5GT3B

Crystal structure of nucleosome particle in the presence of human testis-specific histone variant, hth2b
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
81
structure length
81
Chain Sequence
b'LRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Structural analyses of the nucleosome complexes with human testis-specific histone variants, hTh2a and hTh2b
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 27
structure length 81
sequence length 81
chains with identical sequence F
ec nomenclature
pdb deposition date 2016-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5gt3B00
1B6WA 5B0YC 3MNNB 1KX3B 4WV4B 3AZFB 1HTAA 2AROA 4KGCA 4YM6C 3AV1B 3A6NC 4CSRB 5FUGA 4UUZA 3WKJC 1HQ3C 4YS3A 2F8NH 1M18B 4KUDA 1P3OB 2AROC 4Z66B 4KGCC 3WTPE 4J8UD 4YS3C 4KUDC 3TU4B 3KSYA 3X1UA 4ZBJB 4H9OA 3VH6W 3AN2D 1ZLAA 4J8XB 3MGQA 3W96A 2CV5D 5GSUD 3B6FB 5E5AD 5GXQA 3REID 4CAYA 3X1UC 3AZKD 3UT9A 3X1SD 1ZLAC 3MGQC 3W96C 1BFMA 2YFVB 4XUJD 5CP6D 3W97B 5GXQC 2L5AA 2HIOA 3AZND 4H9PA 1P3PD 3AYWD 3UT9C 3V9RB 5CPKB 1S32A 4LD9D 1BH8A 4WU9D 2HIOC 2NQBA 2F8NA 5B0YD 1P3MD 1S32C 5G49A 3W99D 3W98B 3AV2B 1TZYD 1F66B 1P3AA 2NQBC 1KX4B 2BYKA 4KGCD 3AZGA 4H9NA 3LELB 5B0ZB 4QLCB 2AROB 3MGSA 1P3AC 4YS3D 2PYOD 3O62B 4XZQA 3KXBD 5FUGB 3AZGC 3C1BB 3MGSC 3LJAB 4R8PA 4NFTA 3X1UD 4XZQC 3AFAB 1BH9B 5GT0B 1U35B 5KDMA 4H9OB 1P3KA 1P3FB 5GXQD 3W96B 4J8WA 1KU5A 4R8PC 5BO0A 3AZFA 1M1AA 4CAYB 5BS7A 1P3KC 4WNNB 3AV1A 4E44A 3AZLD 4H9RB 2HUEB 3C1CA 4J8WC 1M18A 1P3OA 2HIOB 5AVCB 3AZFC 1M1AC 1P3BB 1S32B 3MGRB 5BS7C 3AV1C 4H9QB 5B33D 3WAAB 3C1CC 1BH8B 3TU4A 5B1LB 1P3OC 3REJB 1M18C 4KHAB 2NQBB 1ULYA 4J8XA 2F8NB 5AV5B 5B40B 5G49B 1M19B 1EQZA 1P3AD 3TU4C 3X1TD 5C3IC 4J8XC 3AZGD 1TAFB 5AVBA 2YFVA 5B1MA 3W97A 2YFWA 1JFIB 1EQZC 5CPJD 4XZQD 3KUYB 5CPKA 3REKD 5AVBC 1P34B 5B1MC 3W97C 5B2IA 5F99B 5CPKC 3MVDD 3W98A 4WU8B 3AV2A 1P3KD 1F66A 4J8WD 2RVQD 5B2IC 3LZ0D 3MNND 1KX3D 1KX4A 3AZFD 3RELB 3W98C 3AV2C 3AZMB 5B24D 1P3LB 3X1VB 1F66C 3LELA 5B0ZA 1M1AB 4QLCA 3O62A 1KX4C 3C1CB 3AZIB 4Z66D 5B31B 3UTBD 3LELC 5B0ZC 3C1BA 4QLCC 3LJAA 5AY8B 3O62C 2F8NK 3AFAA 2CWEA 1BH9A 3KWQD 5GT0A 1U35A 4ZUXD 2NZDB 3B6FD 1P3FA 3C1BC 5C3IB 3LJAC 3AFAC 1EQZB 5JA4B 5GT0C 1U35C 1KX5B 3W97D 1P3FC 4WNNA 4H9RA 3VH6A 5AVBB 5B1MB 2F8NG 2YFWB 5CPKD 3VH5A 5AVCA 4J8WB 1P3BA 1B67A 5JRGB 3MGRA 2IO5C 4H9QA 3WAAA 2HUEC 4EO5B 5B1LA 3REJA 3MGPB 4KHAA 5AVCC 5AV8A 2FJ7A 1P3BC 5AV5A 5B40A 5B2IB 1P3GC 3MGRC 1F66D 1M19A 3WAAC 2CV5B 4YM6D 5B1LC 1Q9CA 3REJC 3A6ND 3WKJD 1HQ3D 5AV8C 2FJ7C 5AV5C 4AWLB 5B40C 1TAFA 3NQJA 3WA9B 3X1SB 3LELD 1M19C 1R4VA 2AROD 1JFIA 4XUJB 5CPIB 3KUYA 1ID3B 4KUDD 3AYWB 5GT3B 1P34A 3LJAD 4WU9B 3AFAD 3KUYC 5F99A 4WU8A 1P34C 1P3FD 5CHLB 1ZLAD 3W99B 3MGQD 3B6GA 3W96D 5BNXA 3AZHB 5F99C 5B31G 3RELA 4HGAC 5B2JA 3REHB 3UT9D 3AZMA 3X1VA 4WU8C 1P3LA 3B6GC 2IO5B 3B0DB 2HIOD 4X23B 5DNMB 5DNNA 3RELC 2PYOB 3AZIA 4Z5TA 1P3BD 5B31A 5B2JC 3AZMC 1S32D 1P3LC 3X1VC 3WKJA 3WAAD 3AZEB 5B32B 1P3GB 4NE5A 5AY8A 5B1LD 3REJD 3LZ1B 2NQBD 5DNNC 2F8ND 3AZIC 4Z5TC 5B31C 5B40D 4H9SC 2NZDA 5AV8B 5AV6A 3AZJB 2FJ7B 1F1EA 5AY8C 5JA4A 1P3IA 1KX5A 2NZDC 1AOIB 5AV6C 3NQJB 4J8VB 3MGSD 1H3OB 3AZLB 1P3IC 5JRGA 1P34D 1KX5C 3B0CT 3VH5T 2BYMB 5B33B 5F99D 5AV9B 3MGPA 4R8PD 4G92C 5JRGC 4HGAB 2CV5A 4EO5C 5E5AA 4Z2MH 3WTPB 3B6GB 3MGPC 5BNXB 3RELD 3REIA 3AZKA 3X1VD 3WA9A 3X1SA 1M1AD 5B2JB 2CV5C 4XUJA 4NE3A 5E5AC 3AV1D 5CPIA 1ID3A 4JJNB 3C1CD 3REIC 3AZID 5CPJB 1P3PA 5B31D 3AZKC 1P3OD 4AWLC 3AYWA 1M18D 3WA9C 5GT3A 3X1SC 5DNNB 4Z5TB 3REKB 2LY8A 5AY8D 4LD9A 4XUJC 4WU9A 4NE6A 5CPIC 1ID3C 1P3PC 1P3MA 3TU4D 3AYWC 2NZDD 5GT3C 3MVDB 3W99A 4J8XD 3UTAB 1TZYA 4LD9C 4WU9C 5AV6B 1EQZD 3AZHA 1P3MC 3LZ0B 3REHA 1KX5D 5B32G 1P3IB 3W99C 5B24B 5AVBD 1TZYC 5BNVA 5B1MD 4X23A 5DNMA 3AZHC 2PYOA 1A7WA 3KXBA 5JRGD 3REHC 3UTBB 3AZEA 5B32A 2JSSA 4G92B 1P3GA 3B0DC 4X23C 5DNMC 3MGPD 3LZ1A 2PYOC 4J8UB 5B2ID 1N1JA 3KXBC 1WWSA 3NQUA 3KWQB 3AZJA 4ZUXB 3B0CW 3AZEC 3AV2D 5B32C 3W98D 4G91C 3VH5W 4DRAA 3AN2B 4WZSB 3LZ1C 5GSUB 5E5AB 3WA9D 1KX4D 3REIB 1AOIA 3AZJC 3AZKB 5B0ZD 5CPID 4J8VA 4QLCD 1H3OA 3AZLA 1ID3D 5CP6B 3O62D 3B0BA 4E45A 5GT3D 3AZNB 1AOIC 1P3PB 3C1BD 4J8VC 2BYMA 5B33A 3AZLC 5AV9A 4LD9B 5GT0D 5B0YB 1U35D 1P3MB 5B33C 3AZHD 3WTPA 5AV9C 1TZYB 4YM6B 3X1TA 3A6NB 3REHD 3WKJB 1HQ3B 5BT1C 4X23D 4KGCB 5DNMD 3WTPC 4JJNA 5BNVB 5CPJA 3X1TC 4UUZB 5AVCD 4YS3B 4KUDB 3R45A 3REKA 5B32D 3KXBB 3AZED 4H9SA 1P3GD 3MGRD 3LZ1D 4JJNC 4G91B 5CPJC 3MVDA 5AV8D 3AZJD 2FJ7D 3X1UB 3REKC 5AV5D 3UTAA 1N1JB 3NQUB 1ZLAB 1M19D 3MGQB 5GXQB 3LZ0A 3MNNA 1KX3A 3MVDC 1AOID 3UTAC 5B24A 3UT9B 4J8VD 4CSRA 2RVQC 3LZ0C 3MNNC 3KUYD 4H9PB 1KX3C 4Z66A 3UTBA 5B24C 3VH6T 5AV9D 4J8UA 3KWQA 4Z66C 4ZUXA 5BT1D 3UTBC 4WU8D 1WWIA 3AN2A 3B6FA 3WTPD 3B6GD 5GSUA 4ZBJC 4J8UC 3KWQC 1P3AB 4M6BA 4ZUXC 3X1TB 5B2JD 3AZMD 1P3LD 3AN2C 3B6FC 2BYKB 3AZGB 4H9NB 4JJND 5GSUC 5CP6A 3MGSB 3V9RA 3AZNA 5DNND 4Z5TD 4XZQB 3R45B 5CP6C 3AZNC 4R8PB 5B0YA 3UTAD 5AV6D 5KDMB 1P3KB 4YM6A 4Z2MG 3A6NA 4DRBA 1P3ID 1HQ3A 5BO0B
chains in the Genus database with same CATH superfamily
1B6WA 5B0YC 3MNNB 1KX3B 4WV4B 3AZFB 1HTAA 2AROA 4KGCA 4YM6C 3AV1B 3A6NC 4CSRB 5FUGA 4UUZA 3WKJC 1HQ3C 4YS3A 2F8NH 1M18B 4KUDA 1P3OB 2AROC 4Z66B 4KGCC 3WTPE 4J8UD 2JE5A 4YS3C 4KUDC 3TU4B 3KSYA 3X1UA 4ZBJB 4H9OA 3VH6W 3AN2D 1ZLAA 4J8XB 3MGQA 3W96A 2CV5D 5GSUD 3B6FB 5E5AD 5GXQA 3REID 4CAYA 3X1UC 3AZKD 3UT9A 3X1SD 1ZLAC 3MGQC 3W96C 1BFMA 2YFVB 4XUJD 5CP6D 3W97B 5GXQC 2L5AA 2HIOA 3AZND 4H9PA 1P3PD 3AYWD 3UT9C 3V9RB 5CPKB 1S32A 4LD9D 1BH8A 4WU9D 2HIOC 4UPKA 2NQBA 2F8NA 5B0YD 1P3MD 1S32C 5G49A 3W99D 3W98B 3AV2B 1TZYD 1F66B 2Y2MA 1P3AA 2NQBC 1KX4B 2Y2HA 2BYKA 4KGCD 3AZGA 4H9NA 3LELB 5B0ZB 4QLCB 2AROB 3MGSA 1P3AC 4YS3D 2PYOD 3O62B 4XZQA 3KXBD 5FUGB 3AZGC 3C1BB 3MGSC 3LJAB 4R8PA 4NFTA 3X1UD 4XZQC 3AFAB 1BH9B 5GT0B 1U35B 5KDMA 4H9OB 1P3KA 1P3FB 5GXQD 3W96B 4J8WA 1KU5A 4R8PC 5BO0A 3AZFA 1M1AA 4CAYB 3EPJA 2G5IC 5BS7A 1P3KC 4WNNB 3AV1A 4E44A 3AZLD 4H9RB 2HUEB 3C1CA 4J8WC 3AL0C 1M18A 1P3OA 2HIOB 2Y2QA 5AVCB 3AZFC 1M1AC 2F2AC 1P3BB 1S32B 3MGRB 5BS7C 3AV1C 4H9QB 5B33D 3WAAB 3C1CC 1BH8B 3TU4A 5B1LB 1P3OC 3REJB 1M18C 4KHAB 2NQBB 1ULYA 4J8XA 2F8NB 5AV5B 5B40B 5G49B 1M19B 1EQZA 1P3AD 3TU4C 3X1TD 2UWXA 5C3IC 4J8XC 3AZGD 2DF4C 1TAFB 2ZM5A 5AVBA 2YFVA 5B1MA 3W97A 2YFWA 1JFIB 1EQZC 5CPJD 4XZQD 3KUYB 5CPKA 3H0MC 3REKD 5AVBC 1P34B 5B1MC 3W97C 5B2IA 5F99B 5CPKC 3MVDD 3W98A 4WU8B 3AV2A 1P3KD 1F66A 3KFUG 3EG5B 4J8WD 2RVQD 5B2IC 3LZ0D 3MNND 1KX3D 1KX4A 3AZFD 3RELB 3W98C 3AV2C 3AZMB 5B24D 1P3LB 3X1VB 1F66C 3LELA 5B0ZA 1M1AB 2Y2IA 4QLCA 3O62A 2ZY3A 1KX4C 3C1CB 3AZIB 4Z66D 5B31B 3UTBD 2Y2LA 3LELC 5B0ZC 3C1BA 4QLCC 3LJAA 5AY8B 3O62C 2F8NK 3AFAA 2CWEA 1BH9A 3KWQD 5GT0A 1U35A 4ZUXD 2NZDB 3B6FD 1P3FA 3C1BC 5C3IB 3LJAC 3AFAC 1EQZB 5JA4B 5GT0C 1U35C 1KX5B 3W97D 1P3FC 4WNNA 4H9RA 3VH6A 5AVBB 5B1MB 2F8NG 2YFWB 5CPKD 3F6TA 3VH5A 5AVCA 4J8WB 1P3BA 1B67A 5JRGB 3MGRA 2IO5C 4H9QA 3WAAA 2HUEC 2Y2NA 4EO5B 2XD5A 5B1LA 3REJA 2XD1A 3MGPB 4KHAA 5AVCC 5AV8A 2FJ7A 1P3BC 5AV5A 5B40A 5B2IB 1P3GC 3MGRC 1F66D 1M19A 3WAAC 2CV5B 4YM6D 5B1LC 1Q9CA 3REJC 3A6ND 3WKJD 1HQ3D 5AV8C 2FJ7C 5AV5C 4AWLB 5B40C 1TAFA 3NQJA 3WA9B 2JCHA 3X1SB 3LELD 1M19C 1R4VA 2AROD 1JFIA 4XUJB 5CPIB 3KUYA 1ID3B 2J8PA 2W8SA 4KUDD 3AYWB 5GT3B 1P34A 3LJAD 4WU9B 3AFAD 3KUYC 5F99A 2FFFB 4WU8A 1P34C 1P3FD 5CHLB 1ZLAD 3W99B 3MGQD 3B6GA 3W96D 5BNXA 3AZHB 5B31G 5F99C 3RELA 4HGAC 5B2JA 3REHB 3UT9D 3AZMA 3X1VA 4WU8C 1P3LA 3B6GC 3A1IA 2IO5B 2ZY2A 3B0DB 3EPHA 2HIOD 4X23B 5DNMB 5DNNA 3RELC 2PYOB 3AZIA 4Z5TA 1P3BD 5B31A 5B2JC 1PZRA 3AZMC 1S32D 1P3LC 3X1VC 3WKJA 3WAAD 3AZEB 5B32B 1P3GB 4NE5A 5AY8A 5B1LD 3REJD 3LZ1B 2NQBD 5DNNC 2F8ND 3AZIC 4Z5TC 5B31C 5B40D 4H9SC 2NZDA 5AV8B 5AV6A 3AZJB 2FJ7B 1F1EA 5AY8C 5JA4A 1P3IA 1KX5A 2NZDC 1AOIB 5AV6C 3NQJB 4J8VB 3MGSD 1H3OB 3AZLB 1P3IC 5JRGA 1P34D 1KX5C 3B0CT 3VH5T 2BYMB 5B33B 5F99D 2RIQA 5AV9B 3MGPA 4R8PD 3EPKA 4G92C 5JRGC 4HGAB 2CV5A 4EO5C 5E5AA 4Z2MH 3WTPB 3B6GB 2Y2PA 5BNXB 3MGPC 3REIA 3RELD 3AZKA 3X1VD 3WA9A 2DQNC 3X1SA 1M1AD 5B2JB 2CV5C 4XUJA 4NE3A 5E5AC 3AV1D 5CPIA 1ID3A 4JJNB 3C1CD 3REIC 3AZID 5CPJB 1P3PA 5B31D 3AZKC 1P3OD 4AWLC 3AYWA 1M18D 3WA9C 5GT3A 3X1SC 5DNNB 4Z5TB 3REKB 2LY8A 5AY8D 4LD9A 4XUJC 4WU9A 4NE6A 5CPIC 1ID3C 1P3PC 1P3MA 3TU4D 3AYWC 2NZDD 5GT3C 3MVDB 3W99A 4J8XD 3UTAB 1TZYA 4LD9C 4WU9C 5AV6B 1EQZD 3AZHA 2BG1A 1P3MC 3LZ0B 3REHA 1KX5D 5B32G 1P3IB 3W99C 5B24B 5AVBD 1TZYC 5BNVA 5B1MD 4X23A 5DNMA 3AZHC 2PYOA 2Y2JA 1A7WA 3KXBA 5JRGD 3REHC 3UTBB 3IP4C 5B32A 3AZEA 2JSSA 4G92B 1P3GA 3B0DC 4X23C 5DNMC 3MGPD 3LZ1A 2PYOC 4J8UB 5B2ID 1N1JA 2Y2OA 1WWSA 3NQUA 3KXBC 3KWQB 3EPLA 4ZUXB 3B0CW 3AZEC 3AZJA 5B32C 3AV2D 3W98D 4G91C 3VH5W 4DRAA 3AN2B 4WZSB 3LZ1C 5GSUB 5E5AB 3WA9D 1KX4D 3REIB 1AOIA 3AZJC 3AZKB 4WJ3C 5B0ZD 5CPID 4J8VA 4QLCD 1H3OA 3AZLA 1ID3D 5CP6B 3O62D 3B0BA 4E45A 5GT3D 3AZNB 1AOIC 1P3PB 3P5JB 3C1BD 4J8VC 2BYMA 2Y2GA 5B33A 3AZLC 5AV9A 4LD9B 5GT0D 5B0YB 1U35D 1P3MB 5B33C 3AZHD 3WTPA 2ZY5A 5AV9C 1TZYB 4YM6B 3X1TA 3A6NB 3REHD 1W2EA 3WKJB 1HQ3B 3H0RC 5BT1C 4X23D 1T3UA 5DNMD 2VQRA 3WTPC 4KGCB 3H0LC 4JJNA 5BNVB 5CPJA 3X1TC 4UUZB 5AVCD 4YS3B 4KUDB 3R45A 3REKA 5B32D 3KXBB 3AZED 3A1KA 4H9SA 3MGRD 1P3GD 1Z2CB 3LZ1D 4JJNC 4G91B 5CPJC 3MVDA 5AV8D 3AZJD 2FJ7D 3X1UB 3REKC 5AV5D 3UTAA 1N1JB 3NQUB 1ZLAB 1M19D 3MGQB 4DQYB 5GXQB 3LZ0A 3MNNA 1KX3A 3MVDC 1AOID 3UTAC 5B24A 3UT9B 2Y2KA 4J8VD 4CSRA 2RVQC 3LZ0C 3MNNC 3KUYD 4H9PB 1KX3C 2G5HC 4Z66A 3UTBA 5B24C 3VH6T 5AV9D 4J8UA 3KWQA 4Z66C 3FDDA 4ZUXA 5BT1D 3UTBC 4WU8D 1WWIA 3AN2A 3B6FA 3WTPD 3B6GD 5GSUA 4ZBJC 4J8UC 3KWQC 1P3AB 4M6BA 4ZUXC 3X1TB 5B2JD 3AZMD 1P3LD 3AN2C 3B6FC 2BYKB 3AZGB 4H9NB 4JJND 5GSUC 5CP6A 3MGSB 3V9RA 3AZNA 5DNND 4Z5TD 4XZQB 3R45B 5CP6C 3AZNC 4R8PB 5B0YA 3UTAD 2ZY4A 5AV6D 5KDMB 1P3KB 4YM6A 4Z2MG 3A6NA 4DRBA 1P3ID 1HQ3A 5BO0B
chains in the Genus database with same CATH topology
1B6WA 5B0YC 3MNNB 1KX3B 4WV4B 3AZFB 1HTAA 2AROA 4KGCA 4YM6C 3AV1B 3A6NC 4CSRB 5FUGA 4UUZA 3WKJC 1HQ3C 4YS3A 2F8NH 1M18B 4KUDA 1P3OB 2AROC 4Z66B 4KGCC 3WTPE 4J8UD 2JE5A 4YS3C 4KUDC 3TU4B 3KSYA 3X1UA 4ZBJB 4H9OA 3VH6W 3AN2D 1ZLAA 4J8XB 3MGQA 3W96A 2CV5D 5GSUD 3B6FB 5E5AD 5GXQA 3REID 4CAYA 3X1UC 3AZKD 3UT9A 3X1SD 1ZLAC 3MGQC 3W96C 1BFMA 2YFVB 4XUJD 5CP6D 3W97B 5GXQC 2L5AA 2HIOA 3AZND 4H9PA 1P3PD 3AYWD 3UT9C 3V9RB 5CPKB 1S32A 4LD9D 1BH8A 4WU9D 2HIOC 4UPKA 2NQBA 2F8NA 5B0YD 1P3MD 1S32C 5G49A 3W99D 3W98B 3AV2B 1TZYD 1F66B 2Y2MA 1P3AA 2NQBC 1KX4B 2Y2HA 2BYKA 4KGCD 3AZGA 4H9NA 3LELB 5B0ZB 4QLCB 2AROB 3MGSA 1P3AC 4YS3D 2PYOD 3O62B 4XZQA 3KXBD 5FUGB 3AZGC 3C1BB 3MGSC 3LJAB 4R8PA 4NFTA 3X1UD 4XZQC 3AFAB 1BH9B 5GT0B 1U35B 5KDMA 4H9OB 1P3KA 1P3FB 5GXQD 3W96B 4J8WA 1KU5A 4R8PC 5BO0A 3AZFA 1M1AA 4CAYB 3EPJA 2G5IC 5BS7A 1P3KC 4WNNB 3AV1A 4E44A 3AZLD 4H9RB 2HUEB 3C1CA 4J8WC 3AL0C 1M18A 1P3OA 2HIOB 2Y2QA 5AVCB 3AZFC 1M1AC 2F2AC 1P3BB 1S32B 3MGRB 5BS7C 3AV1C 4H9QB 5B33D 3WAAB 3C1CC 1BH8B 3TU4A 5B1LB 1P3OC 3REJB 1M18C 4KHAB 2NQBB 1ULYA 4J8XA 2F8NB 5AV5B 5B40B 5G49B 1M19B 1EQZA 1P3AD 3TU4C 3X1TD 2UWXA 5C3IC 4J8XC 3AZGD 2DF4C 1TAFB 2ZM5A 5AVBA 2YFVA 5B1MA 3W97A 2YFWA 1JFIB 1EQZC 5CPJD 4XZQD 3KUYB 5CPKA 3H0MC 3REKD 5AVBC 1P34B 5B1MC 3W97C 5B2IA 5F99B 5CPKC 3MVDD 3W98A 4WU8B 3AV2A 1P3KD 1F66A 3KFUG 3EG5B 4J8WD 2RVQD 5B2IC 3LZ0D 3MNND 1KX3D 1KX4A 3AZFD 3RELB 3W98C 3AV2C 3AZMB 5B24D 1P3LB 3X1VB 1F66C 3LELA 5B0ZA 1M1AB 2Y2IA 4QLCA 3O62A 2ZY3A 1KX4C 3C1CB 3AZIB 4Z66D 5B31B 3UTBD 2Y2LA 3LELC 5B0ZC 3C1BA 4QLCC 3LJAA 5AY8B 3O62C 2F8NK 3AFAA 2CWEA 1BH9A 3KWQD 5GT0A 1U35A 4ZUXD 2NZDB 3B6FD 1P3FA 3C1BC 5C3IB 3LJAC 3AFAC 1EQZB 5JA4B 5GT0C 1U35C 1KX5B 3W97D 1P3FC 4WNNA 4H9RA 3VH6A 5AVBB 5B1MB 2F8NG 2YFWB 5CPKD 3F6TA 3VH5A 5AVCA 4J8WB 1P3BA 1B67A 5JRGB 3MGRA 2IO5C 4H9QA 3WAAA 2HUEC 2Y2NA 4EO5B 2XD5A 5B1LA 3REJA 2XD1A 3MGPB 4KHAA 5AVCC 5AV8A 2FJ7A 1P3BC 5AV5A 5B40A 5B2IB 1P3GC 3MGRC 1F66D 1M19A 3WAAC 2CV5B 4YM6D 5B1LC 1Q9CA 3REJC 3A6ND 3WKJD 1HQ3D 5AV8C 2FJ7C 5AV5C 4AWLB 5B40C 1TAFA 3NQJA 3WA9B 2JCHA 3X1SB 3LELD 1M19C 1R4VA 2AROD 1JFIA 4XUJB 5CPIB 3KUYA 1ID3B 2J8PA 2W8SA 4KUDD 3AYWB 5GT3B 1P34A 3LJAD 4WU9B 3AFAD 3KUYC 5F99A 2FFFB 4WU8A 1P34C 1P3FD 5CHLB 1ZLAD 3W99B 3MGQD 3B6GA 3W96D 5BNXA 3AZHB 5B31G 5F99C 3RELA 4HGAC 5B2JA 3REHB 3UT9D 3AZMA 3X1VA 4WU8C 1P3LA 3B6GC 3A1IA 2IO5B 2ZY2A 3B0DB 3EPHA 2HIOD 4X23B 5DNMB 5DNNA 3RELC 2PYOB 3AZIA 4Z5TA 1P3BD 5B31A 5B2JC 1PZRA 3AZMC 1S32D 1P3LC 3X1VC 3WKJA 3WAAD 3AZEB 5B32B 1P3GB 4NE5A 5AY8A 5B1LD 3REJD 3LZ1B 2NQBD 5DNNC 2F8ND 3AZIC 4Z5TC 5B31C 5B40D 4H9SC 2NZDA 5AV8B 5AV6A 3AZJB 2FJ7B 1F1EA 5AY8C 5JA4A 1P3IA 1KX5A 2NZDC 1AOIB 5AV6C 3NQJB 4J8VB 3MGSD 1H3OB 3AZLB 1P3IC 5JRGA 1P34D 1KX5C 3B0CT 3VH5T 2BYMB 5B33B 5F99D 2RIQA 5AV9B 3MGPA 4R8PD 3EPKA 4G92C 5JRGC 4HGAB 2CV5A 4EO5C 5E5AA 4Z2MH 3WTPB 3B6GB 2Y2PA 5BNXB 3MGPC 3REIA 3RELD 3AZKA 3X1VD 3WA9A 2DQNC 3X1SA 1M1AD 5B2JB 2CV5C 4XUJA 4NE3A 5E5AC 3AV1D 5CPIA 1ID3A 4JJNB 3C1CD 3REIC 3AZID 5CPJB 1P3PA 5B31D 3AZKC 1P3OD 4AWLC 3AYWA 1M18D 3WA9C 5GT3A 3X1SC 5DNNB 4Z5TB 3REKB 2LY8A 5AY8D 4LD9A 4XUJC 4WU9A 4NE6A 5CPIC 1ID3C 1P3PC 1P3MA 3TU4D 3AYWC 2NZDD 5GT3C 3MVDB 3W99A 4J8XD 3UTAB 1TZYA 4LD9C 4WU9C 5AV6B 1EQZD 3AZHA 2BG1A 1P3MC 3LZ0B 3REHA 1KX5D 5B32G 1P3IB 3W99C 5B24B 5AVBD 1TZYC 5BNVA 5B1MD 4X23A 5DNMA 3AZHC 2PYOA 2Y2JA 1A7WA 3KXBA 5JRGD 3REHC 3UTBB 3IP4C 5B32A 3AZEA 2JSSA 4G92B 1P3GA 3B0DC 4X23C 5DNMC 3MGPD 3LZ1A 2PYOC 4J8UB 5B2ID 1N1JA 2Y2OA 1WWSA 3NQUA 3KXBC 3KWQB 3EPLA 4ZUXB 3B0CW 3AZEC 3AZJA 5B32C 3AV2D 3W98D 4G91C 3VH5W 4DRAA 3AN2B 4WZSB 3LZ1C 5GSUB 5E5AB 3WA9D 1KX4D 3REIB 1AOIA 3AZJC 3AZKB 4WJ3C 5B0ZD 5CPID 4J8VA 4QLCD 1H3OA 3AZLA 1ID3D 5CP6B 3O62D 3B0BA 4E45A 5GT3D 3AZNB 1AOIC 1P3PB 3P5JB 3C1BD 4J8VC 2BYMA 2Y2GA 5B33A 3AZLC 5AV9A 4LD9B 5GT0D 5B0YB 1U35D 1P3MB 5B33C 3AZHD 3WTPA 2ZY5A 5AV9C 1TZYB 4YM6B 3X1TA 3A6NB 3REHD 1W2EA 3WKJB 1HQ3B 3H0RC 5BT1C 4X23D 1T3UA 5DNMD 2VQRA 3WTPC 4KGCB 3H0LC 4JJNA 5BNVB 5CPJA 3X1TC 4UUZB 5AVCD 4YS3B 4KUDB 3R45A 3REKA 5B32D 3KXBB 3AZED 3A1KA 4H9SA 3MGRD 1P3GD 1Z2CB 3LZ1D 4JJNC 4G91B 5CPJC 3MVDA 5AV8D 3AZJD 2FJ7D 3X1UB 3REKC 5AV5D 3UTAA 1N1JB 3NQUB 1ZLAB 1M19D 3MGQB 4DQYB 5GXQB 3LZ0A 3MNNA 1KX3A 3MVDC 1AOID 3UTAC 5B24A 3UT9B 2Y2KA 4J8VD 4CSRA 2RVQC 3LZ0C 3MNNC 3KUYD 4H9PB 1KX3C 2G5HC 4Z66A 3UTBA 5B24C 3VH6T 5AV9D 4J8UA 3KWQA 4Z66C 3FDDA 4ZUXA 5BT1D 3UTBC 4WU8D 1WWIA 3AN2A 3B6FA 3WTPD 3B6GD 5GSUA 4ZBJC 4J8UC 3KWQC 1P3AB 4M6BA 4ZUXC 3X1TB 5B2JD 3AZMD 1P3LD 3AN2C 3B6FC 2BYKB 3AZGB 4H9NB 4JJND 5GSUC 5CP6A 3MGSB 3V9RA 3AZNA 5DNND 4Z5TD 4XZQB 3R45B 5CP6C 3AZNC 4R8PB 5B0YA 3UTAD 2ZY4A 5AV6D 5KDMB 1P3KB 4YM6A 4Z2MG 3A6NA 4DRBA 1P3ID 1HQ3A 5BO0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B6W A;  5B0Y C;  3MNN B;  1KX3 B;  4WV4 B;  3AZF B;  1HTA A;  2ARO A;  4KGC A;  4YM6 C;  3AV1 B;  3A6N C;  4CSR B;  5FUG A;  4UUZ A;  3WKJ C;  1HQ3 C;  4YS3 A;  2F8N H;  1M18 B;  4KUD A;  1P3O B;  2ARO C;  4Z66 B;  4KGC C;  3WTP E;  4J8U D;  4YS3 C;  4KUD C;  3TU4 B;  3KSY A;  3X1U A;  4ZBJ B;  4H9O A;  3VH6 W;  3AN2 D;  1ZLA A;  4J8X B;  3MGQ A;  3W96 A;  2CV5 D;  5GSU D;  3B6F B;  5E5A D;  5GXQ A;  3REI D;  4CAY A;  3X1U C;  3AZK D;  3UT9 A;  3X1S D;  1ZLA C;  3MGQ C;  3W96 C;  1BFM A;  2YFV B;  4XUJ D;  5CP6 D;  3W97 B;  5GXQ C;  2L5A A;  2HIO A;  3AZN D;  4H9P A;  1P3P D;  3AYW D;  3UT9 C;  3V9R B;  5CPK B;  1S32 A;  4LD9 D;  1BH8 A;  4WU9 D;  2HIO C;  2NQB A;  2F8N A;  5B0Y D;  1P3M D;  1S32 C;  5G49 A;  3W99 D;  3W98 B;  3AV2 B;  1TZY D;  1F66 B;  1P3A A;  2NQB C;  1KX4 B;  2BYK A;  4KGC D;  3AZG A;  4H9N A;  3LEL B;  5B0Z B;  4QLC B;  2ARO B;  3MGS A;  1P3A C;  4YS3 D;  2PYO D;  3O62 B;  4XZQ A;  3KXB D;  5FUG B;  3AZG C;  3C1B B;  3MGS C;  3LJA B;  4R8P A;  4NFT A;  3X1U D;  4XZQ C;  3AFA B;  1BH9 B;  5GT0 B;  1U35 B;  5KDM A;  4H9O B;  1P3K A;  1P3F B;  5GXQ D;  3W96 B;  4J8W A;  1KU5 A;  4R8P C;  5BO0 A;  3AZF A;  1M1A A;  4CAY B;  5BS7 A;  1P3K C;  4WNN B;  3AV1 A;  4E44 A;  3AZL D;  4H9R B;  2HUE B;  3C1C A;  4J8W C;  1M18 A;  1P3O A;  2HIO B;  5AVC B;  3AZF C;  1M1A C;  1P3B B;  1S32 B;  3MGR B;  5BS7 C;  3AV1 C;  4H9Q B;  5B33 D;  3WAA B;  3C1C C;  1BH8 B;  3TU4 A;  5B1L B;  1P3O C;  3REJ B;  1M18 C;  4KHA B;  2NQB B;  1ULY A;  4J8X A;  2F8N B;  5AV5 B;  5B40 B;  5G49 B;  1M19 B;  1EQZ A;  1P3A D;  3TU4 C;  3X1T D;  5C3I C;  4J8X C;  3AZG D;  1TAF B;  5AVB A;  2YFV A;  5B1M A;  3W97 A;  2YFW A;  1JFI B;  1EQZ C;  5CPJ D;  4XZQ D;  3KUY B;  5CPK A;  3REK D;  5AVB C;  1P34 B;  5B1M C;  3W97 C;  5B2I A;  5F99 B;  5CPK C;  3MVD D;  3W98 A;  4WU8 B;  3AV2 A;  1P3K D;  1F66 A;  4J8W D;  2RVQ D;  5B2I C;  3LZ0 D;  3MNN D;  1KX3 D;  1KX4 A;  3AZF D;  3REL B;  3W98 C;  3AV2 C;  3AZM B;  5B24 D;  1P3L B;  3X1V B;  1F66 C;  3LEL A;  5B0Z A;  1M1A B;  4QLC A;  3O62 A;  1KX4 C;  3C1C B;  3AZI B;  4Z66 D;  5B31 B;  3UTB D;  3LEL C;  5B0Z C;  3C1B A;  4QLC C;  3LJA A;  5AY8 B;  3O62 C;  2F8N K;  3AFA A;  2CWE A;  1BH9 A;  3KWQ D;  5GT0 A;  1U35 A;  4ZUX D;  2NZD B;  3B6F D;  1P3F A;  3C1B C;  5C3I B;  3LJA C;  3AFA C;  1EQZ B;  5JA4 B;  5GT0 C;  1U35 C;  1KX5 B;  3W97 D;  1P3F C;  4WNN A;  4H9R A;  3VH6 A;  5AVB B;  5B1M B;  2F8N G;  2YFW B;  5CPK D;  3VH5 A;  5AVC A;  4J8W B;  1P3B A;  1B67 A;  5JRG B;  3MGR A;  2IO5 C;  4H9Q A;  3WAA A;  2HUE C;  4EO5 B;  5B1L A;  3REJ A;  3MGP B;  4KHA A;  5AVC C;  5AV8 A;  2FJ7 A;  1P3B C;  5AV5 A;  5B40 A;  5B2I B;  1P3G C;  3MGR C;  1F66 D;  1M19 A;  3WAA C;  2CV5 B;  4YM6 D;  5B1L C;  1Q9C A;  3REJ C;  3A6N D;  3WKJ D;  1HQ3 D;  5AV8 C;  2FJ7 C;  5AV5 C;  4AWL B;  5B40 C;  1TAF A;  3NQJ A;  3WA9 B;  3X1S B;  3LEL D;  1M19 C;  1R4V A;  2ARO D;  1JFI A;  4XUJ B;  5CPI B;  3KUY A;  1ID3 B;  4KUD D;  3AYW B;  5GT3 B;  1P34 A;  3LJA D;  4WU9 B;  3AFA D;  3KUY C;  5F99 A;  4WU8 A;  1P34 C;  1P3F D;  5CHL B;  1ZLA D;  3W99 B;  3MGQ D;  3B6G A;  3W96 D;  5BNX A;  3AZH B;  5F99 C;  5B31 G;  3REL A;  4HGA C;  5B2J A;  3REH B;  3UT9 D;  3AZM A;  3X1V A;  4WU8 C;  1P3L A;  3B6G C;  2IO5 B;  3B0D B;  2HIO D;  4X23 B;  5DNM B;  5DNN A;  3REL C;  2PYO B;  3AZI A;  4Z5T A;  1P3B D;  5B31 A;  5B2J C;  3AZM C;  1S32 D;  1P3L C;  3X1V C;  3WKJ A;  3WAA D;  3AZE B;  5B32 B;  1P3G B;  4NE5 A;  5AY8 A;  5B1L D;  3REJ D;  3LZ1 B;  2NQB D;  5DNN C;  2F8N D;  3AZI C;  4Z5T C;  5B31 C;  5B40 D;  4H9S C;  2NZD A;  5AV8 B;  5AV6 A;  3AZJ B;  2FJ7 B;  1F1E A;  5AY8 C;  5JA4 A;  1P3I A;  1KX5 A;  2NZD C;  1AOI B;  5AV6 C;  3NQJ B;  4J8V B;  3MGS D;  1H3O B;  3AZL B;  1P3I C;  5JRG A;  1P34 D;  1KX5 C;  3B0C T;  3VH5 T;  2BYM B;  5B33 B;  5F99 D;  5AV9 B;  3MGP A;  4R8P D;  4G92 C;  5JRG C;  4HGA B;  2CV5 A;  4EO5 C;  5E5A A;  4Z2M H;  3WTP B;  3B6G B;  3MGP C;  5BNX B;  3REL D;  3REI A;  3AZK A;  3X1V D;  3WA9 A;  3X1S A;  1M1A D;  5B2J B;  2CV5 C;  4XUJ A;  4NE3 A;  5E5A C;  3AV1 D;  5CPI A;  1ID3 A;  4JJN B;  3C1C D;  3REI C;  3AZI D;  5CPJ B;  1P3P A;  5B31 D;  3AZK C;  1P3O D;  4AWL C;  3AYW A;  1M18 D;  3WA9 C;  5GT3 A;  3X1S C;  5DNN B;  4Z5T B;  3REK B;  2LY8 A;  5AY8 D;  4LD9 A;  4XUJ C;  4WU9 A;  4NE6 A;  5CPI C;  1ID3 C;  1P3P C;  1P3M A;  3TU4 D;  3AYW C;  2NZD D;  5GT3 C;  3MVD B;  3W99 A;  4J8X D;  3UTA B;  1TZY A;  4LD9 C;  4WU9 C;  5AV6 B;  1EQZ D;  3AZH A;  1P3M C;  3LZ0 B;  3REH A;  1KX5 D;  5B32 G;  1P3I B;  3W99 C;  5B24 B;  5AVB D;  1TZY C;  5BNV A;  5B1M D;  4X23 A;  5DNM A;  3AZH C;  2PYO A;  1A7W A;  3KXB A;  5JRG D;  3REH C;  3UTB B;  3AZE A;  5B32 A;  2JSS A;  4G92 B;  1P3G A;  3B0D C;  4X23 C;  5DNM C;  3MGP D;  3LZ1 A;  2PYO C;  4J8U B;  5B2I D;  1N1J A;  3KXB C;  1WWS A;  3NQU A;  3KWQ B;  3AZJ A;  4ZUX B;  3B0C W;  3AZE C;  3AV2 D;  5B32 C;  3W98 D;  4G91 C;  3VH5 W;  4DRA A;  3AN2 B;  4WZS B;  3LZ1 C;  5GSU B;  5E5A B;  3WA9 D;  1KX4 D;  3REI B;  1AOI A;  3AZJ C;  3AZK B;  5B0Z D;  5CPI D;  4J8V A;  4QLC D;  1H3O A;  3AZL A;  1ID3 D;  5CP6 B;  3O62 D;  3B0B A;  4E45 A;  5GT3 D;  3AZN B;  1AOI C;  1P3P B;  3C1B D;  4J8V C;  2BYM A;  5B33 A;  3AZL C;  5AV9 A;  4LD9 B;  5GT0 D;  5B0Y B;  1U35 D;  1P3M B;  5B33 C;  3AZH D;  3WTP A;  5AV9 C;  1TZY B;  4YM6 B;  3X1T A;  3A6N B;  3REH D;  3WKJ B;  1HQ3 B;  5BT1 C;  4X23 D;  4KGC B;  5DNM D;  3WTP C;  4JJN A;  5BNV B;  5CPJ A;  3X1T C;  4UUZ B;  5AVC D;  4YS3 B;  4KUD B;  3R45 A;  3REK A;  5B32 D;  3KXB B;  3AZE D;  4H9S A;  1P3G D;  3MGR D;  3LZ1 D;  4JJN C;  4G91 B;  5CPJ C;  3MVD A;  5AV8 D;  3AZJ D;  2FJ7 D;  3X1U B;  3REK C;  5AV5 D;  3UTA A;  1N1J B;  3NQU B;  1ZLA B;  1M19 D;  3MGQ B;  5GXQ B;  3LZ0 A;  3MNN A;  1KX3 A;  3MVD C;  1AOI D;  3UTA C;  5B24 A;  3UT9 B;  4J8V D;  4CSR A;  2RVQ C;  3LZ0 C;  3MNN C;  3KUY D;  4H9P B;  1KX3 C;  4Z66 A;  3UTB A;  5B24 C;  3VH6 T;  5AV9 D;  4J8U A;  3KWQ A;  4Z66 C;  4ZUX A;  5BT1 D;  3UTB C;  4WU8 D;  1WWI A;  3AN2 A;  3B6F A;  3WTP D;  3B6G D;  5GSU A;  4ZBJ C;  4J8U C;  3KWQ C;  1P3A B;  4M6B A;  4ZUX C;  3X1T B;  5B2J D;  3AZM D;  1P3L D;  3AN2 C;  3B6F C;  2BYK B;  3AZG B;  4H9N B;  4JJN D;  5GSU C;  5CP6 A;  3MGS B;  3V9R A;  3AZN A;  5DNN D;  4Z5T D;  4XZQ B;  3R45 B;  5CP6 C;  3AZN C;  4R8P B;  5B0Y A;  3UTA D;  5AV6 D;  5KDM B;  1P3K B;  4YM6 A;  4Z2M G;  3A6N A;  4DRB A;  1P3I D;  1HQ3 A;  5BO0 B; 
#chains in the Genus database with same CATH topology
 1B6W A;  5B0Y C;  3MNN B;  1KX3 B;  4WV4 B;  3AZF B;  1HTA A;  2ARO A;  4KGC A;  4YM6 C;  3AV1 B;  3A6N C;  4CSR B;  5FUG A;  4UUZ A;  3WKJ C;  1HQ3 C;  4YS3 A;  2F8N H;  1M18 B;  4KUD A;  1P3O B;  2ARO C;  4Z66 B;  4KGC C;  3WTP E;  4J8U D;  2JE5 A;  4YS3 C;  4KUD C;  3TU4 B;  3KSY A;  3X1U A;  4ZBJ B;  4H9O A;  3VH6 W;  3AN2 D;  1ZLA A;  4J8X B;  3MGQ A;  3W96 A;  2CV5 D;  5GSU D;  3B6F B;  5E5A D;  5GXQ A;  3REI D;  4CAY A;  3X1U C;  3AZK D;  3UT9 A;  3X1S D;  1ZLA C;  3MGQ C;  3W96 C;  1BFM A;  2YFV B;  4XUJ D;  5CP6 D;  3W97 B;  5GXQ C;  2L5A A;  2HIO A;  3AZN D;  4H9P A;  1P3P D;  3AYW D;  3UT9 C;  3V9R B;  5CPK B;  1S32 A;  4LD9 D;  1BH8 A;  4WU9 D;  2HIO C;  4UPK A;  2NQB A;  2F8N A;  5B0Y D;  1P3M D;  1S32 C;  5G49 A;  3W99 D;  3W98 B;  3AV2 B;  1TZY D;  1F66 B;  2Y2M A;  1P3A A;  2NQB C;  1KX4 B;  2Y2H A;  2BYK A;  4KGC D;  3AZG A;  4H9N A;  3LEL B;  5B0Z B;  4QLC B;  2ARO B;  3MGS A;  1P3A C;  4YS3 D;  2PYO D;  3O62 B;  4XZQ A;  3KXB D;  5FUG B;  3AZG C;  3C1B B;  3MGS C;  3LJA B;  4R8P A;  4NFT A;  3X1U D;  4XZQ C;  3AFA B;  1BH9 B;  5GT0 B;  1U35 B;  5KDM A;  4H9O B;  1P3K A;  1P3F B;  5GXQ D;  3W96 B;  4J8W A;  1KU5 A;  4R8P C;  5BO0 A;  3AZF A;  1M1A A;  4CAY B;  3EPJ A;  2G5I C;  5BS7 A;  1P3K C;  4WNN B;  3AV1 A;  4E44 A;  3AZL D;  4H9R B;  2HUE B;  3C1C A;  4J8W C;  3AL0 C;  1M18 A;  1P3O A;  2HIO B;  2Y2Q A;  5AVC B;  3AZF C;  1M1A C;  2F2A C;  1P3B B;  1S32 B;  3MGR B;  5BS7 C;  3AV1 C;  4H9Q B;  5B33 D;  3WAA B;  3C1C C;  1BH8 B;  3TU4 A;  5B1L B;  1P3O C;  3REJ B;  1M18 C;  4KHA B;  2NQB B;  1ULY A;  4J8X A;  2F8N B;  5AV5 B;  5B40 B;  5G49 B;  1M19 B;  1EQZ A;  1P3A D;  3TU4 C;  3X1T D;  2UWX A;  5C3I C;  4J8X C;  3AZG D;  2DF4 C;  1TAF B;  2ZM5 A;  5AVB A;  2YFV A;  5B1M A;  3W97 A;  2YFW A;  1JFI B;  1EQZ C;  5CPJ D;  4XZQ D;  3KUY B;  5CPK A;  3H0M C;  3REK D;  5AVB C;  1P34 B;  5B1M C;  3W97 C;  5B2I A;  5F99 B;  5CPK C;  3MVD D;  3W98 A;  4WU8 B;  3AV2 A;  1P3K D;  1F66 A;  3KFU G;  3EG5 B;  4J8W D;  2RVQ D;  5B2I C;  3LZ0 D;  3MNN D;  1KX3 D;  1KX4 A;  3AZF D;  3REL B;  3W98 C;  3AV2 C;  3AZM B;  5B24 D;  1P3L B;  3X1V B;  1F66 C;  3LEL A;  5B0Z A;  1M1A B;  2Y2I A;  4QLC A;  3O62 A;  2ZY3 A;  1KX4 C;  3C1C B;  3AZI B;  4Z66 D;  5B31 B;  3UTB D;  2Y2L A;  3LEL C;  5B0Z C;  3C1B A;  4QLC C;  3LJA A;  5AY8 B;  3O62 C;  2F8N K;  3AFA A;  2CWE A;  1BH9 A;  3KWQ D;  5GT0 A;  1U35 A;  4ZUX D;  2NZD B;  3B6F D;  1P3F A;  3C1B C;  5C3I B;  3LJA C;  3AFA C;  1EQZ B;  5JA4 B;  5GT0 C;  1U35 C;  1KX5 B;  3W97 D;  1P3F C;  4WNN A;  4H9R A;  3VH6 A;  5AVB B;  5B1M B;  2F8N G;  2YFW B;  5CPK D;  3F6T A;  3VH5 A;  5AVC A;  4J8W B;  1P3B A;  1B67 A;  5JRG B;  3MGR A;  2IO5 C;  4H9Q A;  3WAA A;  2HUE C;  2Y2N A;  4EO5 B;  2XD5 A;  5B1L A;  3REJ A;  2XD1 A;  3MGP B;  4KHA A;  5AVC C;  5AV8 A;  2FJ7 A;  1P3B C;  5AV5 A;  5B40 A;  5B2I B;  1P3G C;  3MGR C;  1F66 D;  1M19 A;  3WAA C;  2CV5 B;  4YM6 D;  5B1L C;  1Q9C A;  3REJ C;  3A6N D;  3WKJ D;  1HQ3 D;  5AV8 C;  2FJ7 C;  5AV5 C;  4AWL B;  5B40 C;  1TAF A;  3NQJ A;  3WA9 B;  2JCH A;  3X1S B;  3LEL D;  1M19 C;  1R4V A;  2ARO D;  1JFI A;  4XUJ B;  5CPI B;  3KUY A;  1ID3 B;  2J8P A;  2W8S A;  4KUD D;  3AYW B;  5GT3 B;  1P34 A;  3LJA D;  4WU9 B;  3AFA D;  3KUY C;  5F99 A;  2FFF B;  4WU8 A;  1P34 C;  1P3F D;  5CHL B;  1ZLA D;  3W99 B;  3MGQ D;  3B6G A;  3W96 D;  5BNX A;  3AZH B;  5B31 G;  5F99 C;  3REL A;  4HGA C;  5B2J A;  3REH B;  3UT9 D;  3AZM A;  3X1V A;  4WU8 C;  1P3L A;  3B6G C;  3A1I A;  2IO5 B;  2ZY2 A;  3B0D B;  3EPH A;  2HIO D;  4X23 B;  5DNM B;  5DNN A;  3REL C;  2PYO B;  3AZI A;  4Z5T A;  1P3B D;  5B31 A;  5B2J C;  1PZR A;  3AZM C;  1S32 D;  1P3L C;  3X1V C;  3WKJ A;  3WAA D;  3AZE B;  5B32 B;  1P3G B;  4NE5 A;  5AY8 A;  5B1L D;  3REJ D;  3LZ1 B;  2NQB D;  5DNN C;  2F8N D;  3AZI C;  4Z5T C;  5B31 C;  5B40 D;  4H9S C;  2NZD A;  5AV8 B;  5AV6 A;  3AZJ B;  2FJ7 B;  1F1E A;  5AY8 C;  5JA4 A;  1P3I A;  1KX5 A;  2NZD C;  1AOI B;  5AV6 C;  3NQJ B;  4J8V B;  3MGS D;  1H3O B;  3AZL B;  1P3I C;  5JRG A;  1P34 D;  1KX5 C;  3B0C T;  3VH5 T;  2BYM B;  5B33 B;  5F99 D;  2RIQ A;  5AV9 B;  3MGP A;  4R8P D;  3EPK A;  4G92 C;  5JRG C;  4HGA B;  2CV5 A;  4EO5 C;  5E5A A;  4Z2M H;  3WTP B;  3B6G B;  2Y2P A;  5BNX B;  3MGP C;  3REI A;  3REL D;  3AZK A;  3X1V D;  3WA9 A;  2DQN C;  3X1S A;  1M1A D;  5B2J B;  2CV5 C;  4XUJ A;  4NE3 A;  5E5A C;  3AV1 D;  5CPI A;  1ID3 A;  4JJN B;  3C1C D;  3REI C;  3AZI D;  5CPJ B;  1P3P A;  5B31 D;  3AZK C;  1P3O D;  4AWL C;  3AYW A;  1M18 D;  3WA9 C;  5GT3 A;  3X1S C;  5DNN B;  4Z5T B;  3REK B;  2LY8 A;  5AY8 D;  4LD9 A;  4XUJ C;  4WU9 A;  4NE6 A;  5CPI C;  1ID3 C;  1P3P C;  1P3M A;  3TU4 D;  3AYW C;  2NZD D;  5GT3 C;  3MVD B;  3W99 A;  4J8X D;  3UTA B;  1TZY A;  4LD9 C;  4WU9 C;  5AV6 B;  1EQZ D;  3AZH A;  2BG1 A;  1P3M C;  3LZ0 B;  3REH A;  1KX5 D;  5B32 G;  1P3I B;  3W99 C;  5B24 B;  5AVB D;  1TZY C;  5BNV A;  5B1M D;  4X23 A;  5DNM A;  3AZH C;  2PYO A;  2Y2J A;  1A7W A;  3KXB A;  5JRG D;  3REH C;  3UTB B;  3IP4 C;  5B32 A;  3AZE A;  2JSS A;  4G92 B;  1P3G A;  3B0D C;  4X23 C;  5DNM C;  3MGP D;  3LZ1 A;  2PYO C;  4J8U B;  5B2I D;  1N1J A;  2Y2O A;  1WWS A;  3NQU A;  3KXB C;  3KWQ B;  3EPL A;  4ZUX B;  3B0C W;  3AZE C;  3AZJ A;  5B32 C;  3AV2 D;  3W98 D;  4G91 C;  3VH5 W;  4DRA A;  3AN2 B;  4WZS B;  3LZ1 C;  5GSU B;  5E5A B;  3WA9 D;  1KX4 D;  3REI B;  1AOI A;  3AZJ C;  3AZK B;  4WJ3 C;  5B0Z D;  5CPI D;  4J8V A;  4QLC D;  1H3O A;  3AZL A;  1ID3 D;  5CP6 B;  3O62 D;  3B0B A;  4E45 A;  5GT3 D;  3AZN B;  1AOI C;  1P3P B;  3P5J B;  3C1B D;  4J8V C;  2BYM A;  2Y2G A;  5B33 A;  3AZL C;  5AV9 A;  4LD9 B;  5GT0 D;  5B0Y B;  1U35 D;  1P3M B;  5B33 C;  3AZH D;  3WTP A;  2ZY5 A;  5AV9 C;  1TZY B;  4YM6 B;  3X1T A;  3A6N B;  3REH D;  1W2E A;  3WKJ B;  1HQ3 B;  3H0R C;  5BT1 C;  4X23 D;  1T3U A;  5DNM D;  2VQR A;  3WTP C;  4KGC B;  3H0L C;  4JJN A;  5BNV B;  5CPJ A;  3X1T C;  4UUZ B;  5AVC D;  4YS3 B;  4KUD B;  3R45 A;  3REK A;  5B32 D;  3KXB B;  3AZE D;  3A1K A;  4H9S A;  3MGR D;  1P3G D;  1Z2C B;  3LZ1 D;  4JJN C;  4G91 B;  5CPJ C;  3MVD A;  5AV8 D;  3AZJ D;  2FJ7 D;  3X1U B;  3REK C;  5AV5 D;  3UTA A;  1N1J B;  3NQU B;  1ZLA B;  1M19 D;  3MGQ B;  4DQY B;  5GXQ B;  3LZ0 A;  3MNN A;  1KX3 A;  3MVD C;  1AOI D;  3UTA C;  5B24 A;  3UT9 B;  2Y2K A;  4J8V D;  4CSR A;  2RVQ C;  3LZ0 C;  3MNN C;  3KUY D;  4H9P B;  1KX3 C;  2G5H C;  4Z66 A;  3UTB A;  5B24 C;  3VH6 T;  5AV9 D;  4J8U A;  3KWQ A;  4Z66 C;  3FDD A;  4ZUX A;  5BT1 D;  3UTB C;  4WU8 D;  1WWI A;  3AN2 A;  3B6F A;  3WTP D;  3B6G D;  5GSU A;  4ZBJ C;  4J8U C;  3KWQ C;  1P3A B;  4M6B A;  4ZUX C;  3X1T B;  5B2J D;  3AZM D;  1P3L D;  3AN2 C;  3B6F C;  2BYK B;  3AZG B;  4H9N B;  4JJN D;  5GSU C;  5CP6 A;  3MGS B;  3V9R A;  3AZN A;  5DNN D;  4Z5T D;  4XZQ B;  3R45 B;  5CP6 C;  3AZN C;  4R8P B;  5B0Y A;  3UTA D;  2ZY4 A;  5AV6 D;  5KDM B;  1P3K B;  4YM6 A;  4Z2M G;  3A6N A;  4DRB A;  1P3I D;  1HQ3 A;  5BO0 B; 
#chains in the Genus database with same CATH homology
 1B6W A;  5B0Y C;  3MNN B;  1KX3 B;  4WV4 B;  3AZF B;  1HTA A;  2ARO A;  4KGC A;  4YM6 C;  3AV1 B;  3A6N C;  4CSR B;  5FUG A;  4UUZ A;  3WKJ C;  1HQ3 C;  4YS3 A;  2F8N H;  1M18 B;  4KUD A;  1P3O B;  2ARO C;  4Z66 B;  4KGC C;  3WTP E;  4J8U D;  2JE5 A;  4YS3 C;  4KUD C;  3TU4 B;  3KSY A;  3X1U A;  4ZBJ B;  4H9O A;  3VH6 W;  3AN2 D;  1ZLA A;  4J8X B;  3MGQ A;  3W96 A;  2CV5 D;  5GSU D;  3B6F B;  5E5A D;  5GXQ A;  3REI D;  4CAY A;  3X1U C;  3AZK D;  3UT9 A;  3X1S D;  1ZLA C;  3MGQ C;  3W96 C;  1BFM A;  2YFV B;  4XUJ D;  5CP6 D;  3W97 B;  5GXQ C;  2L5A A;  2HIO A;  3AZN D;  4H9P A;  1P3P D;  3AYW D;  3UT9 C;  3V9R B;  5CPK B;  1S32 A;  4LD9 D;  1BH8 A;  4WU9 D;  2HIO C;  4UPK A;  2NQB A;  2F8N A;  5B0Y D;  1P3M D;  1S32 C;  5G49 A;  3W99 D;  3W98 B;  3AV2 B;  1TZY D;  1F66 B;  2Y2M A;  1P3A A;  2NQB C;  1KX4 B;  2Y2H A;  2BYK A;  4KGC D;  3AZG A;  4H9N A;  3LEL B;  5B0Z B;  4QLC B;  2ARO B;  3MGS A;  1P3A C;  4YS3 D;  2PYO D;  3O62 B;  4XZQ A;  3KXB D;  5FUG B;  3AZG C;  3C1B B;  3MGS C;  3LJA B;  4R8P A;  4NFT A;  3X1U D;  4XZQ C;  3AFA B;  1BH9 B;  5GT0 B;  1U35 B;  5KDM A;  4H9O B;  1P3K A;  1P3F B;  5GXQ D;  3W96 B;  4J8W A;  1KU5 A;  4R8P C;  5BO0 A;  3AZF A;  1M1A A;  4CAY B;  3EPJ A;  2G5I C;  5BS7 A;  1P3K C;  4WNN B;  3AV1 A;  4E44 A;  3AZL D;  4H9R B;  2HUE B;  3C1C A;  4J8W C;  3AL0 C;  1M18 A;  1P3O A;  2HIO B;  2Y2Q A;  5AVC B;  3AZF C;  1M1A C;  2F2A C;  1P3B B;  1S32 B;  3MGR B;  5BS7 C;  3AV1 C;  4H9Q B;  5B33 D;  3WAA B;  3C1C C;  1BH8 B;  3TU4 A;  5B1L B;  1P3O C;  3REJ B;  1M18 C;  4KHA B;  2NQB B;  1ULY A;  4J8X A;  2F8N B;  5AV5 B;  5B40 B;  5G49 B;  1M19 B;  1EQZ A;  1P3A D;  3TU4 C;  3X1T D;  2UWX A;  5C3I C;  4J8X C;  3AZG D;  2DF4 C;  1TAF B;  2ZM5 A;  5AVB A;  2YFV A;  5B1M A;  3W97 A;  2YFW A;  1JFI B;  1EQZ C;  5CPJ D;  4XZQ D;  3KUY B;  5CPK A;  3H0M C;  3REK D;  5AVB C;  1P34 B;  5B1M C;  3W97 C;  5B2I A;  5F99 B;  5CPK C;  3MVD D;  3W98 A;  4WU8 B;  3AV2 A;  1P3K D;  1F66 A;  3KFU G;  3EG5 B;  4J8W D;  2RVQ D;  5B2I C;  3LZ0 D;  3MNN D;  1KX3 D;  1KX4 A;  3AZF D;  3REL B;  3W98 C;  3AV2 C;  3AZM B;  5B24 D;  1P3L B;  3X1V B;  1F66 C;  3LEL A;  5B0Z A;  1M1A B;  2Y2I A;  4QLC A;  3O62 A;  2ZY3 A;  1KX4 C;  3C1C B;  3AZI B;  4Z66 D;  5B31 B;  3UTB D;  2Y2L A;  3LEL C;  5B0Z C;  3C1B A;  4QLC C;  3LJA A;  5AY8 B;  3O62 C;  2F8N K;  3AFA A;  2CWE A;  1BH9 A;  3KWQ D;  5GT0 A;  1U35 A;  4ZUX D;  2NZD B;  3B6F D;  1P3F A;  3C1B C;  5C3I B;  3LJA C;  3AFA C;  1EQZ B;  5JA4 B;  5GT0 C;  1U35 C;  1KX5 B;  3W97 D;  1P3F C;  4WNN A;  4H9R A;  3VH6 A;  5AVB B;  5B1M B;  2F8N G;  2YFW B;  5CPK D;  3F6T A;  3VH5 A;  5AVC A;  4J8W B;  1P3B A;  1B67 A;  5JRG B;  3MGR A;  2IO5 C;  4H9Q A;  3WAA A;  2HUE C;  2Y2N A;  4EO5 B;  2XD5 A;  5B1L A;  3REJ A;  2XD1 A;  3MGP B;  4KHA A;  5AVC C;  5AV8 A;  2FJ7 A;  1P3B C;  5AV5 A;  5B40 A;  5B2I B;  1P3G C;  3MGR C;  1F66 D;  1M19 A;  3WAA C;  2CV5 B;  4YM6 D;  5B1L C;  1Q9C A;  3REJ C;  3A6N D;  3WKJ D;  1HQ3 D;  5AV8 C;  2FJ7 C;  5AV5 C;  4AWL B;  5B40 C;  1TAF A;  3NQJ A;  3WA9 B;  2JCH A;  3X1S B;  3LEL D;  1M19 C;  1R4V A;  2ARO D;  1JFI A;  4XUJ B;  5CPI B;  3KUY A;  1ID3 B;  2J8P A;  2W8S A;  4KUD D;  3AYW B;  5GT3 B;  1P34 A;  3LJA D;  4WU9 B;  3AFA D;  3KUY C;  5F99 A;  2FFF B;  4WU8 A;  1P34 C;  1P3F D;  5CHL B;  1ZLA D;  3W99 B;  3MGQ D;  3B6G A;  3W96 D;  5BNX A;  3AZH B;  5B31 G;  5F99 C;  3REL A;  4HGA C;  5B2J A;  3REH B;  3UT9 D;  3AZM A;  3X1V A;  4WU8 C;  1P3L A;  3B6G C;  3A1I A;  2IO5 B;  2ZY2 A;  3B0D B;  3EPH A;  2HIO D;  4X23 B;  5DNM B;  5DNN A;  3REL C;  2PYO B;  3AZI A;  4Z5T A;  1P3B D;  5B31 A;  5B2J C;  1PZR A;  3AZM C;  1S32 D;  1P3L C;  3X1V C;  3WKJ A;  3WAA D;  3AZE B;  5B32 B;  1P3G B;  4NE5 A;  5AY8 A;  5B1L D;  3REJ D;  3LZ1 B;  2NQB D;  5DNN C;  2F8N D;  3AZI C;  4Z5T C;  5B31 C;  5B40 D;  4H9S C;  2NZD A;  5AV8 B;  5AV6 A;  3AZJ B;  2FJ7 B;  1F1E A;  5AY8 C;  5JA4 A;  1P3I A;  1KX5 A;  2NZD C;  1AOI B;  5AV6 C;  3NQJ B;  4J8V B;  3MGS D;  1H3O B;  3AZL B;  1P3I C;  5JRG A;  1P34 D;  1KX5 C;  3B0C T;  3VH5 T;  2BYM B;  5B33 B;  5F99 D;  2RIQ A;  5AV9 B;  3MGP A;  4R8P D;  3EPK A;  4G92 C;  5JRG C;  4HGA B;  2CV5 A;  4EO5 C;  5E5A A;  4Z2M H;  3WTP B;  3B6G B;  2Y2P A;  5BNX B;  3MGP C;  3REI A;  3REL D;  3AZK A;  3X1V D;  3WA9 A;  2DQN C;  3X1S A;  1M1A D;  5B2J B;  2CV5 C;  4XUJ A;  4NE3 A;  5E5A C;  3AV1 D;  5CPI A;  1ID3 A;  4JJN B;  3C1C D;  3REI C;  3AZI D;  5CPJ B;  1P3P A;  5B31 D;  3AZK C;  1P3O D;  4AWL C;  3AYW A;  1M18 D;  3WA9 C;  5GT3 A;  3X1S C;  5DNN B;  4Z5T B;  3REK B;  2LY8 A;  5AY8 D;  4LD9 A;  4XUJ C;  4WU9 A;  4NE6 A;  5CPI C;  1ID3 C;  1P3P C;  1P3M A;  3TU4 D;  3AYW C;  2NZD D;  5GT3 C;  3MVD B;  3W99 A;  4J8X D;  3UTA B;  1TZY A;  4LD9 C;  4WU9 C;  5AV6 B;  1EQZ D;  3AZH A;  2BG1 A;  1P3M C;  3LZ0 B;  3REH A;  1KX5 D;  5B32 G;  1P3I B;  3W99 C;  5B24 B;  5AVB D;  1TZY C;  5BNV A;  5B1M D;  4X23 A;  5DNM A;  3AZH C;  2PYO A;  2Y2J A;  1A7W A;  3KXB A;  5JRG D;  3REH C;  3UTB B;  3IP4 C;  5B32 A;  3AZE A;  2JSS A;  4G92 B;  1P3G A;  3B0D C;  4X23 C;  5DNM C;  3MGP D;  3LZ1 A;  2PYO C;  4J8U B;  5B2I D;  1N1J A;  2Y2O A;  1WWS A;  3NQU A;  3KXB C;  3KWQ B;  3EPL A;  4ZUX B;  3B0C W;  3AZE C;  3AZJ A;  5B32 C;  3AV2 D;  3W98 D;  4G91 C;  3VH5 W;  4DRA A;  3AN2 B;  4WZS B;  3LZ1 C;  5GSU B;  5E5A B;  3WA9 D;  1KX4 D;  3REI B;  1AOI A;  3AZJ C;  3AZK B;  4WJ3 C;  5B0Z D;  5CPI D;  4J8V A;  4QLC D;  1H3O A;  3AZL A;  1ID3 D;  5CP6 B;  3O62 D;  3B0B A;  4E45 A;  5GT3 D;  3AZN B;  1AOI C;  1P3P B;  3P5J B;  3C1B D;  4J8V C;  2BYM A;  2Y2G A;  5B33 A;  3AZL C;  5AV9 A;  4LD9 B;  5GT0 D;  5B0Y B;  1U35 D;  1P3M B;  5B33 C;  3AZH D;  3WTP A;  2ZY5 A;  5AV9 C;  1TZY B;  4YM6 B;  3X1T A;  3A6N B;  3REH D;  1W2E A;  3WKJ B;  1HQ3 B;  3H0R C;  5BT1 C;  4X23 D;  1T3U A;  5DNM D;  2VQR A;  3WTP C;  4KGC B;  3H0L C;  4JJN A;  5BNV B;  5CPJ A;  3X1T C;  4UUZ B;  5AVC D;  4YS3 B;  4KUD B;  3R45 A;  3REK A;  5B32 D;  3KXB B;  3AZE D;  3A1K A;  4H9S A;  3MGR D;  1P3G D;  1Z2C B;  3LZ1 D;  4JJN C;  4G91 B;  5CPJ C;  3MVD A;  5AV8 D;  3AZJ D;  2FJ7 D;  3X1U B;  3REK C;  5AV5 D;  3UTA A;  1N1J B;  3NQU B;  1ZLA B;  1M19 D;  3MGQ B;  4DQY B;  5GXQ B;  3LZ0 A;  3MNN A;  1KX3 A;  3MVD C;  1AOI D;  3UTA C;  5B24 A;  3UT9 B;  2Y2K A;  4J8V D;  4CSR A;  2RVQ C;  3LZ0 C;  3MNN C;  3KUY D;  4H9P B;  1KX3 C;  2G5H C;  4Z66 A;  3UTB A;  5B24 C;  3VH6 T;  5AV9 D;  4J8U A;  3KWQ A;  4Z66 C;  3FDD A;  4ZUX A;  5BT1 D;  3UTB C;  4WU8 D;  1WWI A;  3AN2 A;  3B6F A;  3WTP D;  3B6G D;  5GSU A;  4ZBJ C;  4J8U C;  3KWQ C;  1P3A B;  4M6B A;  4ZUX C;  3X1T B;  5B2J D;  3AZM D;  1P3L D;  3AN2 C;  3B6F C;  2BYK B;  3AZG B;  4H9N B;  4JJN D;  5GSU C;  5CP6 A;  3MGS B;  3V9R A;  3AZN A;  5DNN D;  4Z5T D;  4XZQ B;  3R45 B;  5CP6 C;  3AZN C;  4R8P B;  5B0Y A;  3UTA D;  2ZY4 A;  5AV6 D;  5KDM B;  1P3K B;  4YM6 A;  4Z2M G;  3A6N A;  4DRB A;  1P3I D;  1HQ3 A;  5BO0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...