C;  3R45 B;  5CPI C;  4WNN B;  3VH5 W;  5AY8 B;  5GT0 C;  5KDM A;  5JRG A;  4JJN B;  3REI A;  3W97 B;  3B0D C;  5DNM D;  5G49 B;  5CPI A;  3KXB D;  3W96 B;  3AFA C;  2ZY2 A;  4CAY B;  5B32 B;  2NQB C;  5DNN D;  3AFA A;  3UTB A;  4J8W A;  3TU4 D;  3NQJ B;  3X1T B;  5AY8 C;  4R8P B;  2Y2O A;  3MGQ C;  4JJN C;  2F8N B;  3W97 C;  3W99 B;  3R45 A;  5AY8 A;  4WNN A;  3AN2 D;  3W96 C;  4JJN A;  3W97 A;  3KUY D;  1BH9 B;  5G49 A;  1Z2C B;  2ZY5 A;  5B32 C;  1P3A D;  3W96 A;  5AV6 D;  4CAY A;  3X1T C;  5B32 A;  4R8P C;  5AV9 B;  1S32 A;  2G5H C;  3W98 A;  2CWE A;  3NQJ A;  3W99 C;  3X1T A;  4R8P A;  3WAA B;  2F8N A;  3X1V D;  3C1B C;  4XUJ C;  1P3F D;  3W99 A;  3AZN D;  1P3K B;  1BH9 A;  4NFT A;  3MNN B;  3H0R C;  2PYO D;  4Z66 D;  3X1U D;  4YM6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...