5GT3B

Crystal structure of nucleosome particle in the presence of human testis-specific histone variant, hth2b
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
81
structure length
81
Chain Sequence
LRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analyses of the nucleosome complexes with human testis-specific histone variants, hTh2a and hTh2b
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
molecule keywords Histone H3.1
total genus 27
structure length 81
sequence length 81
chains with identical sequence F
ec nomenclature
pdb deposition date 2016-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5gt3B00
3UTAD 3RELD 1KX5D 4ZUXD 4UUZA 5B32C 3LZ1C 1F66D 4M6BA 3UT9D 5B40D 1KX4A 1P3FB 3REHD 1BFMA 5JRGB 5AY8B 4G91B 4YM6C 1ULYA 1P3LC 5AVBB 3AZED 5B31C 4E45A 2NZDA 4XZQB 5C3IC 5GT3C 1EQZB 1M1AD 1HQ3D 2NQBB 3REKB 3AZNA 4WNNA 4WV4B 3W98D 3REKA 5AVCA 4X23C 3X1VD 5B0ZD 2BYMB 3TU4B 3KWQC 1P3AB 1ID3A 5AV5B 1JFIB 5F99A 4QLCA 4H9NA 5B24A 5B0YB 3C1CC 5AV8D 4R8PD 4JJNA 3X1UD 3A6NA 1KX3B 4H9PA 4CSRB 5AY8A 1KX4C 5CP6B 3WA9D 5G49B 4XUJA 5E5AA 2PYOA 3AV1B 4WNNB 3AZMB 1N1JA 2AROD 3MNND 2YFVB 5AV6B 2FJ7A 1P3PD 5AV8C 5B31D 3C1CD 5GSUB 4AWLC 1R4VA 5CPJA 1EQZA 3WAAD 4LD9A 2CWEA 5B0ZB 4KUDD 4J8VD 3MGPA 3C1BA 1F1EA 3MNNC 5DNNC 3REIA 3AZID 4WU9A 3B6GA 5GSUC 5CP6A 1U35C 3UTAC 3AYWB 3TU4C 3AFAA 3MGSB 3AZKB 4YS3A 3AYWA 3V9RB 1P3GD 1WWSA 3AZHA 4KGCA 4H9NB 3AZGA 3C1BB 3WAAC 5GT0A 2BYKB 2F8NB 4J8XC 3AZLC 5JRGD 3AV2D 1P3PB 3MGPB 5B40C 2JSSA 5AV9C 3LJAC 3REHC 4LD9B 5AV6A 5CPIB 1BH8B 4Z5TD 4ZUXA 5GSUA 5CPIA 4KGCB 1P3BA 1KX4D 1M18C 4DRAA 3REHB 4LD9C 1P34D 3AZMC 2NZDB 3AN2C 3X1TD 4J8WB 5B1MD 3AZJA 1TAFA 2HIOC 3UTBB 5JA4A 3AV1C 1P3ID 3MGSD 5AVBD 4HGAC 3KWQD 5DNND 5AV9D 3B0CT 5C3IB 1S32C 5CP6C 3MVDA 1U35A 5GT3A 4AWLB 3WTPC 3VH6W 5B0YA 4R8PB 3LZ0C 4J8WC 1P3OA 4UUZB 3WKJA 5AY8C 4ZUXC 3X1UB 1F66C 4KHAA 1ZLAB 3NQUA 1P3KD 5GXQD 3REKD 3WA9C 1P3GC 1ZLAA 3AN2D 3X1VA 5B0ZA 1P3OB 2FJ7C 4CAYB 1ID3D 5F99D 4QLCD 3KXBB 1KU5A 3AZKC 4J8UD 1BH9B 1AOIC 3LJAD 4J8WD 3W96A 5BS7C 3KUYA 1H3OB 3UT9B 5DNMA 4KUDC 4H9PB 5B32D 3R45A 3LZ1D 1P3FD 1P3MD 2NQBC 1HTAA 3LJAB 5CPKA 3MNNA 1ID3C 4YM6A 3AZMD 2FJ7D 1BH8A 3TU4D 5B31A 3AZKD 5GXQB 5AV5D 3MVDC 2F8NH 3REJA 1EQZD 3WAAA 5B0YC 4H9SA 3LZ0B 1M19D 3C1BD 3VH6T 3AZJC 3KXBD 4G92B 3AZHC 3AZIA 4KGCC 4WU8B 3VH5A 4G92C 3AZHB 3B6GD 2NQBD 3B0DB 3VH5T 4HGAB 3X1SA 5CP6D 1P3FC 3WA9B 3VH6A 5KDMB 3LZ0D 1M19B 5B1LD 3REJC 4YS3D 3AZFD 3MNNB 3AYWD 4X23D 1P3LA 3RELA 1KX5A 5B32B 3AZHD 3B6GB 4KGCD 5B24C 3AZGD 5GT0D 4J8UC 4NE5A 1H3OA 5JA4B 3C1BC 3UT9A 5JRGA 2CV5C 4Z66B 3X1SC 3W99A 1P3BB 3X1TB 5B33B 5AVCC 5BNVB 4ZUXB 3X1UC 4H9QA 5B2IA 3NQJA 5CPID 1P3MC 4YS3C 4J8XB 3AZLB 2YFVA 4Z2MH 1P3BD 4ZBJB 5E5AB 4WU8D 2F8NA 2PYOB 1HQ3A 2YFWA 3O62B 1WWIA 1S32D 1P34A 1P3KB 5B1MA 4J8XD 3AZLD 1KX3A 3MGSA 4YS3B 4JJNC 3W98A 3RELB 1KX5B 1P3IB 4JJNB 5AV6C 5DNNA 3REIC 5F99C 3MVDD 4QLCB 4Z66D 4JJND 3W97A 1ZLAD 2HIOA 4XZQD 2YFWB 3O62A 3X1VC 1M18B 4WU9C 3KSYA 1M18A 4XUJD 5E5AD 3VH5W 5AVBC 2PYOD 1Q9CA 1TZYB 3MGSC 5BNXB 4YM6B 5CPKC 4J8UB 3LJAA 5CPKB 1P3PA 1N1JB 5B33A 3W97B 3B6FC 1M19C 4XUJB 3WTPA 4H9OA 5B32A 4KUDA 1P3FA 5FUGA 5AV5C 2IO5B 5CPKD 3MGQC 4WU9D 3LELA 3TU4A 4J8VC 4H9RA 4KUDB 5B1LC 3AYWC 3AZFB 5F99B 3REJD 3B0CW 5AV9B 3UT9C 1B67A 3UTAA 1P34C 3RELC 1KX5C 1TZYD 2NQBA 5B2JB 3B0BA 5B40A 3LELC 3O62C 3LELB 5BO0A 5B1LA 1M1AB 3W99B 3MGQA 4X23A 5B32G 5BNVA 1P3LD 4NE3A 4Z5TA 3AV1A 1TAFB 3B0DC 4NE6A 4WU8C 4XZQC 3W96B 3MGRA 3W99D 1P3BC 1BH9A 5KDMA 1P3LB 5B0ZC 3AZJD 3B6GC 3WKJC 1P3AD 1P3IA 5B24B 3AZND 5B2ID 3MGQB 5B2JA 1P3GB 5AV8B 3W98C 3KWQA 3B6FB 1U35D 4CAYA 3X1TC 4WU8A 4E44A 2F8ND 5AVCB 4Z66C 3W97C 4DRBA 3MGRC 5BS7A 1S32A 5B24D 3AZGC 3AZNB 5AV8A 3WKJD 3AZNC 3AZGB 4R8PA 4J8XA 3AZLA 3REKC 5GXQA 3X1UA 1U35B 2HUEC 3AN2A 3AV2C 4XUJC 5AY8D 2CV5A 3A6NC 1B6WA 3MVDB 3C1CB 3KXBC 3UTBA 3KUYB 1P3PC 4Z66A 3R45B 1AOID 2AROA 4EO5C 4X23B 3W97D 4J8WA 4WZSB 3AZJB 4QLCC 3C1CA 5BO0B 3O62D 5CPJD 3MGPC 3KUYD 3W96C 5B40B 4LD9D 1M18D 3LZ1A 4J8VA 4R8PC 3REID 4YM6D 3AZEC 3AZMA 3AZIC 5G49A 4H9RB 3WTPD 3UTAB 4G91C 3B6FA 2NZDC 3AFAD 5JRGC 1P3GA 1ZLAC 1F66B 5DNNB 5GT3B 3V9RA 5B31G 1EQZC 1F66A 3LELD 3W98B 2HUEB 1JFIA 3WTPB 3REHA 3X1SB 5FUGB 5BT1D 2BYMA 4H9OB 5AV6D 3AZEA 1P3MB 2IO5C 5GSUD 1P34B 4Z5TC 5GT0C 2NZDD 1TZYA 3WAAB 3NQJB 1HQ3B 5B1LB 3AZFC 1M1AA 4J8VB 5B33C 4H9QB 5B2IB 3W99C 3MGQD 2LY8A 3X1TA 4EO5B 2RVQD 3AV1D 5CPIC 2HIOB 1KX3C 5AVBA 2AROC 4KHAB 1HQ3C 5B2JC 5AVCD 3AZEB 5DNMB 5AV9A 3A6NB 5GT3D 3MGRD 5GXQC 5B0YD 4CSRA 1P3OD 1P3AA 1TZYC 4Z2MG 1ID3B 1KX3D 5B2JD 4H9SC 1P3KA 3A6ND 4NFTA 3AZIB 2RVQC 4WU9B 1A7WA 3WA9A 3X1VB 3REJB 4J8UA 3WKJB 3LZ1B 5BNXA 5B31B 5CPJB 3W96D 5CPJC 1P3OC 2HIOD 4XZQA 2FJ7B 2CV5D 5DNMD 2L5AA 3WTPE 3UTBD 3MGRB 1P3AC 1P3MA 3MGPD 3KUYC 1AOIA 1P3KC 5GT0B 2F8NK 1AOIB 4Z5TB 2AROB 2CV5B 5E5AC 2PYOC 5B33D 3AFAB 3AZKA 5AV5A 3AFAC 4ZBJC 1KX4B 2F8NG 5CHLB 1M19A 3AN2B 3KXBA 5B1MB 3UTBC 5DNMC 3REIB 3AV2B 5B1MC 3X1SD 5BT1C 3NQUB 1P3IC 3AV2A 3KWQB 1S32B 2BYKA 1M1AC 3LZ0A 3B6FD 5B2IC 3AZFA
chains in the Genus database with same CATH superfamily
3UTAD 3RELD 1KX5D 4ZUXD 4UUZA 5B32C 3LZ1C 1F66D 4M6BA 3UT9D 5B40D 1KX4A 1P3FB 3REHD 1BFMA 5JRGB 5AY8B 4G91B 4YM6C 1ULYA 1P3LC 5AVBB 3AZED 5B31C 4E45A 2NZDA 4XZQB 5C3IC 5GT3C 1EQZB 1M1AD 1HQ3D 2NQBB 3REKB 3AZNA 4WNNA 4WV4B 3W98D 3REKA 5AVCA 4X23C 3X1VD 5B0ZD 2Y2MA 2BYMB 2Y2NA 3IP4C 3TU4B 3KWQC 2ZM5A 1P3AB 1ID3A 5AV5B 1JFIB 5F99A 4QLCA 4H9NA 5B24A 5B0YB 3C1CC 5AV8D 2JE5A 4R8PD 4JJNA 2Y2HA 3X1UD 3A6NA 1KX3B 4H9PA 4CSRB 5AY8A 1KX4C 5CP6B 3WA9D 2Y2QA 5G49B 4XUJA 5E5AA 2PYOA 3AV1B 4WNNB 3AZMB 1N1JA 2AROD 3MNND 2YFVB 5AV6B 2FJ7A 1P3PD 5AV8C 4WJ3C 5B31D 3C1CD 5GSUB 4AWLC 1R4VA 5CPJA 2DQNC 1EQZA 3WAAD 4LD9A 2CWEA 5B0ZB 4KUDD 4J8VD 3MGPA 3C1BA 1T3UA 1F1EA 3MNNC 5DNNC 2RIQA 3REIA 3AZID 1W2EA 4WU9A 3B6GA 5GSUC 5CP6A 1U35C 2G5HC 3UTAC 2ZY3A 3AYWB 3TU4C 3AFAA 3MGSB 3AZKB 4YS3A 3EPHA 3AYWA 3V9RB 1P3GD 1WWSA 2W8SA 3AZHA 4KGCA 4H9NB 3AZGA 3C1BB 3WAAC 5GT0A 2BYKB 2F8NB 4J8XC 3AZLC 5JRGD 3AV2D 1P3PB 3MGPB 4DQYB 5B40C 2JSSA 5AV9C 3LJAC 3REHC 4LD9B 5AV6A 5CPIB 1BH8B 4Z5TD 4ZUXA 5GSUA 2XD1A 5CPIA 4KGCB 1P3BA 1KX4D 1M18C 4DRAA 3EPLA 3REHB 4LD9C 2VQRA 1P34D 3AZMC 2NZDB 3AN2C 3X1TD 4J8WB 5B1MD 3AZJA 1TAFA 2HIOC 3UTBB 5JA4A 3AV1C 1P3ID 3MGSD 5AVBD 4HGAC 3KWQD 5DNND 2JCHA 5AV9D 3B0CT 5C3IB 1S32C 5CP6C 3MVDA 1U35A 5GT3A 4AWLB 3WTPC 3VH6W 5B0YA 4R8PB 1PZRA 3LZ0C 4J8WC 1P3OA 4UUZB 3WKJA 5AY8C 4ZUXC 3X1UB 1F66C 4KHAA 1ZLAB 2Y2GA 3NQUA 1P3KD 5GXQD 3REKD 3WA9C 1P3GC 1ZLAA 3AN2D 3X1VA 3H0LC 5B0ZA 1P3OB 2FJ7C 4CAYB 1ID3D 5F99D 4QLCD 3KXBB 1KU5A 3AZKC 4J8UD 3P5JB 1BH9B 1AOIC 3LJAD 4J8WD 3W96A 5BS7C 3KUYA 1H3OB 3UT9B 5DNMA 4KUDC 4H9PB 5B32D 3R45A 3LZ1D 1P3FD 1P3MD 2NQBC 1HTAA 3LJAB 5CPKA 3MNNA 1ID3C 4YM6A 3AZMD 2FJ7D 1BH8A 3TU4D 5B31A 3AZKD 5GXQB 5AV5D 3MVDC 2F8NH 3REJA 1EQZD 3WAAA 5B0YC 4H9SA 3LZ0B 1M19D 3C1BD 3VH6T 3AZJC 3KXBD 4G92B 3AZHC 3AZIA 4KGCC 4WU8B 3VH5A 4G92C 3AZHB 3B6GD 2NQBD 3B0DB 3VH5T 4HGAB 3X1SA 5CP6D 1P3FC 3WA9B 2G5IC 3VH6A 5KDMB 3LZ0D 1M19B 5B1LD 3REJC 4YS3D 3AZFD 3MNNB 3AYWD 4X23D 1P3LA 3RELA 1KX5A 5B32B 3AZHD 3B6GB 4KGCD 5B24C 3AZGD 5GT0D 4J8UC 4NE5A 1H3OA 5JA4B 3C1BC 3UT9A 5JRGA 2CV5C 4Z66B 3X1SC 3W99A 1P3BB 2Y2JA 3X1TB 5B33B 5AVCC 5BNVB 4ZUXB 3X1UC 2Y2IA 4H9QA 5B2IA 3NQJA 5CPID 1P3MC 4YS3C 4J8XB 3AZLB 2YFVA 4Z2MH 1P3BD 4ZBJB 5E5AB 4WU8D 2F8NA 2PYOB 1HQ3A 2YFWA 3O62B 1WWIA 1S32D 1P34A 1P3KB 5B1MA 2UWXA 4J8XD 3AZLD 1KX3A 3MGSA 4YS3B 4JJNC 3W98A 3RELB 1KX5B 2XD5A 1P3IB 4JJNB 5AV6C 5DNNA 3REIC 5F99C 3MVDD 4QLCB 2Y2PA 3AL0C 4Z66D 4JJND 3W97A 1ZLAD 2HIOA 4XZQD 2YFWB 3O62A 3X1VC 1M18B 4WU9C 3KSYA 1M18A 4XUJD 5E5AD 3VH5W 5AVBC 2PYOD 1Q9CA 1TZYB 3MGSC 5BNXB 4YM6B 3EPJA 5CPKC 2Y2OA 4J8UB 3LJAA 5CPKB 1Z2CB 1P3PA 1N1JB 5B33A 3W97B 3B6FC 1M19C 4XUJB 3WTPA 4H9OA 3H0RC 5B32A 4KUDA 1P3FA 5FUGA 5AV5C 2IO5B 5CPKD 3MGQC 4WU9D 3LELA 3TU4A 4J8VC 4H9RA 4KUDB 5B1LC 2ZY5A 3AYWC 5F99B 3AZFB 3REJD 3B0CW 5AV9B 3UT9C 1B67A 3UTAA 3KFUG 1P34C 3RELC 1KX5C 1TZYD 2NQBA 5B2JB 3B0BA 5B40A 3LELC 3O62C 3LELB 5BO0A 5B1LA 1M1AB 3W99B 2Y2LA 3MGQA 4X23A 5B32G 5BNVA 1P3LD 4NE3A 4Z5TA 3AV1A 1TAFB 3B0DC 4NE6A 4WU8C 2F2AC 4XZQC 3W96B 3MGRA 3W99D 1P3BC 1BH9A 5KDMA 1P3LB 5B0ZC 3AZJD 3B6GC 3WKJC 1P3AD 1P3IA 5B24B 3AZND 5B2ID 3MGQB 5B2JA 1P3GB 5AV8B 3W98C 3KWQA 3B6FB 1U35D 4CAYA 3X1TC 4WU8A 4E44A 2F8ND 5AVCB 4Z66C 3W97C 4DRBA 3MGRC 5BS7A 1S32A 5B24D 3AZGC 3AZNB 5AV8A 3WKJD 3AZNC 3AZGB 4R8PA 4J8XA 3AZLA 3REKC 5GXQA 3X1UA 1U35B 2BG1A 2HUEC 3AN2A 3AV2C 4XUJC 5AY8D 4UPKA 2CV5A 3A6NC 1B6WA 3MVDB 3C1CB 3KXBC 3UTBA 3KUYB 1P3PC 4Z66A 3R45B 1AOID 2AROA 4EO5C 4X23B 3W97D 4J8WA 4WZSB 3AZJB 4QLCC 3C1CA 5BO0B 3O62D 5CPJD 3MGPC 3KUYD 3W96C 2ZY2A 5B40B 4LD9D 1M18D 3LZ1A 4J8VA 4R8PC 3REID 4YM6D 3AZEC 3AZMA 3AZIC 5G49A 4H9RB 3WTPD 3UTAB 4G91C 3B6FA 2NZDC 3AFAD 5JRGC 1P3GA 1ZLAC 1F66B 5DNNB 5GT3B 3V9RA 5B31G 1EQZC 1F66A 3LELD 3W98B 2HUEB 3FDDA 3WTPB 1JFIA 3REHA 3X1SB 5FUGB 5BT1D 3A1KA 2BYMA 4H9OB 5AV6D 3AZEA 1P3MB 2IO5C 5GSUD 1P34B 4Z5TC 5GT0C 2NZDD 1TZYA 3EG5B 3WAAB 3NQJB 1HQ3B 5B1LB 3AZFC 1M1AA 4J8VB 3F6TA 5B33C 4H9QB 5B2IB 3W99C 3MGQD 2LY8A 3X1TA 4EO5B 2RVQD 3AV1D 2FFFB 5CPIC 2HIOB 1KX3C 5AVBA 2AROC 4KHAB 1HQ3C 5B2JC 5AVCD 3AZEB 5DNMB 5AV9A 3A6NB 5GT3D 3MGRD 5GXQC 5B0YD 4CSRA 2ZY4A 1P3OD 1P3AA 1TZYC 4Z2MG 1ID3B 2DF4C 1KX3D 5B2JD 4H9SC 1P3KA 3A6ND 4NFTA 3AZIB 2RVQC 4WU9B 1A7WA 3WA9A 3X1VB 3REJB 4J8UA 3WKJB 3LZ1B 5BNXA 5B31B 5CPJB 3W96D 5CPJC 1P3OC 2HIOD 4XZQA 2FJ7B 2CV5D 5DNMD 2L5AA 3WTPE 3UTBD 3MGRB 3A1IA 1P3AC 3MGPD 3KUYC 1P3MA 2J8PA 2Y2KA 1AOIA 1P3KC 5GT0B 2F8NK 1AOIB 4Z5TB 2AROB 2CV5B 5E5AC 2PYOC 5B33D 3AFAB 3AZKA 5AV5A 3AFAC 4ZBJC 3EPKA 1KX4B 2F8NG 5CHLB 1M19A 3AN2B 3KXBA 5B1MB 3UTBC 5DNMC 3REIB 3AV2B 5B1MC 3H0MC 3X1SD 5BT1C 3NQUB 1P3IC 3AV2A 3KWQB 1S32B 2BYKA 1M1AC 3LZ0A 3B6FD 5B2IC 3AZFA
chains in the Genus database with same CATH topology
3UTAD 3RELD 1KX5D 4ZUXD 4UUZA 5B32C 3LZ1C 1F66D 4M6BA 3UT9D 5B40D 1KX4A 1P3FB 3REHD 1BFMA 5JRGB 5AY8B 4G91B 4YM6C 1ULYA 1P3LC 5AVBB 3AZED 5B31C 4E45A 2NZDA 4XZQB 5C3IC 5GT3C 1EQZB 1M1AD 1HQ3D 2NQBB 3REKB 3AZNA 4WNNA 4WV4B 3W98D 3REKA 5AVCA 4X23C 3X1VD 5B0ZD 2Y2MA 2BYMB 2Y2NA 3IP4C 3TU4B 3KWQC 2ZM5A 1P3AB 1ID3A 5AV5B 1JFIB 5F99A 4QLCA 4H9NA 5B24A 5B0YB 3C1CC 5AV8D 2JE5A 4R8PD 4JJNA 2Y2HA 3X1UD 3A6NA 1KX3B 4H9PA 4CSRB 5AY8A 1KX4C 5CP6B 3WA9D 2Y2QA 5G49B 4XUJA 5E5AA 2PYOA 3AV1B 4WNNB 3AZMB 1N1JA 2AROD 3MNND 2YFVB 5AV6B 2FJ7A 1P3PD 5AV8C 4WJ3C 5B31D 3C1CD 5GSUB 4AWLC 1R4VA 5CPJA 2DQNC 1EQZA 3WAAD 4LD9A 2CWEA 5B0ZB 4KUDD 4J8VD 3MGPA 3C1BA 1T3UA 1F1EA 3MNNC 5DNNC 2RIQA 3REIA 3AZID 1W2EA 4WU9A 3B6GA 5GSUC 5CP6A 1U35C 2G5HC 3UTAC 2ZY3A 3AYWB 3TU4C 3AFAA 3MGSB 3AZKB 4YS3A 3EPHA 3AYWA 3V9RB 1P3GD 1WWSA 2W8SA 3AZHA 4KGCA 4H9NB 3AZGA 3C1BB 3WAAC 5GT0A 2BYKB 2F8NB 4J8XC 3AZLC 5JRGD 3AV2D 1P3PB 3MGPB 4DQYB 5B40C 2JSSA 5AV9C 3LJAC 3REHC 4LD9B 5AV6A 5CPIB 1BH8B 4Z5TD 4ZUXA 5GSUA 2XD1A 5CPIA 4KGCB 1P3BA 1KX4D 1M18C 4DRAA 3EPLA 3REHB 4LD9C 2VQRA 1P34D 3AZMC 2NZDB 3AN2C 3X1TD 4J8WB 5B1MD 3AZJA 1TAFA 2HIOC 3UTBB 5JA4A 3AV1C 1P3ID 3MGSD 5AVBD 4HGAC 3KWQD 5DNND 2JCHA 5AV9D 3B0CT 5C3IB 1S32C 5CP6C 3MVDA 1U35A 5GT3A 4AWLB 3WTPC 3VH6W 5B0YA 4R8PB 1PZRA 3LZ0C 4J8WC 1P3OA 4UUZB 3WKJA 5AY8C 4ZUXC 3X1UB 1F66C 4KHAA 1ZLAB 2Y2GA 3NQUA 1P3KD 5GXQD 3REKD 3WA9C 1P3GC 1ZLAA 3AN2D 3X1VA 3H0LC 5B0ZA 1P3OB 2FJ7C 4CAYB 1ID3D 5F99D 4QLCD 3KXBB 1KU5A 3AZKC 4J8UD 3P5JB 1BH9B 1AOIC 3LJAD 4J8WD 3W96A 5BS7C 3KUYA 1H3OB 3UT9B 5DNMA 4KUDC 4H9PB 5B32D 3R45A 3LZ1D 1P3FD 1P3MD 2NQBC 1HTAA 3LJAB 5CPKA 3MNNA 1ID3C 4YM6A 3AZMD 2FJ7D 1BH8A 3TU4D 5B31A 3AZKD 5GXQB 5AV5D 3MVDC 2F8NH 3REJA 1EQZD 3WAAA 5B0YC 4H9SA 3LZ0B 1M19D 3C1BD 3VH6T 3AZJC 3KXBD 4G92B 3AZHC 3AZIA 4KGCC 4WU8B 3VH5A 4G92C 3AZHB 3B6GD 2NQBD 3B0DB 3VH5T 4HGAB 3X1SA 5CP6D 1P3FC 3WA9B 2G5IC 3VH6A 5KDMB 3LZ0D 1M19B 5B1LD 3REJC 4YS3D 3AZFD 3MNNB 3AYWD 4X23D 1P3LA 3RELA 1KX5A 5B32B 3AZHD 3B6GB 4KGCD 5B24C 3AZGD 5GT0D 4J8UC 4NE5A 1H3OA 5JA4B 3C1BC 3UT9A 5JRGA 2CV5C 4Z66B 3X1SC 3W99A 1P3BB 2Y2JA 3X1TB 5B33B 5AVCC 5BNVB 4ZUXB 3X1UC 2Y2IA 4H9QA 5B2IA 3NQJA 5CPID 1P3MC 4YS3C 4J8XB 3AZLB 2YFVA 4Z2MH 1P3BD 4ZBJB 5E5AB 4WU8D 2F8NA 2PYOB 1HQ3A 2YFWA 3O62B 1WWIA 1S32D 1P34A 1P3KB 5B1MA 2UWXA 4J8XD 3AZLD 1KX3A 3MGSA 4YS3B 4JJNC 3W98A 3RELB 1KX5B 2XD5A 1P3IB 4JJNB 5AV6C 5DNNA 3REIC 5F99C 3MVDD 4QLCB 2Y2PA 3AL0C 4Z66D 4JJND 3W97A 1ZLAD 2HIOA 4XZQD 2YFWB 3O62A 3X1VC 1M18B 4WU9C 3KSYA 1M18A 4XUJD 5E5AD 3VH5W 5AVBC 2PYOD 1Q9CA 1TZYB 3MGSC 5BNXB 4YM6B 3EPJA 5CPKC 2Y2OA 4J8UB 3LJAA 5CPKB 1Z2CB 1P3PA 1N1JB 5B33A 3W97B 3B6FC 1M19C 4XUJB 3WTPA 4H9OA 3H0RC 5B32A 4KUDA 1P3FA 5FUGA 5AV5C 2IO5B 5CPKD 3MGQC 4WU9D 3LELA 3TU4A 4J8VC 4H9RA 4KUDB 5B1LC 2ZY5A 3AYWC 5F99B 3AZFB 3REJD 3B0CW 5AV9B 3UT9C 1B67A 3UTAA 3KFUG 1P34C 3RELC 1KX5C 1TZYD 2NQBA 5B2JB 3B0BA 5B40A 3LELC 3O62C 3LELB 5BO0A 5B1LA 1M1AB 3W99B 2Y2LA 3MGQA 4X23A 5B32G 5BNVA 1P3LD 4NE3A 4Z5TA 3AV1A 1TAFB 3B0DC 4NE6A 4WU8C 2F2AC 4XZQC 3W96B 3MGRA 3W99D 1P3BC 1BH9A 5KDMA 1P3LB 5B0ZC 3AZJD 3B6GC 3WKJC 1P3AD 1P3IA 5B24B 3AZND 5B2ID 3MGQB 5B2JA 1P3GB 5AV8B 3W98C 3KWQA 3B6FB 1U35D 4CAYA 3X1TC 4WU8A 4E44A 2F8ND 5AVCB 4Z66C 3W97C 4DRBA 3MGRC 5BS7A 1S32A 5B24D 3AZGC 3AZNB 5AV8A 3WKJD 3AZNC 3AZGB 4R8PA 4J8XA 3AZLA 3REKC 5GXQA 3X1UA 1U35B 2BG1A 2HUEC 3AN2A 3AV2C 4XUJC 5AY8D 4UPKA 2CV5A 3A6NC 1B6WA 3MVDB 3C1CB 3KXBC 3UTBA 3KUYB 1P3PC 4Z66A 3R45B 1AOID 2AROA 4EO5C 4X23B 3W97D 4J8WA 4WZSB 3AZJB 4QLCC 3C1CA 5BO0B 3O62D 5CPJD 3MGPC 3KUYD 3W96C 2ZY2A 5B40B 4LD9D 1M18D 3LZ1A 4J8VA 4R8PC 3REID 4YM6D 3AZEC 3AZMA 3AZIC 5G49A 4H9RB 3WTPD 3UTAB 4G91C 3B6FA 2NZDC 3AFAD 5JRGC 1P3GA 1ZLAC 1F66B 5DNNB 5GT3B 3V9RA 5B31G 1EQZC 1F66A 3LELD 3W98B 2HUEB 3FDDA 3WTPB 1JFIA 3REHA 3X1SB 5FUGB 5BT1D 3A1KA 2BYMA 4H9OB 5AV6D 3AZEA 1P3MB 2IO5C 5GSUD 1P34B 4Z5TC 5GT0C 2NZDD 1TZYA 3EG5B 3WAAB 3NQJB 1HQ3B 5B1LB 3AZFC 1M1AA 4J8VB 3F6TA 5B33C 4H9QB 5B2IB 3W99C 3MGQD 2LY8A 3X1TA 4EO5B 2RVQD 3AV1D 2FFFB 5CPIC 2HIOB 1KX3C 5AVBA 2AROC 4KHAB 1HQ3C 5B2JC 5AVCD 3AZEB 5DNMB 5AV9A 3A6NB 5GT3D 3MGRD 5GXQC 5B0YD 4CSRA 2ZY4A 1P3OD 1P3AA 1TZYC 4Z2MG 1ID3B 2DF4C 1KX3D 5B2JD 4H9SC 1P3KA 3A6ND 4NFTA 3AZIB 2RVQC 4WU9B 1A7WA 3WA9A 3X1VB 3REJB 4J8UA 3WKJB 3LZ1B 5BNXA 5B31B 5CPJB 3W96D 5CPJC 1P3OC 2HIOD 4XZQA 2FJ7B 2CV5D 5DNMD 2L5AA 3WTPE 3UTBD 3MGRB 3A1IA 1P3AC 3MGPD 3KUYC 1P3MA 2J8PA 2Y2KA 1AOIA 1P3KC 5GT0B 2F8NK 1AOIB 4Z5TB 2AROB 2CV5B 5E5AC 2PYOC 5B33D 3AFAB 3AZKA 5AV5A 3AFAC 4ZBJC 3EPKA 1KX4B 2F8NG 5CHLB 1M19A 3AN2B 3KXBA 5B1MB 3UTBC 5DNMC 3REIB 3AV2B 5B1MC 3H0MC 3X1SD 5BT1C 3NQUB 1P3IC 3AV2A 3KWQB 1S32B 2BYKA 1M1AC 3LZ0A 3B6FD 5B2IC 3AZFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UTA D;  3REL D;  1KX5 D;  4ZUX D;  4UUZ A;  5B32 C;  3LZ1 C;  1F66 D;  4M6B A;  3UT9 D;  5B40 D;  1KX4 A;  1P3F B;  3REH D;  1BFM A;  5JRG B;  5AY8 B;  4G91 B;  4YM6 C;  1ULY A;  1P3L C;  5AVB B;  3AZE D;  5B31 C;  4E45 A;  2NZD A;  4XZQ B;  5C3I C;  5GT3 C;  1EQZ B;  1M1A D;  1HQ3 D;  2NQB B;  3REK B;  3AZN A;  4WNN A;  4WV4 B;  3W98 D;  3REK A;  5AVC A;  4X23 C;  3X1V D;  5B0Z D;  2BYM B;  3TU4 B;  3KWQ C;  1P3A B;  1ID3 A;  5AV5 B;  1JFI B;  5F99 A;  4QLC A;  4H9N A;  5B24 A;  5B0Y B;  3C1C C;  5AV8 D;  4R8P D;  4JJN A;  3X1U D;  3A6N A;  1KX3 B;  4H9P A;  4CSR B;  5AY8 A;  1KX4 C;  5CP6 B;  3WA9 D;  5G49 B;  4XUJ A;  5E5A A;  2PYO A;  3AV1 B;  4WNN B;  3AZM B;  1N1J A;  2ARO D;  3MNN D;  2YFV B;  5AV6 B;  2FJ7 A;  1P3P D;  5AV8 C;  5B31 D;  3C1C D;  5GSU B;  4AWL C;  1R4V A;  5CPJ A;  1EQZ A;  3WAA D;  4LD9 A;  2CWE A;  5B0Z B;  4KUD D;  4J8V D;  3MGP A;  3C1B A;  1F1E A;  3MNN C;  5DNN C;  3REI A;  3AZI D;  4WU9 A;  3B6G A;  5GSU C;  5CP6 A;  1U35 C;  3UTA C;  3AYW B;  3TU4 C;  3AFA A;  3MGS B;  3AZK B;  4YS3 A;  3AYW A;  3V9R B;  1P3G D;  1WWS A;  3AZH A;  4KGC A;  4H9N B;  3AZG A;  3C1B B;  3WAA C;  5GT0 A;  2BYK B;  2F8N B;  4J8X C;  3AZL C;  5JRG D;  3AV2 D;  1P3P B;  3MGP B;  5B40 C;  2JSS A;  5AV9 C;  3LJA C;  3REH C;  4LD9 B;  5AV6 A;  5CPI B;  1BH8 B;  4Z5T D;  4ZUX A;  5GSU A;  5CPI A;  4KGC B;  1P3B A;  1KX4 D;  1M18 C;  4DRA A;  3REH B;  4LD9 C;  1P34 D;  3AZM C;  2NZD B;  3AN2 C;  3X1T D;  4J8W B;  5B1M D;  3AZJ A;  1TAF A;  2HIO C;  3UTB B;  5JA4 A;  3AV1 C;  1P3I D;  3MGS D;  5AVB D;  4HGA C;  3KWQ D;  5DNN D;  5AV9 D;  3B0C T;  5C3I B;  1S32 C;  5CP6 C;  3MVD A;  1U35 A;  5GT3 A;  4AWL B;  3WTP C;  3VH6 W;  5B0Y A;  4R8P B;  3LZ0 C;  4J8W C;  1P3O A;  4UUZ B;  3WKJ A;  5AY8 C;  4ZUX C;  3X1U B;  1F66 C;  4KHA A;  1ZLA B;  3NQU A;  1P3K D;  5GXQ D;  3REK D;  3WA9 C;  1P3G C;  1ZLA A;  3AN2 D;  3X1V A;  5B0Z A;  1P3O B;  2FJ7 C;  4CAY B;  1ID3 D;  5F99 D;  4QLC D;  3KXB B;  1KU5 A;  3AZK C;  4J8U D;  1BH9 B;  1AOI C;  3LJA D;  4J8W D;  3W96 A;  5BS7 C;  3KUY A;  1H3O B;  3UT9 B;  5DNM A;  4KUD C;  4H9P B;  5B32 D;  3R45 A;  3LZ1 D;  1P3F D;  1P3M D;  2NQB C;  1HTA A;  3LJA B;  5CPK A;  3MNN A;  1ID3 C;  4YM6 A;  3AZM D;  2FJ7 D;  1BH8 A;  3TU4 D;  5B31 A;  3AZK D;  5GXQ B;  5AV5 D;  3MVD C;  2F8N H;  3REJ A;  1EQZ D;  3WAA A;  5B0Y C;  4H9S A;  3LZ0 B;  1M19 D;  3C1B D;  3VH6 T;  3AZJ C;  3KXB D;  4G92 B;  3AZH C;  3AZI A;  4KGC C;  4WU8 B;  3VH5 A;  4G92 C;  3AZH B;  3B6G D;  2NQB D;  3B0D B;  3VH5 T;  4HGA B;  3X1S A;  5CP6 D;  1P3F C;  3WA9 B;  3VH6 A;  5KDM B;  3LZ0 D;  1M19 B;  5B1L D;  3REJ C;  4YS3 D;  3AZF D;  3MNN B;  3AYW D;  4X23 D;  1P3L A;  3REL A;  1KX5 A;  5B32 B;  3AZH D;  3B6G B;  4KGC D;  5B24 C;  3AZG D;  5GT0 D;  4J8U C;  4NE5 A;  1H3O A;  5JA4 B;  3C1B C;  3UT9 A;  5JRG A;  2CV5 C;  4Z66 B;  3X1S C;  3W99 A;  1P3B B;  3X1T B;  5B33 B;  5AVC C;  5BNV B;  4ZUX B;  3X1U C;  4H9Q A;  5B2I A;  3NQJ A;  5CPI D;  1P3M C;  4YS3 C;  4J8X B;  3AZL B;  2YFV A;  4Z2M H;  1P3B D;  4ZBJ B;  5E5A B;  4WU8 D;  2F8N A;  2PYO B;  1HQ3 A;  2YFW A;  3O62 B;  1WWI A;  1S32 D;  1P34 A;  1P3K B;  5B1M A;  4J8X D;  3AZL D;  1KX3 A;  3MGS A;  4YS3 B;  4JJN C;  3W98 A;  3REL B;  1KX5 B;  1P3I B;  4JJN B;  5AV6 C;  5DNN A;  3REI C;  5F99 C;  3MVD D;  4QLC B;  4Z66 D;  4JJN D;  3W97 A;  1ZLA D;  2HIO A;  4XZQ D;  2YFW B;  3O62 A;  3X1V C;  1M18 B;  4WU9 C;  3KSY A;  1M18 A;  4XUJ D;  5E5A D;  3VH5 W;  5AVB C;  2PYO D;  1Q9C A;  1TZY B;  3MGS C;  5BNX B;  4YM6 B;  5CPK C;  4J8U B;  3LJA A;  5CPK B;  1P3P A;  1N1J B;  5B33 A;  3W97 B;  3B6F C;  1M19 C;  4XUJ B;  3WTP A;  4H9O A;  5B32 A;  4KUD A;  1P3F A;  5FUG A;  5AV5 C;  2IO5 B;  5CPK D;  3MGQ C;  4WU9 D;  3LEL A;  3TU4 A;  4J8V C;  4H9R A;  4KUD B;  5B1L C;  3AYW C;  3AZF B;  5F99 B;  3REJ D;  3B0C W;  5AV9 B;  3UT9 C;  1B67 A;  3UTA A;  1P34 C;  3REL C;  1KX5 C;  1TZY D;  2NQB A;  5B2J B;  3B0B A;  5B40 A;  3LEL C;  3O62 C;  3LEL B;  5BO0 A;  5B1L A;  1M1A B;  3W99 B;  3MGQ A;  4X23 A;  5B32 G;  5BNV A;  1P3L D;  4NE3 A;  4Z5T A;  3AV1 A;  1TAF B;  3B0D C;  4NE6 A;  4WU8 C;  4XZQ C;  3W96 B;  3MGR A;  3W99 D;  1P3B C;  1BH9 A;  5KDM A;  1P3L B;  5B0Z C;  3AZJ D;  3B6G C;  3WKJ C;  1P3A D;  1P3I A;  5B24 B;  3AZN D;  5B2I D;  3MGQ B;  5B2J A;  1P3G B;  5AV8 B;  3W98 C;  3KWQ A;  3B6F B;  1U35 D;  4CAY A;  3X1T C;  4WU8 A;  4E44 A;  2F8N D;  5AVC B;  4Z66 C;  3W97 C;  4DRB A;  3MGR C;  5BS7 A;  1S32 A;  5B24 D;  3AZG C;  3AZN B;  5AV8 A;  3WKJ D;  3AZN C;  3AZG B;  4R8P A;  4J8X A;  3AZL A;  3REK C;  5GXQ A;  3X1U A;  1U35 B;  2HUE C;  3AN2 A;  3AV2 C;  4XUJ C;  5AY8 D;  2CV5 A;  3A6N C;  1B6W A;  3MVD B;  3C1C B;  3KXB C;  3UTB A;  3KUY B;  1P3P C;  4Z66 A;  3R45 B;  1AOI D;  2ARO A;  4EO5 C;  4X23 B;  3W97 D;  4J8W A;  4WZS B;  3AZJ B;  4QLC C;  3C1C A;  5BO0 B;  3O62 D;  5CPJ D;  3MGP C;  3KUY D;  3W96 C;  5B40 B;  4LD9 D;  1M18 D;  3LZ1 A;  4J8V A;  4R8P C;  3REI D;  4YM6 D;  3AZE C;  3AZM A;  3AZI C;  5G49 A;  4H9R B;  3WTP D;  3UTA B;  4G91 C;  3B6F A;  2NZD C;  3AFA D;  5JRG C;  1P3G A;  1ZLA C;  1F66 B;  5DNN B;  5GT3 B;  3V9R A;  5B31 G;  1EQZ C;  1F66 A;  3LEL D;  3W98 B;  2HUE B;  1JFI A;  3WTP B;  3REH A;  3X1S B;  5FUG B;  5BT1 D;  2BYM A;  4H9O B;  5AV6 D;  3AZE A;  1P3M B;  2IO5 C;  5GSU D;  1P34 B;  4Z5T C;  5GT0 C;  2NZD D;  1TZY A;  3WAA B;  3NQJ B;  1HQ3 B;  5B1L B;  3AZF C;  1M1A A;  4J8V B;  5B33 C;  4H9Q B;  5B2I B;  3W99 C;  3MGQ D;  2LY8 A;  3X1T A;  4EO5 B;  2RVQ D;  3AV1 D;  5CPI C;  2HIO B;  1KX3 C;  5AVB A;  2ARO C;  4KHA B;  1HQ3 C;  5B2J C;  5AVC D;  3AZE B;  5DNM B;  5AV9 A;  3A6N B;  5GT3 D;  3MGR D;  5GXQ C;  5B0Y D;  4CSR A;  1P3O D;  1P3A A;  1TZY C;  4Z2M G;  1ID3 B;  1KX3 D;  5B2J D;  4H9S C;  1P3K A;  3A6N D;  4NFT A;  3AZI B;  2RVQ C;  4WU9 B;  1A7W A;  3WA9 A;  3X1V B;  3REJ B;  4J8U A;  3WKJ B;  3LZ1 B;  5BNX A;  5B31 B;  5CPJ B;  3W96 D;  5CPJ C;  1P3O C;  2HIO D;  4XZQ A;  2FJ7 B;  2CV5 D;  5DNM D;  2L5A A;  3WTP E;  3UTB D;  3MGR B;  1P3A C;  1P3M A;  3MGP D;  3KUY C;  1AOI A;  1P3K C;  5GT0 B;  2F8N K;  1AOI B;  4Z5T B;  2ARO B;  2CV5 B;  5E5A C;  2PYO C;  5B33 D;  3AFA B;  3AZK A;  5AV5 A;  3AFA C;  4ZBJ C;  1KX4 B;  2F8N G;  5CHL B;  1M19 A;  3AN2 B;  3KXB A;  5B1M B;  3UTB C;  5DNM C;  3REI B;  3AV2 B;  5B1M C;  3X1S D;  5BT1 C;  3NQU B;  1P3I C;  3AV2 A;  3KWQ B;  1S32 B;  2BYK A;  1M1A C;  3LZ0 A;  3B6F D;  5B2I C;  3AZF A; 
#chains in the Genus database with same CATH topology
 3UTA D;  3REL D;  1KX5 D;  4ZUX D;  4UUZ A;  5B32 C;  3LZ1 C;  1F66 D;  4M6B A;  3UT9 D;  5B40 D;  1KX4 A;  1P3F B;  3REH D;  1BFM A;  5JRG B;  5AY8 B;  4G91 B;  4YM6 C;  1ULY A;  1P3L C;  5AVB B;  3AZE D;  5B31 C;  4E45 A;  2NZD A;  4XZQ B;  5C3I C;  5GT3 C;  1EQZ B;  1M1A D;  1HQ3 D;  2NQB B;  3REK B;  3AZN A;  4WNN A;  4WV4 B;  3W98 D;  3REK A;  5AVC A;  4X23 C;  3X1V D;  5B0Z D;  2Y2M A;  2BYM B;  2Y2N A;  3IP4 C;  3TU4 B;  3KWQ C;  2ZM5 A;  1P3A B;  1ID3 A;  5AV5 B;  1JFI B;  5F99 A;  4QLC A;  4H9N A;  5B24 A;  5B0Y B;  3C1C C;  5AV8 D;  2JE5 A;  4R8P D;  4JJN A;  2Y2H A;  3X1U D;  3A6N A;  1KX3 B;  4H9P A;  4CSR B;  5AY8 A;  1KX4 C;  5CP6 B;  3WA9 D;  2Y2Q A;  5G49 B;  4XUJ A;  5E5A A;  2PYO A;  3AV1 B;  4WNN B;  3AZM B;  1N1J A;  2ARO D;  3MNN D;  2YFV B;  5AV6 B;  2FJ7 A;  1P3P D;  5AV8 C;  4WJ3 C;  5B31 D;  3C1C D;  5GSU B;  4AWL C;  1R4V A;  5CPJ A;  2DQN C;  1EQZ A;  3WAA D;  4LD9 A;  2CWE A;  5B0Z B;  4KUD D;  4J8V D;  3MGP A;  3C1B A;  1T3U A;  1F1E A;  3MNN C;  5DNN C;  2RIQ A;  3REI A;  3AZI D;  1W2E A;  4WU9 A;  3B6G A;  5GSU C;  5CP6 A;  1U35 C;  2G5H C;  3UTA C;  2ZY3 A;  3AYW B;  3TU4 C;  3AFA A;  3MGS B;  3AZK B;  4YS3 A;  3EPH A;  3AYW A;  3V9R B;  1P3G D;  1WWS A;  2W8S A;  3AZH A;  4KGC A;  4H9N B;  3AZG A;  3C1B B;  3WAA C;  5GT0 A;  2BYK B;  2F8N B;  4J8X C;  3AZL C;  5JRG D;  3AV2 D;  1P3P B;  3MGP B;  4DQY B;  5B40 C;  2JSS A;  5AV9 C;  3LJA C;  3REH C;  4LD9 B;  5AV6 A;  5CPI B;  1BH8 B;  4Z5T D;  4ZUX A;  5GSU A;  2XD1 A;  5CPI A;  4KGC B;  1P3B A;  1KX4 D;  1M18 C;  4DRA A;  3EPL A;  3REH B;  4LD9 C;  2VQR A;  1P34 D;  3AZM C;  2NZD B;  3AN2 C;  3X1T D;  4J8W B;  5B1M D;  3AZJ A;  1TAF A;  2HIO C;  3UTB B;  5JA4 A;  3AV1 C;  1P3I D;  3MGS D;  5AVB D;  4HGA C;  3KWQ D;  5DNN D;  2JCH A;  5AV9 D;  3B0C T;  5C3I B;  1S32 C;  5CP6 C;  3MVD A;  1U35 A;  5GT3 A;  4AWL B;  3WTP C;  3VH6 W;  5B0Y A;  4R8P B;  1PZR A;  3LZ0 C;  4J8W C;  1P3O A;  4UUZ B;  3WKJ A;  5AY8 C;  4ZUX C;  3X1U B;  1F66 C;  4KHA A;  1ZLA B;  2Y2G A;  3NQU A;  1P3K D;  5GXQ D;  3REK D;  3WA9 C;  1P3G C;  1ZLA A;  3AN2 D;  3X1V A;  3H0L C;  5B0Z A;  1P3O B;  2FJ7 C;  4CAY B;  1ID3 D;  5F99 D;  4QLC D;  3KXB B;  1KU5 A;  3AZK C;  4J8U D;  3P5J B;  1BH9 B;  1AOI C;  3LJA D;  4J8W D;  3W96 A;  5BS7 C;  3KUY A;  1H3O B;  3UT9 B;  5DNM A;  4KUD C;  4H9P B;  5B32 D;  3R45 A;  3LZ1 D;  1P3F D;  1P3M D;  2NQB C;  1HTA A;  3LJA B;  5CPK A;  3MNN A;  1ID3 C;  4YM6 A;  3AZM D;  2FJ7 D;  1BH8 A;  3TU4 D;  5B31 A;  3AZK D;  5GXQ B;  5AV5 D;  3MVD C;  2F8N H;  3REJ A;  1EQZ D;  3WAA A;  5B0Y C;  4H9S A;  3LZ0 B;  1M19 D;  3C1B D;  3VH6 T;  3AZJ C;  3KXB D;  4G92 B;  3AZH C;  3AZI A;  4KGC C;  4WU8 B;  3VH5 A;  4G92 C;  3AZH B;  3B6G D;  2NQB D;  3B0D B;  3VH5 T;  4HGA B;  3X1S A;  5CP6 D;  1P3F C;  3WA9 B;  2G5I C;  3VH6 A;  5KDM B;  3LZ0 D;  1M19 B;  5B1L D;  3REJ C;  4YS3 D;  3AZF D;  3MNN B;  3AYW D;  4X23 D;  1P3L A;  3REL A;  1KX5 A;  5B32 B;  3AZH D;  3B6G B;  4KGC D;  5B24 C;  3AZG D;  5GT0 D;  4J8U C;  4NE5 A;  1H3O A;  5JA4 B;  3C1B C;  3UT9 A;  5JRG A;  2CV5 C;  4Z66 B;  3X1S C;  3W99 A;  1P3B B;  2Y2J A;  3X1T B;  5B33 B;  5AVC C;  5BNV B;  4ZUX B;  3X1U C;  2Y2I A;  4H9Q A;  5B2I A;  3NQJ A;  5CPI D;  1P3M C;  4YS3 C;  4J8X B;  3AZL B;  2YFV A;  4Z2M H;  1P3B D;  4ZBJ B;  5E5A B;  4WU8 D;  2F8N A;  2PYO B;  1HQ3 A;  2YFW A;  3O62 B;  1WWI A;  1S32 D;  1P34 A;  1P3K B;  5B1M A;  2UWX A;  4J8X D;  3AZL D;  1KX3 A;  3MGS A;  4YS3 B;  4JJN C;  3W98 A;  3REL B;  1KX5 B;  2XD5 A;  1P3I B;  4JJN B;  5AV6 C;  5DNN A;  3REI C;  5F99 C;  3MVD D;  4QLC B;  2Y2P A;  3AL0 C;  4Z66 D;  4JJN D;  3W97 A;  1ZLA D;  2HIO A;  4XZQ D;  2YFW B;  3O62 A;  3X1V C;  1M18 B;  4WU9 C;  3KSY A;  1M18 A;  4XUJ D;  5E5A D;  3VH5 W;  5AVB C;  2PYO D;  1Q9C A;  1TZY B;  3MGS C;  5BNX B;  4YM6 B;  3EPJ A;  5CPK C;  2Y2O A;  4J8U B;  3LJA A;  5CPK B;  1Z2C B;  1P3P A;  1N1J B;  5B33 A;  3W97 B;  3B6F C;  1M19 C;  4XUJ B;  3WTP A;  4H9O A;  3H0R C;  5B32 A;  4KUD A;  1P3F A;  5FUG A;  5AV5 C;  2IO5 B;  5CPK D;  3MGQ C;  4WU9 D;  3LEL A;  3TU4 A;  4J8V C;  4H9R A;  4KUD B;  5B1L C;  2ZY5 A;  3AYW C;  5F99 B;  3AZF B;  3REJ D;  3B0C W;  5AV9 B;  3UT9 C;  1B67 A;  3UTA A;  3KFU G;  1P34 C;  3REL C;  1KX5 C;  1TZY D;  2NQB A;  5B2J B;  3B0B A;  5B40 A;  3LEL C;  3O62 C;  3LEL B;  5BO0 A;  5B1L A;  1M1A B;  3W99 B;  2Y2L A;  3MGQ A;  4X23 A;  5B32 G;  5BNV A;  1P3L D;  4NE3 A;  4Z5T A;  3AV1 A;  1TAF B;  3B0D C;  4NE6 A;  4WU8 C;  2F2A C;  4XZQ C;  3W96 B;  3MGR A;  3W99 D;  1P3B C;  1BH9 A;  5KDM A;  1P3L B;  5B0Z C;  3AZJ D;  3B6G C;  3WKJ C;  1P3A D;  1P3I A;  5B24 B;  3AZN D;  5B2I D;  3MGQ B;  5B2J A;  1P3G B;  5AV8 B;  3W98 C;  3KWQ A;  3B6F B;  1U35 D;  4CAY A;  3X1T C;  4WU8 A;  4E44 A;  2F8N D;  5AVC B;  4Z66 C;  3W97 C;  4DRB A;  3MGR C;  5BS7 A;  1S32 A;  5B24 D;  3AZG C;  3AZN B;  5AV8 A;  3WKJ D;  3AZN C;  3AZG B;  4R8P A;  4J8X A;  3AZL A;  3REK C;  5GXQ A;  3X1U A;  1U35 B;  2BG1 A;  2HUE C;  3AN2 A;  3AV2 C;  4XUJ C;  5AY8 D;  4UPK A;  2CV5 A;  3A6N C;  1B6W A;  3MVD B;  3C1C B;  3KXB C;  3UTB A;  3KUY B;  1P3P C;  4Z66 A;  3R45 B;  1AOI D;  2ARO A;  4EO5 C;  4X23 B;  3W97 D;  4J8W A;  4WZS B;  3AZJ B;  4QLC C;  3C1C A;  5BO0 B;  3O62 D;  5CPJ D;  3MGP C;  3KUY D;  3W96 C;  2ZY2 A;  5B40 B;  4LD9 D;  1M18 D;  3LZ1 A;  4J8V A;  4R8P C;  3REI D;  4YM6 D;  3AZE C;  3AZM A;  3AZI C;  5G49 A;  4H9R B;  3WTP D;  3UTA B;  4G91 C;  3B6F A;  2NZD C;  3AFA D;  5JRG C;  1P3G A;  1ZLA C;  1F66 B;  5DNN B;  5GT3 B;  3V9R A;  5B31 G;  1EQZ C;  1F66 A;  3LEL D;  3W98 B;  2HUE B;  3FDD A;  3WTP B;  1JFI A;  3REH A;  3X1S B;  5FUG B;  5BT1 D;  3A1K A;  2BYM A;  4H9O B;  5AV6 D;  3AZE A;  1P3M B;  2IO5 C;  5GSU D;  1P34 B;  4Z5T C;  5GT0 C;  2NZD D;  1TZY A;  3EG5 B;  3WAA B;  3NQJ B;  1HQ3 B;  5B1L B;  3AZF C;  1M1A A;  4J8V B;  3F6T A;  5B33 C;  4H9Q B;  5B2I B;  3W99 C;  3MGQ D;  2LY8 A;  3X1T A;  4EO5 B;  2RVQ D;  3AV1 D;  2FFF B;  5CPI C;  2HIO B;  1KX3 C;  5AVB A;  2ARO C;  4KHA B;  1HQ3 C;  5B2J C;  5AVC D;  3AZE B;  5DNM B;  5AV9 A;  3A6N B;  5GT3 D;  3MGR D;  5GXQ C;  5B0Y D;  4CSR A;  2ZY4 A;  1P3O D;  1P3A A;  1TZY C;  4Z2M G;  1ID3 B;  2DF4 C;  1KX3 D;  5B2J D;  4H9S C;  1P3K A;  3A6N D;  4NFT A;  3AZI B;  2RVQ C;  4WU9 B;  1A7W A;  3WA9 A;  3X1V B;  3REJ B;  4J8U A;  3WKJ B;  3LZ1 B;  5BNX A;  5B31 B;  5CPJ B;  3W96 D;  5CPJ C;  1P3O C;  2HIO D;  4XZQ A;  2FJ7 B;  2CV5 D;  5DNM D;  2L5A A;  3WTP E;  3UTB D;  3MGR B;  3A1I A;  1P3A C;  3MGP D;  3KUY C;  1P3M A;  2J8P A;  2Y2K A;  1AOI A;  1P3K C;  5GT0 B;  2F8N K;  1AOI B;  4Z5T B;  2ARO B;  2CV5 B;  5E5A C;  2PYO C;  5B33 D;  3AFA B;  3AZK A;  5AV5 A;  3AFA C;  4ZBJ C;  3EPK A;  1KX4 B;  2F8N G;  5CHL B;  1M19 A;  3AN2 B;  3KXB A;  5B1M B;  3UTB C;  5DNM C;  3REI B;  3AV2 B;  5B1M C;  3H0M C;  3X1S D;  5BT1 C;  3NQU B;  1P3I C;  3AV2 A;  3KWQ B;  1S32 B;  2BYK A;  1M1A C;  3LZ0 A;  3B6F D;  5B2I C;  3AZF A; 
#chains in the Genus database with same CATH homology
 3UTA D;  3REL D;  1KX5 D;  4ZUX D;  4UUZ A;  5B32 C;  3LZ1 C;  1F66 D;  4M6B A;  3UT9 D;  5B40 D;  1KX4 A;  1P3F B;  3REH D;  1BFM A;  5JRG B;  5AY8 B;  4G91 B;  4YM6 C;  1ULY A;  1P3L C;  5AVB B;  3AZE D;  5B31 C;  4E45 A;  2NZD A;  4XZQ B;  5C3I C;  5GT3 C;  1EQZ B;  1M1A D;  1HQ3 D;  2NQB B;  3REK B;  3AZN A;  4WNN A;  4WV4 B;  3W98 D;  3REK A;  5AVC A;  4X23 C;  3X1V D;  5B0Z D;  2Y2M A;  2BYM B;  2Y2N A;  3IP4 C;  3TU4 B;  3KWQ C;  2ZM5 A;  1P3A B;  1ID3 A;  5AV5 B;  1JFI B;  5F99 A;  4QLC A;  4H9N A;  5B24 A;  5B0Y B;  3C1C C;  5AV8 D;  2JE5 A;  4R8P D;  4JJN A;  2Y2H A;  3X1U D;  3A6N A;  1KX3 B;  4H9P A;  4CSR B;  5AY8 A;  1KX4 C;  5CP6 B;  3WA9 D;  2Y2Q A;  5G49 B;  4XUJ A;  5E5A A;  2PYO A;  3AV1 B;  4WNN B;  3AZM B;  1N1J A;  2ARO D;  3MNN D;  2YFV B;  5AV6 B;  2FJ7 A;  1P3P D;  5AV8 C;  4WJ3 C;  5B31 D;  3C1C D;  5GSU B;  4AWL C;  1R4V A;  5CPJ A;  2DQN C;  1EQZ A;  3WAA D;  4LD9 A;  2CWE A;  5B0Z B;  4KUD D;  4J8V D;  3MGP A;  3C1B A;  1T3U A;  1F1E A;  3MNN C;  5DNN C;  2RIQ A;  3REI A;  3AZI D;  1W2E A;  4WU9 A;  3B6G A;  5GSU C;  5CP6 A;  1U35 C;  2G5H C;  3UTA C;  2ZY3 A;  3AYW B;  3TU4 C;  3AFA A;  3MGS B;  3AZK B;  4YS3 A;  3EPH A;  3AYW A;  3V9R B;  1P3G D;  1WWS A;  2W8S A;  3AZH A;  4KGC A;  4H9N B;  3AZG A;  3C1B B;  3WAA C;  5GT0 A;  2BYK B;  2F8N B;  4J8X C;  3AZL C;  5JRG D;  3AV2 D;  1P3P B;  3MGP B;  4DQY B;  5B40 C;  2JSS A;  5AV9 C;  3LJA C;  3REH C;  4LD9 B;  5AV6 A;  5CPI B;  1BH8 B;  4Z5T D;  4ZUX A;  5GSU A;  2XD1 A;  5CPI A;  4KGC B;  1P3B A;  1KX4 D;  1M18 C;  4DRA A;  3EPL A;  3REH B;  4LD9 C;  2VQR A;  1P34 D;  3AZM C;  2NZD B;  3AN2 C;  3X1T D;  4J8W B;  5B1M D;  3AZJ A;  1TAF A;  2HIO C;  3UTB B;  5JA4 A;  3AV1 C;  1P3I D;  3MGS D;  5AVB D;  4HGA C;  3KWQ D;  5DNN D;  2JCH A;  5AV9 D;  3B0C T;  5C3I B;  1S32 C;  5CP6 C;  3MVD A;  1U35 A;  5GT3 A;  4AWL B;  3WTP C;  3VH6 W;  5B0Y A;  4R8P B;  1PZR A;  3LZ0 C;  4J8W C;  1P3O A;  4UUZ B;  3WKJ A;  5AY8 C;  4ZUX C;  3X1U B;  1F66 C;  4KHA A;  1ZLA B;  2Y2G A;  3NQU A;  1P3K D;  5GXQ D;  3REK D;  3WA9 C;  1P3G C;  1ZLA A;  3AN2 D;  3X1V A;  3H0L C;  5B0Z A;  1P3O B;  2FJ7 C;  4CAY B;  1ID3 D;  5F99 D;  4QLC D;  3KXB B;  1KU5 A;  3AZK C;  4J8U D;  3P5J B;  1BH9 B;  1AOI C;  3LJA D;  4J8W D;  3W96 A;  5BS7 C;  3KUY A;  1H3O B;  3UT9 B;  5DNM A;  4KUD C;  4H9P B;  5B32 D;  3R45 A;  3LZ1 D;  1P3F D;  1P3M D;  2NQB C;  1HTA A;  3LJA B;  5CPK A;  3MNN A;  1ID3 C;  4YM6 A;  3AZM D;  2FJ7 D;  1BH8 A;  3TU4 D;  5B31 A;  3AZK D;  5GXQ B;  5AV5 D;  3MVD C;  2F8N H;  3REJ A;  1EQZ D;  3WAA A;  5B0Y C;  4H9S A;  3LZ0 B;  1M19 D;  3C1B D;  3VH6 T;  3AZJ C;  3KXB D;  4G92 B;  3AZH C;  3AZI A;  4KGC C;  4WU8 B;  3VH5 A;  4G92 C;  3AZH B;  3B6G D;  2NQB D;  3B0D B;  3VH5 T;  4HGA B;  3X1S A;  5CP6 D;  1P3F C;  3WA9 B;  2G5I C;  3VH6 A;  5KDM B;  3LZ0 D;  1M19 B;  5B1L D;  3REJ C;  4YS3 D;  3AZF D;  3MNN B;  3AYW D;  4X23 D;  1P3L A;  3REL A;  1KX5 A;  5B32 B;  3AZH D;  3B6G B;  4KGC D;  5B24 C;  3AZG D;  5GT0 D;  4J8U C;  4NE5 A;  1H3O A;  5JA4 B;  3C1B C;  3UT9 A;  5JRG A;  2CV5 C;  4Z66 B;  3X1S C;  3W99 A;  1P3B B;  2Y2J A;  3X1T B;  5B33 B;  5AVC C;  5BNV B;  4ZUX B;  3X1U C;  2Y2I A;  4H9Q A;  5B2I A;  3NQJ A;  5CPI D;  1P3M C;  4YS3 C;  4J8X B;  3AZL B;  2YFV A;  4Z2M H;  1P3B D;  4ZBJ B;  5E5A B;  4WU8 D;  2F8N A;  2PYO B;  1HQ3 A;  2YFW A;  3O62 B;  1WWI A;  1S32 D;  1P34 A;  1P3K B;  5B1M A;  2UWX A;  4J8X D;  3AZL D;  1KX3 A;  3MGS A;  4YS3 B;  4JJN C;  3W98 A;  3REL B;  1KX5 B;  2XD5 A;  1P3I B;  4JJN B;  5AV6 C;  5DNN A;  3REI C;  5F99 C;  3MVD D;  4QLC B;  2Y2P A;  3AL0 C;  4Z66 D;  4JJN D;  3W97 A;  1ZLA D;  2HIO A;  4XZQ D;  2YFW B;  3O62 A;  3X1V C;  1M18 B;  4WU9 C;  3KSY A;  1M18 A;  4XUJ D;  5E5A D;  3VH5 W;  5AVB C;  2PYO D;  1Q9C A;  1TZY B;  3MGS C;  5BNX B;  4YM6 B;  3EPJ A;  5CPK C;  2Y2O A;  4J8U B;  3LJA A;  5CPK B;  1Z2C B;  1P3P A;  1N1J B;  5B33 A;  3W97 B;  3B6F C;  1M19 C;  4XUJ B;  3WTP A;  4H9O A;  3H0R C;  5B32 A;  4KUD A;  1P3F A;  5FUG A;  5AV5 C;  2IO5 B;  5CPK D;  3MGQ C;  4WU9 D;  3LEL A;  3TU4 A;  4J8V C;  4H9R A;  4KUD B;  5B1L C;  2ZY5 A;  3AYW C;  5F99 B;  3AZF B;  3REJ D;  3B0C W;  5AV9 B;  3UT9 C;  1B67 A;  3UTA A;  3KFU G;  1P34 C;  3REL C;  1KX5 C;  1TZY D;  2NQB A;  5B2J B;  3B0B A;  5B40 A;  3LEL C;  3O62 C;  3LEL B;  5BO0 A;  5B1L A;  1M1A B;  3W99 B;  2Y2L A;  3MGQ A;  4X23 A;  5B32 G;  5BNV A;  1P3L D;  4NE3 A;  4Z5T A;  3AV1 A;  1TAF B;  3B0D C;  4NE6 A;  4WU8 C;  2F2A C;  4XZQ C;  3W96 B;  3MGR A;  3W99 D;  1P3B C;  1BH9 A;  5KDM A;  1P3L B;  5B0Z C;  3AZJ D;  3B6G C;  3WKJ C;  1P3A D;  1P3I A;  5B24 B;  3AZN D;  5B2I D;  3MGQ B;  5B2J A;  1P3G B;  5AV8 B;  3W98 C;  3KWQ A;  3B6F B;  1U35 D;  4CAY A;  3X1T C;  4WU8 A;  4E44 A;  2F8N D;  5AVC B;  4Z66 C;  3W97 C;  4DRB A;  3MGR C;  5BS7 A;  1S32 A;  5B24 D;  3AZG C;  3AZN B;  5AV8 A;  3WKJ D;  3AZN C;  3AZG B;  4R8P A;  4J8X A;  3AZL A;  3REK C;  5GXQ A;  3X1U A;  1U35 B;  2BG1 A;  2HUE C;  3AN2 A;  3AV2 C;  4XUJ C;  5AY8 D;  4UPK A;  2CV5 A;  3A6N C;  1B6W A;  3MVD B;  3C1C B;  3KXB C;  3UTB A;  3KUY B;  1P3P C;  4Z66 A;  3R45 B;  1AOI D;  2ARO A;  4EO5 C;  4X23 B;  3W97 D;  4J8W A;  4WZS B;  3AZJ B;  4QLC C;  3C1C A;  5BO0 B;  3O62 D;  5CPJ D;  3MGP C;  3KUY D;  3W96 C;  2ZY2 A;  5B40 B;  4LD9 D;  1M18 D;  3LZ1 A;  4J8V A;  4R8P C;  3REI D;  4YM6 D;  3AZE C;  3AZM A;  3AZI C;  5G49 A;  4H9R B;  3WTP D;  3UTA B;  4G91 C;  3B6F A;  2NZD C;  3AFA D;  5JRG C;  1P3G A;  1ZLA C;  1F66 B;  5DNN B;  5GT3 B;  3V9R A;  5B31 G;  1EQZ C;  1F66 A;  3LEL D;  3W98 B;  2HUE B;  3FDD A;  3WTP B;  1JFI A;  3REH A;  3X1S B;  5FUG B;  5BT1 D;  3A1K A;  2BYM A;  4H9O B;  5AV6 D;  3AZE A;  1P3M B;  2IO5 C;  5GSU D;  1P34 B;  4Z5T C;  5GT0 C;  2NZD D;  1TZY A;  3EG5 B;  3WAA B;  3NQJ B;  1HQ3 B;  5B1L B;  3AZF C;  1M1A A;  4J8V B;  3F6T A;  5B33 C;  4H9Q B;  5B2I B;  3W99 C;  3MGQ D;  2LY8 A;  3X1T A;  4EO5 B;  2RVQ D;  3AV1 D;  2FFF B;  5CPI C;  2HIO B;  1KX3 C;  5AVB A;  2ARO C;  4KHA B;  1HQ3 C;  5B2J C;  5AVC D;  3AZE B;  5DNM B;  5AV9 A;  3A6N B;  5GT3 D;  3MGR D;  5GXQ C;  5B0Y D;  4CSR A;  2ZY4 A;  1P3O D;  1P3A A;  1TZY C;  4Z2M G;  1ID3 B;  2DF4 C;  1KX3 D;  5B2J D;  4H9S C;  1P3K A;  3A6N D;  4NFT A;  3AZI B;  2RVQ C;  4WU9 B;  1A7W A;  3WA9 A;  3X1V B;  3REJ B;  4J8U A;  3WKJ B;  3LZ1 B;  5BNX A;  5B31 B;  5CPJ B;  3W96 D;  5CPJ C;  1P3O C;  2HIO D;  4XZQ A;  2FJ7 B;  2CV5 D;  5DNM D;  2L5A A;  3WTP E;  3UTB D;  3MGR B;  3A1I A;  1P3A C;  3MGP D;  3KUY C;  1P3M A;  2J8P A;  2Y2K A;  1AOI A;  1P3K C;  5GT0 B;  2F8N K;  1AOI B;  4Z5T B;  2ARO B;  2CV5 B;  5E5A C;  2PYO C;  5B33 D;  3AFA B;  3AZK A;  5AV5 A;  3AFA C;  4ZBJ C;  3EPK A;  1KX4 B;  2F8N G;  5CHL B;  1M19 A;  3AN2 B;  3KXB A;  5B1M B;  3UTB C;  5DNM C;  3REI B;  3AV2 B;  5B1M C;  3H0M C;  3X1S D;  5BT1 C;  3NQU B;  1P3I C;  3AV2 A;  3KWQ B;  1S32 B;  2BYK A;  1M1A C;  3LZ0 A;  3B6F D;  5B2I C;  3AZF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...