3X1TC

Crystal structure of nucleosome core particle consisting of mouse testis specific histone variants h2aa and h2ba
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
105
structure length
105
Chain Sequence
VKSRSSRAGLQFPVGRVHRLLRQGNYAQRIGAGAPVYLAAVLEYLTAEVLELAGNAARDNKKTRITPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords DNA (146-MER)
publication title Structural and functional analyses of nucleosome complexes with mouse histone variants TH2a and TH2b, involved in reprogramming
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 105
sequence length 105
chains with identical sequence G
ec nomenclature
pdb deposition date 2014-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3x1tC00
5AV8A 4NE6A 1AOIB 4WV4B 3UTAD 4QLCB 5CPIA 4X23B 2F8NK 4WNNA 3WAAD 3AZMC 1P3PD 5GSUD 3AZEB 1P3MB 3MGPA 3WTPD 5B31C 1KX3B 4Z66B 5FUGB 4YM6C 3O62B 3LJAC 3AYWA 5B2ID 3VH5A 2NQBC 5B1LD 1A7WA 5DNNA 3AN2D 1KX5C 5AV5A 5B32D 5B24C 4YS3C 1JFIB 4J8XC 3AZJB 5F99C 4EO5B 5CPKC 2NQBA 3AZIA 4LD9D 1P3BC 3KWQC 3W97B 5KDMB 5AY8B 2BYKA 5B0YA 5B24A 3B6FC 3W99C 5F99A 5B1MA 5CPKA 4H9QA 1TAFB 3C1CC 1Q9CA 3WKJA 1P3IA 1KX4C 3AZKA 3WTPE 1M1AA 3AZMD 4JJNA 5AVCC 3MNNC 4WU8C 1P34B 3X1TB 4H9PA 2NZDA 5B31D 3KXBB 1KX4A 2CWEA 4YM6D 5CHLB 4XZQC 4WU8A 3C1BC 3LJAD 5GT0C 3UT9C 3AZHC 3LELB 1M18A 2NQBD 4KUDB 3MGQB 1TZYB 2BYMB 3AZEA 1HQ3B 1P3MA 2HIOC 5B2JC 3KUYB 4XZQA 3C1BA 4Z66A 1B6WA 3REIC 4YS3D 5B24D 3AZHA 5AV6A 4J8XD 1F66C 5F99D 5CPKD 4R8PB 4DRBA 2HIOA 1P3BD 3KWQD 5B2JA 3O62A 5CPJB 3X1UC 2IO5B 5JRGC 3REIA 3VH5W 3REKB 3B6FD 3WAAB 3W99D 1H3OB 2AROB 3LZ0A 2F8NB 3C1CD 4J8VC 2CV5B 5C3IC 1JFIA 5G49B 5JRGA 1KX4D 3AV2C 5AVCD 3MNND 4WU8D 3B0CW 5KDMA 2PYOC 3AV2A 1P3KB 4Z2MG 4XZQD 3C1BD 1U35C 5GT0D 3UT9D 2PYOA 3AZHD 2L5AA 5AV6D 3TU4B 2YFVA 4KGCB 1ID3A 1P34A 2HIOD 4H9SC 5B2JD 4XUJC 3UTBB 3MGRC 3MVDB 3REID 1U35A 1F66D 5GT3B 1EQZB 2JSSA 3LZ0D 3RELB 3AZNB 3X1UD 4DRAA 5BO0A 5JRGD 3MGRA 3LELA 3W98B 3MGQA 1P3FC 5E5AB 5CP6B 3KUYA 3AZMB 1N1JB 1BH9A 4J8VD 3V9RB 4CAYB 1P3AB 3B0DC 3AZLC 3AV2D 3LZ1C 5AV8C 4R8PA 3A6NC 1S32B 5CPIC 3VH6T 4HGAC 5AVBB 2PYOD 3NQJB 3REKA 3AZFB 1ULYA 3AZLA 5B32G 1ID3D 1H3OA 2AROA 3LZ1A 2F8NA 3A6NA 3MGPC 1U35D 3WA9C 1KX5B 3MGSC 3R45A 4ZUXC 1R4VA 4XUJD 3AFAB 4E45A 4ZBJB 5GXQC 3MGRD 1BH8A 3AYWC 3WA9A 3B6GA 2YFWB 4J8UB 1M19C 5DNMB 1P3KA 4G92B 5DNNC 3MGSA 3W99B 4ZUXA 5B31G 5GXQA 5AV5C 5B0ZC 1P3FD 1M19A 1ZLAB 3AZIC 3UTBA 3X1VC 3MVDA 1P3GB 3AZLD 5B0YC 1EQZA 2FJ7A 3LZ1D 5AV8D 4J8WB 5AV9B 5B0ZA 3RELA 3A6ND 5B1MC 5BNVA 2LY8A 5CPID 5B40C 1P3LA 3X1VA 1P3OC 3WKJC 1P3IC 3W98A 4AWLB 4H9NA 5GT0B 3AZKC 1M1AC 4JJNC 5CP6A 1N1JA 3MGPD 3AZGB 3AV1B 4G91B 2NZDC 5B40A 3WA9D 1P3OA 3B6GD 1WWIA 3REJB 5B33B 3MGSD 4QLCC 4ZUXD 5GXQD 3AYWD 2HUEB 3NQJA 4Z5TB 3X1UB 1M19D 1M18C 3AZEC 1P3MC 1AOIA 5DNND 4QLCA 4X23A 4Z66C 5AV5D 5C3IB 5B0ZD 5AV6C 3AZID 3AFAA 4H9OB 3X1VD 3O62C 3X1SB 4WU9B 3REHB 1KX3A 4J8UA 5FUGA 5B0YD 3W96B 5BS7C 5B1MD 3LZ0C 4H9RB 5B40D 1P3OD 3UTAB 1P3ID 3WKJD 3AZKD 1M1AD 3AZJC 4JJND 4EO5C 5BS7A 3W97C 1P3PB 5GSUB 2NZDD 5AY8C 3WTPB 4J8WA 3AZJA 4QLCD 4X23D 3W97A 4KHAB 5AY8A 1M18D 2RVQC 5B2IB 4CSRB 3AZED 3B0BA 1P34C 1P3MD 1ID3C 1TAFA 3X1TC 5B1LB 3KXBC 4Z66D 4E44A 3AN2B 5B32B 3O62D 3X1TA 4LD9B 4HGAB 3KXBA 3LELC 4KUDC 3MGQC 1TZYC 1HQ3C 4WNNB 3KUYC 4KUDA 3AZJD 1TZYA 2BYMA 4R8PC 1HQ3A 3W97D 5CPJC 3X1SA 3REHA 2IO5C 5AY8D 5B31B 3REKC 2F8NH 2AROC 5DNNB 5CPJA 2CV5C 4YM6B 5JA4B 2RVQD 3LJAB 5AV5B 3WAAA 1P34D 2NQBB 3X1TD 1P3PA 3KXBD 2CV5A 5G49A 3B6GC 2BYKB 1P3KC 4YS3B 5B24B 4J8XB 5F99B 5B1MB 5CPKB 4H9QB 1P3BB 3KWQB 3LELD 4KUDD 3WKJB 3TU4C 3MGQD 1TZYD 5B2IA 4KGCC 1HQ3D 3KUYD 5B1LA 3UTBC 3B6FB 3MVDC 4H9PB 3AN2A 3C1CB 4M6BA 5GT3C 1EQZC 2FJ7C 3TU4A 4R8PD 3RELC 5B32A 4KGCA 3AZNC 1HTAA 1KX4B 5CPJD 4LD9A 1P3LC 5AVCB 4WU8B 3MNNB 3W98C 3REKD 5GT3A 5E5AC 2AROD 5CP6C 1M18B 2F8ND 3AZNA 3NQUB 2CV5D 1P3AC 5BNXB 4XZQB 3C1BB 3UT9B 5E5AA 5AV6B 3AZHB 3AZMA 1S32C 3V9RA 5AVBC 2HIOB 3VH6W 5B2JB 4CAYA 1P3AA 1BFMA 5B31A 3AZFC 4WZSB 3REIB 1P3KD 1AOIC 1S32A 1F66B 4YM6A 4X23C 5JA4A 3LZ0B 5AVBA 4NFTA 3LJAA 3TU4D 3AZFA 3VH5T 4KGCD 5JRGB 3AFAC 3UTBD 4ZBJC 1WWSA 3MVDD 4NE5A 1KX3C 4J8VB 4J8UC 5GT3D 5DNMC 1KX5A 1EQZD 2FJ7D 3RELD 4G92C 4YS3A 3AZND 4J8XA 3AV2B 4UUZB 1P3LD 1P3BA 3B0CT 3KWQA 3W98D 2YFWA 1ZLAC 2PYOB 5E5AD 5DNMA 5CP6D 2YFVB 3B6FA 1ID3B 3W99A 1P3GC 1P3AD 3C1CA 3KSYA 1U35B 4J8WC 5AV9C 1ZLAA 1S32D 4NE3A 5AVBD 5AVCA 3MNNA 1P3GA 4AWLC 4XUJB 3AZFD 5BO0B 3MGRB 5AV9A 1AOID 3AZGC 3NQUA 3AV1C 4G91C 1BH9B 5BNXA 1KX5D 5GT0A 3UT9A 3REJC 5B33C 3AFAD 3AZGA 1P3FB 3AV1A 2HUEC 1KX3D 4Z5TC 4J8UD 5DNMD 1KU5A 3B0DB 3REJA 5B33A 3AZLB 1F66A 3LZ1B 5AV8B 3A6NB 5BT1C 5CPIB 3X1UA 4Z5TA 1B67A 1ZLAD 4Z2MH 3X1SC 1P3GD 4WU9C 3R45B 3REHC 4J8VA 3MGPB 3W96C 1BH8B 4J8WD 5AV9D 3WA9B 3B6GB 4UUZA 4H9OA 3MGSB 3UTAC 4WU9A 3VH6A 4ZUXB 5GXQB 3W96A 3AYWB 3WAAC 3AZGD 1M19B 3AV1D 1P3PC 5GSUC 4H9RA 1F1EA 3UTAA 3WTPC 3REJD 5B33D 2FJ7B 5B0ZB 2F8NG 4H9SA 5BNVB 5GSUA 3AZIB 4XUJA 4Z5TD 1P3LB 3X1VB 3WTPA 5B2IC 4H9NB 5B0YB 5B1LC 5BT1D 4KHAA 3AN2C 5B40B 1P3OB 1P3IB 4CSRA 5B32C 3AZKB 1P3FA 1M1AB 4JJNB 3X1SD 4WU9D 3REHD 4LD9C 3W96D 2NZDB
chains in the Genus database with same CATH superfamily
5AV8A 4NE6A 1AOIB 4WV4B 3UTAD 4QLCB 5CPIA 4X23B 2F8NK 4WNNA 3WAAD 3AZMC 1P3PD 5GSUD 3AZEB 1P3MB 3MGPA 3WTPD 5B31C 1KX3B 2F2AC 4Z66B 5FUGB 3H0MC 4YM6C 3O62B 3LJAC 3AYWA 5B2ID 3VH5A 2NQBC 5B1LD 3IP4C 1A7WA 5DNNA 3EPJA 3AN2D 1KX5C 5AV5A 5B32D 5B24C 4YS3C 1JFIB 4J8XC 3AZJB 5F99C 4EO5B 5CPKC 2NQBA 3AZIA 4LD9D 1P3BC 2BG1A 3KWQC 3W97B 5KDMB 5AY8B 2BYKA 3FDDA 5B0YA 5B24A 3B6FC 3W99C 5F99A 5B1MA 5CPKA 4H9QA 1TAFB 3C1CC 1Q9CA 3WKJA 1P3IA 2VQRA 1KX4C 3AZKA 3WTPE 1M1AA 3AZMD 4JJNA 5AVCC 3MNNC 4WU8C 1P34B 3X1TB 4H9PA 2NZDA 5B31D 3KXBB 1KX4A 2CWEA 4YM6D 5CHLB 4XZQC 4WU8A 3C1BC 3LJAD 5GT0C 3UT9C 3AZHC 3LELB 1M18A 2NQBD 4KUDB 3MGQB 1TZYB 2BYMB 3AZEA 1HQ3B 1P3MA 2HIOC 5B2JC 3KUYB 4XZQA 3C1BA 4Z66A 1B6WA 3REIC 4YS3D 5B24D 3AZHA 5AV6A 4J8XD 1F66C 5F99D 5CPKD 4R8PB 4DRBA 2HIOA 1P3BD 3KWQD 5B2JA 3O62A 5CPJB 3X1UC 2IO5B 5JRGC 3REIA 3VH5W 3REKB 3B6FD 3WAAB 3W99D 1H3OB 2AROB 3LZ0A 2F8NB 3A1KA 3C1CD 4J8VC 2CV5B 5C3IC 1JFIA 5G49B 5JRGA 1KX4D 3AV2C 5AVCD 3MNND 4WU8D 3B0CW 5KDMA 2PYOC 3AV2A 1P3KB 4Z2MG 4XZQD 3C1BD 1U35C 5GT0D 3UT9D 2PYOA 3AZHD 2L5AA 5AV6D 3TU4B 2YFVA 4KGCB 1ID3A 1P34A 2HIOD 4H9SC 5B2JD 4XUJC 3UTBB 3MGRC 3MVDB 3REID 1U35A 1F66D 5GT3B 1EQZB 2JSSA 3LZ0D 3RELB 3AZNB 3X1UD 4DRAA 5BO0A 5JRGD 3MGRA 3LELA 3W98B 3MGQA 1P3FC 5E5AB 5CP6B 3KUYA 3AZMB 1N1JB 1BH9A 4J8VD 3V9RB 4CAYB 1P3AB 3B0DC 3AZLC 2Y2QA 3AV2D 3LZ1C 5AV8C 4R8PA 3F6TA 3A6NC 1S32B 5CPIC 3VH6T 4HGAC 5AVBB 2PYOD 3NQJB 3REKA 3AZFB 1ULYA 3AZLA 5B32G 1ID3D 1H3OA 2AROA 3LZ1A 3AL0C 2F8NA 3A6NA 3MGPC 1U35D 2ZY5A 3WA9C 1KX5B 3MGSC 3R45A 4ZUXC 1R4VA 4XUJD 3AFAB 4E45A 4ZBJB 5GXQC 3MGRD 1BH8A 3AYWC 3WA9A 3B6GA 2YFWB 4J8UB 1M19C 5DNMB 1P3KA 4G92B 5DNNC 3MGSA 3W99B 4ZUXA 5B31G 5GXQA 5AV5C 5B0ZC 1P3FD 1M19A 1ZLAB 2Y2MA 2ZY3A 3AZIC 3UTBA 3X1VC 3MVDA 1P3GB 3AZLD 5B0YC 1EQZA 2FJ7A 3LZ1D 5AV8D 4J8WB 5AV9B 5B0ZA 3RELA 3A6ND 5B1MC 5BNVA 2LY8A 5CPID 5B40C 1P3LA 3X1VA 1P3OC 2Y2HA 1P3IC 3WKJC 3W98A 4AWLB 4H9NA 5GT0B 3AZKC 1M1AC 2DF4C 4JJNC 5CP6A 1N1JA 3MGPD 3AZGB 3AV1B 4G91B 2NZDC 5B40A 3H0LC 3WA9D 1P3OA 3B6GD 1WWIA 3KFUG 3REJB 5B33B 3MGSD 4QLCC 4ZUXD 5GXQD 3AYWD 2HUEB 3NQJA 4Z5TB 3X1UB 1M19D 1M18C 3AZEC 1P3MC 1AOIA 5DNND 4QLCA 4X23A 4Z66C 5AV5D 5C3IB 5B0ZD 5AV6C 3AZID 3AFAA 4H9OB 3X1VD 3O62C 3X1SB 3A1IA 3REHB 4WU9B 1KX3A 4J8UA 5FUGA 5B0YD 3W96B 5BS7C 5B1MD 3LZ0C 4H9RB 5B40D 2Y2JA 1P3OD 3UTAB 1P3ID 3WKJD 3AZKD 1M1AD 3AZJC 4JJND 4EO5C 4WJ3C 5BS7A 3W97C 1P3PB 5GSUB 2NZDD 5AY8C 3WTPB 4J8WA 3AZJA 3H0RC 4UPKA 4QLCD 4X23D 3W97A 1PZRA 4KHAB 5AY8A 1M18D 2RVQC 5B2IB 4CSRB 3AZED 3B0BA 1P34C 1P3MD 1ID3C 1TAFA 3X1TC 5B1LB 3KXBC 2Y2GA 4Z66D 4E44A 3AN2B 5B32B 3O62D 3X1TA 4LD9B 4HGAB 3KXBA 2Y2KA 3LELC 4KUDC 2Y2NA 3MGQC 1TZYC 1HQ3C 4WNNB 3KUYC 3EG5B 2XD1A 4KUDA 3AZJD 2J8PA 1TZYA 2BYMA 4R8PC 1HQ3A 1T3UA 3W97D 5CPJC 3X1SA 3REHA 2IO5C 5AY8D 5B31B 3REKC 2F8NH 2AROC 2ZY4A 5DNNB 5CPJA 2CV5C 4YM6B 5JA4B 2RVQD 3LJAB 5AV5B 2UWXA 3WAAA 1P34D 2NQBB 3X1TD 1P3PA 3KXBD 2CV5A 5G49A 3B6GC 2BYKB 1W2EA 1P3KC 4YS3B 5B24B 4J8XB 5F99B 5B1MB 5CPKB 4H9QB 1P3BB 3KWQB 3LELD 4KUDD 3WKJB 3TU4C 3MGQD 1TZYD 5B2IA 4KGCC 1HQ3D 3KUYD 5B1LA 3UTBC 3B6FB 3MVDC 4H9PB 3AN2A 3C1CB 4M6BA 5GT3C 1EQZC 2FJ7C 3TU4A 4R8PD 3RELC 1Z2CB 5B32A 4KGCA 3AZNC 1HTAA 1KX4B 5CPJD 4LD9A 1P3LC 5AVCB 4WU8B 3MNNB 3W98C 3REKD 5GT3A 5E5AC 2AROD 5CP6C 1M18B 3EPLA 2F8ND 3AZNA 2XD5A 3NQUB 2CV5D 1P3AC 5BNXB 4XZQB 3C1BB 3UT9B 5E5AA 5AV6B 3AZHB 3AZMA 1S32C 2FFFB 3V9RA 5AVBC 2HIOB 3VH6W 5B2JB 4CAYA 2ZY2A 1P3AA 1BFMA 5B31A 3AZFC 4WZSB 3REIB 1P3KD 1AOIC 1S32A 1F66B 4YM6A 4X23C 5JA4A 3LZ0B 5AVBA 4NFTA 3LJAA 3TU4D 3AZFA 3VH5T 4KGCD 5JRGB 3AFAC 3UTBD 4ZBJC 1WWSA 3MVDD 2G5IC 4NE5A 1KX3C 4J8VB 4J8UC 5GT3D 5DNMC 1KX5A 1EQZD 2FJ7D 3RELD 4G92C 4YS3A 3AZND 4J8XA 3AV2B 4UUZB 1P3LD 1P3BA 3B0CT 3KWQA 3W98D 2YFWA 1ZLAC 2PYOB 2RIQA 5E5AD 5DNMA 2Y2IA 5CP6D 2YFVB 2Y2LA 1ID3B 3B6FA 3W99A 1P3GC 1P3AD 3C1CA 3KSYA 1U35B 4J8WC 5AV9C 1ZLAA 1S32D 4NE3A 5AVBD 5AVCA 3MNNA 1P3GA 4AWLC 4XUJB 3AZFD 3EPKA 2G5HC 5BO0B 3MGRB 5AV9A 1AOID 3AZGC 3NQUA 3AV1C 4G91C 1BH9B 5BNXA 2JCHA 1KX5D 5GT0A 3UT9A 3REJC 5B33C 3AFAD 2W8SA 3AZGA 1P3FB 3AV1A 2HUEC 1KX3D 4Z5TC 4J8UD 5DNMD 1KU5A 3B0DB 3REJA 5B33A 3AZLB 1F66A 3LZ1B 5AV8B 3A6NB 5BT1C 5CPIB 3X1UA 3P5JB 4Z5TA 1B67A 1ZLAD 4Z2MH 2ZM5A 3X1SC 4WU9C 3R45B 3REHC 1P3GD 4J8VA 3MGPB 3W96C 1BH8B 4J8WD 5AV9D 3WA9B 3B6GB 4UUZA 4H9OA 3MGSB 3UTAC 4WU9A 3VH6A 4ZUXB 2Y2OA 5GXQB 3W96A 3AYWB 3WAAC 3AZGD 1M19B 2Y2PA 3AV1D 5GSUC 1P3PC 4H9RA 1F1EA 3UTAA 3WTPC 3REJD 5B33D 2FJ7B 5B0ZB 2F8NG 4H9SA 5BNVB 5GSUA 4DQYB 3AZIB 4XUJA 4Z5TD 1P3LB 3X1VB 3WTPA 5B2IC 4H9NB 5B0YB 3EPHA 5B1LC 2JE5A 5BT1D 4KHAA 3AN2C 5B40B 1P3OB 1P3IB 2DQNC 4CSRA 5B32C 3AZKB 1P3FA 1M1AB 4JJNB 3X1SD 4WU9D 3REHD 4LD9C 3W96D 2NZDB
chains in the Genus database with same CATH topology
5AV8A 4NE6A 1AOIB 4WV4B 3UTAD 4QLCB 5CPIA 4X23B 2F8NK 4WNNA 3WAAD 3AZMC 1P3PD 5GSUD 3AZEB 1P3MB 3MGPA 3WTPD 5B31C 1KX3B 2F2AC 4Z66B 5FUGB 3H0MC 4YM6C 3O62B 3LJAC 3AYWA 5B2ID 3VH5A 2NQBC 5B1LD 3IP4C 1A7WA 5DNNA 3EPJA 3AN2D 1KX5C 5AV5A 5B32D 5B24C 4YS3C 1JFIB 4J8XC 3AZJB 5F99C 4EO5B 5CPKC 2NQBA 3AZIA 4LD9D 1P3BC 2BG1A 3KWQC 3W97B 5KDMB 5AY8B 2BYKA 3FDDA 5B0YA 5B24A 3B6FC 3W99C 5F99A 5B1MA 5CPKA 4H9QA 1TAFB 3C1CC 1Q9CA 3WKJA 1P3IA 2VQRA 1KX4C 3AZKA 3WTPE 1M1AA 3AZMD 4JJNA 5AVCC 3MNNC 4WU8C 1P34B 3X1TB 4H9PA 2NZDA 5B31D 3KXBB 1KX4A 2CWEA 4YM6D 5CHLB 4XZQC 4WU8A 3C1BC 3LJAD 5GT0C 3UT9C 3AZHC 3LELB 1M18A 2NQBD 4KUDB 3MGQB 1TZYB 2BYMB 3AZEA 1HQ3B 1P3MA 2HIOC 5B2JC 3KUYB 4XZQA 3C1BA 4Z66A 1B6WA 3REIC 4YS3D 5B24D 3AZHA 5AV6A 4J8XD 1F66C 5F99D 5CPKD 4R8PB 4DRBA 2HIOA 1P3BD 3KWQD 5B2JA 3O62A 5CPJB 3X1UC 2IO5B 5JRGC 3REIA 3VH5W 3REKB 3B6FD 3WAAB 3W99D 1H3OB 2AROB 3LZ0A 2F8NB 3A1KA 3C1CD 4J8VC 2CV5B 5C3IC 1JFIA 5G49B 5JRGA 1KX4D 3AV2C 5AVCD 3MNND 4WU8D 3B0CW 5KDMA 2PYOC 3AV2A 1P3KB 4Z2MG 4XZQD 3C1BD 1U35C 5GT0D 3UT9D 2PYOA 3AZHD 2L5AA 5AV6D 3TU4B 2YFVA 4KGCB 1ID3A 1P34A 2HIOD 4H9SC 5B2JD 4XUJC 3UTBB 3MGRC 3MVDB 3REID 1U35A 1F66D 5GT3B 1EQZB 2JSSA 3LZ0D 3RELB 3AZNB 3X1UD 4DRAA 5BO0A 5JRGD 3MGRA 3LELA 3W98B 3MGQA 1P3FC 5E5AB 5CP6B 3KUYA 3AZMB 1N1JB 1BH9A 4J8VD 3V9RB 4CAYB 1P3AB 3B0DC 3AZLC 2Y2QA 3AV2D 3LZ1C 5AV8C 4R8PA 3F6TA 3A6NC 1S32B 5CPIC 3VH6T 4HGAC 5AVBB 2PYOD 3NQJB 3REKA 3AZFB 1ULYA 3AZLA 5B32G 1ID3D 1H3OA 2AROA 3LZ1A 3AL0C 2F8NA 3A6NA 3MGPC 1U35D 2ZY5A 3WA9C 1KX5B 3MGSC 3R45A 4ZUXC 1R4VA 4XUJD 3AFAB 4E45A 4ZBJB 5GXQC 3MGRD 1BH8A 3AYWC 3WA9A 3B6GA 2YFWB 4J8UB 1M19C 5DNMB 1P3KA 4G92B 5DNNC 3MGSA 3W99B 4ZUXA 5B31G 5GXQA 5AV5C 5B0ZC 1P3FD 1M19A 1ZLAB 2Y2MA 2ZY3A 3AZIC 3UTBA 3X1VC 3MVDA 1P3GB 3AZLD 5B0YC 1EQZA 2FJ7A 3LZ1D 5AV8D 4J8WB 5AV9B 5B0ZA 3RELA 3A6ND 5B1MC 5BNVA 2LY8A 5CPID 5B40C 1P3LA 3X1VA 1P3OC 2Y2HA 1P3IC 3WKJC 3W98A 4AWLB 4H9NA 5GT0B 3AZKC 1M1AC 2DF4C 4JJNC 5CP6A 1N1JA 3MGPD 3AZGB 3AV1B 4G91B 2NZDC 5B40A 3H0LC 3WA9D 1P3OA 3B6GD 1WWIA 3KFUG 3REJB 5B33B 3MGSD 4QLCC 4ZUXD 5GXQD 3AYWD 2HUEB 3NQJA 4Z5TB 3X1UB 1M19D 1M18C 3AZEC 1P3MC 1AOIA 5DNND 4QLCA 4X23A 4Z66C 5AV5D 5C3IB 5B0ZD 5AV6C 3AZID 3AFAA 4H9OB 3X1VD 3O62C 3X1SB 3A1IA 3REHB 4WU9B 1KX3A 4J8UA 5FUGA 5B0YD 3W96B 5BS7C 5B1MD 3LZ0C 4H9RB 5B40D 2Y2JA 1P3OD 3UTAB 1P3ID 3WKJD 3AZKD 1M1AD 3AZJC 4JJND 4EO5C 4WJ3C 5BS7A 3W97C 1P3PB 5GSUB 2NZDD 5AY8C 3WTPB 4J8WA 3AZJA 3H0RC 4UPKA 4QLCD 4X23D 3W97A 1PZRA 4KHAB 5AY8A 1M18D 2RVQC 5B2IB 4CSRB 3AZED 3B0BA 1P34C 1P3MD 1ID3C 1TAFA 3X1TC 5B1LB 3KXBC 2Y2GA 4Z66D 4E44A 3AN2B 5B32B 3O62D 3X1TA 4LD9B 4HGAB 3KXBA 2Y2KA 3LELC 4KUDC 2Y2NA 3MGQC 1TZYC 1HQ3C 4WNNB 3KUYC 3EG5B 2XD1A 4KUDA 3AZJD 2J8PA 1TZYA 2BYMA 4R8PC 1HQ3A 1T3UA 3W97D 5CPJC 3X1SA 3REHA 2IO5C 5AY8D 5B31B 3REKC 2F8NH 2AROC 2ZY4A 5DNNB 5CPJA 2CV5C 4YM6B 5JA4B 2RVQD 3LJAB 5AV5B 2UWXA 3WAAA 1P34D 2NQBB 3X1TD 1P3PA 3KXBD 2CV5A 5G49A 3B6GC 2BYKB 1W2EA 1P3KC 4YS3B 5B24B 4J8XB 5F99B 5B1MB 5CPKB 4H9QB 1P3BB 3KWQB 3LELD 4KUDD 3WKJB 3TU4C 3MGQD 1TZYD 5B2IA 4KGCC 1HQ3D 3KUYD 5B1LA 3UTBC 3B6FB 3MVDC 4H9PB 3AN2A 3C1CB 4M6BA 5GT3C 1EQZC 2FJ7C 3TU4A 4R8PD 3RELC 1Z2CB 5B32A 4KGCA 3AZNC 1HTAA 1KX4B 5CPJD 4LD9A 1P3LC 5AVCB 4WU8B 3MNNB 3W98C 3REKD 5GT3A 5E5AC 2AROD 5CP6C 1M18B 3EPLA 2F8ND 3AZNA 2XD5A 3NQUB 2CV5D 1P3AC 5BNXB 4XZQB 3C1BB 3UT9B 5E5AA 5AV6B 3AZHB 3AZMA 1S32C 2FFFB 3V9RA 5AVBC 2HIOB 3VH6W 5B2JB 4CAYA 2ZY2A 1P3AA 1BFMA 5B31A 3AZFC 4WZSB 3REIB 1P3KD 1AOIC 1S32A 1F66B 4YM6A 4X23C 5JA4A 3LZ0B 5AVBA 4NFTA 3LJAA 3TU4D 3AZFA 3VH5T 4KGCD 5JRGB 3AFAC 3UTBD 4ZBJC 1WWSA 3MVDD 2G5IC 4NE5A 1KX3C 4J8VB 4J8UC 5GT3D 5DNMC 1KX5A 1EQZD 2FJ7D 3RELD 4G92C 4YS3A 3AZND 4J8XA 3AV2B 4UUZB 1P3LD 1P3BA 3B0CT 3KWQA 3W98D 2YFWA 1ZLAC 2PYOB 2RIQA 5E5AD 5DNMA 2Y2IA 5CP6D 2YFVB 2Y2LA 1ID3B 3B6FA 3W99A 1P3GC 1P3AD 3C1CA 3KSYA 1U35B 4J8WC 5AV9C 1ZLAA 1S32D 4NE3A 5AVBD 5AVCA 3MNNA 1P3GA 4AWLC 4XUJB 3AZFD 3EPKA 2G5HC 5BO0B 3MGRB 5AV9A 1AOID 3AZGC 3NQUA 3AV1C 4G91C 1BH9B 5BNXA 2JCHA 1KX5D 5GT0A 3UT9A 3REJC 5B33C 3AFAD 2W8SA 3AZGA 1P3FB 3AV1A 2HUEC 1KX3D 4Z5TC 4J8UD 5DNMD 1KU5A 3B0DB 3REJA 5B33A 3AZLB 1F66A 3LZ1B 5AV8B 3A6NB 5BT1C 5CPIB 3X1UA 3P5JB 4Z5TA 1B67A 1ZLAD 4Z2MH 2ZM5A 3X1SC 4WU9C 3R45B 3REHC 1P3GD 4J8VA 3MGPB 3W96C 1BH8B 4J8WD 5AV9D 3WA9B 3B6GB 4UUZA 4H9OA 3MGSB 3UTAC 4WU9A 3VH6A 4ZUXB 2Y2OA 5GXQB 3W96A 3AYWB 3WAAC 3AZGD 1M19B 2Y2PA 3AV1D 5GSUC 1P3PC 4H9RA 1F1EA 3UTAA 3WTPC 3REJD 5B33D 2FJ7B 5B0ZB 2F8NG 4H9SA 5BNVB 5GSUA 4DQYB 3AZIB 4XUJA 4Z5TD 1P3LB 3X1VB 3WTPA 5B2IC 4H9NB 5B0YB 3EPHA 5B1LC 2JE5A 5BT1D 4KHAA 3AN2C 5B40B 1P3OB 1P3IB 2DQNC 4CSRA 5B32C 3AZKB 1P3FA 1M1AB 4JJNB 3X1SD 4WU9D 3REHD 4LD9C 3W96D 2NZDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AV8 A;  4NE6 A;  1AOI B;  4WV4 B;  3UTA D;  4QLC B;  5CPI A;  4X23 B;  2F8N K;  4WNN A;  3WAA D;  3AZM C;  1P3P D;  5GSU D;  3AZE B;  1P3M B;  3MGP A;  3WTP D;  5B31 C;  1KX3 B;  4Z66 B;  5FUG B;  4YM6 C;  3O62 B;  3LJA C;  3AYW A;  5B2I D;  3VH5 A;  2NQB C;  5B1L D;  1A7W A;  5DNN A;  3AN2 D;  1KX5 C;  5AV5 A;  5B32 D;  5B24 C;  4YS3 C;  1JFI B;  4J8X C;  3AZJ B;  5F99 C;  4EO5 B;  5CPK C;  2NQB A;  3AZI A;  4LD9 D;  1P3B C;  3KWQ C;  3W97 B;  5KDM B;  5AY8 B;  2BYK A;  5B0Y A;  5B24 A;  3B6F C;  3W99 C;  5F99 A;  5B1M A;  5CPK A;  4H9Q A;  1TAF B;  3C1C C;  1Q9C A;  3WKJ A;  1P3I A;  1KX4 C;  3AZK A;  3WTP E;  1M1A A;  3AZM D;  4JJN A;  5AVC C;  3MNN C;  4WU8 C;  1P34 B;  3X1T B;  4H9P A;  2NZD A;  5B31 D;  3KXB B;  1KX4 A;  2CWE A;  4YM6 D;  5CHL B;  4XZQ C;  4WU8 A;  3C1B C;  3LJA D;  5GT0 C;  3UT9 C;  3AZH C;  3LEL B;  1M18 A;  2NQB D;  4KUD B;  3MGQ B;  1TZY B;  2BYM B;  3AZE A;  1HQ3 B;  1P3M A;  2HIO C;  5B2J C;  3KUY B;  4XZQ A;  3C1B A;  4Z66 A;  1B6W A;  3REI C;  4YS3 D;  5B24 D;  3AZH A;  5AV6 A;  4J8X D;  1F66 C;  5F99 D;  5CPK D;  4R8P B;  4DRB A;  2HIO A;  1P3B D;  3KWQ D;  5B2J A;  3O62 A;  5CPJ B;  3X1U C;  2IO5 B;  5JRG C;  3REI A;  3VH5 W;  3REK B;  3B6F D;  3WAA B;  3W99 D;  1H3O B;  2ARO B;  3LZ0 A;  2F8N B;  3C1C D;  4J8V C;  2CV5 B;  5C3I C;  1JFI A;  5G49 B;  5JRG A;  1KX4 D;  3AV2 C;  5AVC D;  3MNN D;  4WU8 D;  3B0C W;  5KDM A;  2PYO C;  3AV2 A;  1P3K B;  4Z2M G;  4XZQ D;  3C1B D;  1U35 C;  5GT0 D;  3UT9 D;  2PYO A;  3AZH D;  2L5A A;  5AV6 D;  3TU4 B;  2YFV A;  4KGC B;  1ID3 A;  1P34 A;  2HIO D;  4H9S C;  5B2J D;  4XUJ C;  3UTB B;  3MGR C;  3MVD B;  3REI D;  1U35 A;  1F66 D;  5GT3 B;  1EQZ B;  2JSS A;  3LZ0 D;  3REL B;  3AZN B;  3X1U D;  4DRA A;  5BO0 A;  5JRG D;  3MGR A;  3LEL A;  3W98 B;  3MGQ A;  1P3F C;  5E5A B;  5CP6 B;  3KUY A;  3AZM B;  1N1J B;  1BH9 A;  4J8V D;  3V9R B;  4CAY B;  1P3A B;  3B0D C;  3AZL C;  3AV2 D;  3LZ1 C;  5AV8 C;  4R8P A;  3A6N C;  1S32 B;  5CPI C;  3VH6 T;  4HGA C;  5AVB B;  2PYO D;  3NQJ B;  3REK A;  3AZF B;  1ULY A;  3AZL A;  5B32 G;  1ID3 D;  1H3O A;  2ARO A;  3LZ1 A;  2F8N A;  3A6N A;  3MGP C;  1U35 D;  3WA9 C;  1KX5 B;  3MGS C;  3R45 A;  4ZUX C;  1R4V A;  4XUJ D;  3AFA B;  4E45 A;  4ZBJ B;  5GXQ C;  3MGR D;  1BH8 A;  3AYW C;  3WA9 A;  3B6G A;  2YFW B;  4J8U B;  1M19 C;  5DNM B;  1P3K A;  4G92 B;  5DNN C;  3MGS A;  3W99 B;  4ZUX A;  5B31 G;  5GXQ A;  5AV5 C;  5B0Z C;  1P3F D;  1M19 A;  1ZLA B;  3AZI C;  3UTB A;  3X1V C;  3MVD A;  1P3G B;  3AZL D;  5B0Y C;  1EQZ A;  2FJ7 A;  3LZ1 D;  5AV8 D;  4J8W B;  5AV9 B;  5B0Z A;  3REL A;  3A6N D;  5B1M C;  5BNV A;  2LY8 A;  5CPI D;  5B40 C;  1P3L A;  3X1V A;  1P3O C;  3WKJ C;  1P3I C;  3W98 A;  4AWL B;  4H9N A;  5GT0 B;  3AZK C;  1M1A C;  4JJN C;  5CP6 A;  1N1J A;  3MGP D;  3AZG B;  3AV1 B;  4G91 B;  2NZD C;  5B40 A;  3WA9 D;  1P3O A;  3B6G D;  1WWI A;  3REJ B;  5B33 B;  3MGS D;  4QLC C;  4ZUX D;  5GXQ D;  3AYW D;  2HUE B;  3NQJ A;  4Z5T B;  3X1U B;  1M19 D;  1M18 C;  3AZE C;  1P3M C;  1AOI A;  5DNN D;  4QLC A;  4X23 A;  4Z66 C;  5AV5 D;  5C3I B;  5B0Z D;  5AV6 C;  3AZI D;  3AFA A;  4H9O B;  3X1V D;  3O62 C;  3X1S B;  4WU9 B;  3REH B;  1KX3 A;  4J8U A;  5FUG A;  5B0Y D;  3W96 B;  5BS7 C;  5B1M D;  3LZ0 C;  4H9R B;  5B40 D;  1P3O D;  3UTA B;  1P3I D;  3WKJ D;  3AZK D;  1M1A D;  3AZJ C;  4JJN D;  4EO5 C;  5BS7 A;  3W97 C;  1P3P B;  5GSU B;  2NZD D;  5AY8 C;  3WTP B;  4J8W A;  3AZJ A;  4QLC D;  4X23 D;  3W97 A;  4KHA B;  5AY8 A;  1M18 D;  2RVQ C;  5B2I B;  4CSR B;  3AZE D;  3B0B A;  1P34 C;  1P3M D;  1ID3 C;  1TAF A;  3X1T C;  5B1L B;  3KXB C;  4Z66 D;  4E44 A;  3AN2 B;  5B32 B;  3O62 D;  3X1T A;  4LD9 B;  4HGA B;  3KXB A;  3LEL C;  4KUD C;  3MGQ C;  1TZY C;  1HQ3 C;  4WNN B;  3KUY C;  4KUD A;  3AZJ D;  1TZY A;  2BYM A;  4R8P C;  1HQ3 A;  3W97 D;  5CPJ C;  3X1S A;  3REH A;  2IO5 C;  5AY8 D;  5B31 B;  3REK C;  2F8N H;  2ARO C;  5DNN B;  5CPJ A;  2CV5 C;  4YM6 B;  5JA4 B;  2RVQ D;  3LJA B;  5AV5 B;  3WAA A;  1P34 D;  2NQB B;  3X1T D;  1P3P A;  3KXB D;  2CV5 A;  5G49 A;  3B6G C;  2BYK B;  1P3K C;  4YS3 B;  5B24 B;  4J8X B;  5F99 B;  5B1M B;  5CPK B;  4H9Q B;  1P3B B;  3KWQ B;  3LEL D;  4KUD D;  3WKJ B;  3TU4 C;  3MGQ D;  1TZY D;  5B2I A;  4KGC C;  1HQ3 D;  3KUY D;  5B1L A;  3UTB C;  3B6F B;  3MVD C;  4H9P B;  3AN2 A;  3C1C B;  4M6B A;  5GT3 C;  1EQZ C;  2FJ7 C;  3TU4 A;  4R8P D;  3REL C;  5B32 A;  4KGC A;  3AZN C;  1HTA A;  1KX4 B;  5CPJ D;  4LD9 A;  1P3L C;  5AVC B;  4WU8 B;  3MNN B;  3W98 C;  3REK D;  5GT3 A;  5E5A C;  2ARO D;  5CP6 C;  1M18 B;  2F8N D;  3AZN A;  3NQU B;  2CV5 D;  1P3A C;  5BNX B;  4XZQ B;  3C1B B;  3UT9 B;  5E5A A;  5AV6 B;  3AZH B;  3AZM A;  1S32 C;  3V9R A;  5AVB C;  2HIO B;  3VH6 W;  5B2J B;  4CAY A;  1P3A A;  1BFM A;  5B31 A;  3AZF C;  4WZS B;  3REI B;  1P3K D;  1AOI C;  1S32 A;  1F66 B;  4YM6 A;  4X23 C;  5JA4 A;  3LZ0 B;  5AVB A;  4NFT A;  3LJA A;  3TU4 D;  3AZF A;  3VH5 T;  4KGC D;  5JRG B;  3AFA C;  3UTB D;  4ZBJ C;  1WWS A;  3MVD D;  4NE5 A;  1KX3 C;  4J8V B;  4J8U C;  5GT3 D;  5DNM C;  1KX5 A;  1EQZ D;  2FJ7 D;  3REL D;  4G92 C;  4YS3 A;  3AZN D;  4J8X A;  3AV2 B;  4UUZ B;  1P3L D;  1P3B A;  3B0C T;  3KWQ A;  3W98 D;  2YFW A;  1ZLA C;  2PYO B;  5E5A D;  5DNM A;  5CP6 D;  2YFV B;  3B6F A;  1ID3 B;  3W99 A;  1P3G C;  1P3A D;  3C1C A;  3KSY A;  1U35 B;  4J8W C;  5AV9 C;  1ZLA A;  1S32 D;  4NE3 A;  5AVB D;  5AVC A;  3MNN A;  1P3G A;  4AWL C;  4XUJ B;  3AZF D;  5BO0 B;  3MGR B;  5AV9 A;  1AOI D;  3AZG C;  3NQU A;  3AV1 C;  4G91 C;  1BH9 B;  5BNX A;  1KX5 D;  5GT0 A;  3UT9 A;  3REJ C;  5B33 C;  3AFA D;  3AZG A;  1P3F B;  3AV1 A;  2HUE C;  1KX3 D;  4Z5T C;  4J8U D;  5DNM D;  1KU5 A;  3B0D B;  3REJ A;  5B33 A;  3AZL B;  1F66 A;  3LZ1 B;  5AV8 B;  3A6N B;  5BT1 C;  5CPI B;  3X1U A;  4Z5T A;  1B67 A;  1ZLA D;  4Z2M H;  3X1S C;  1P3G D;  4WU9 C;  3R45 B;  3REH C;  4J8V A;  3MGP B;  3W96 C;  1BH8 B;  4J8W D;  5AV9 D;  3WA9 B;  3B6G B;  4UUZ A;  4H9O A;  3MGS B;  3UTA C;  4WU9 A;  3VH6 A;  4ZUX B;  5GXQ B;  3W96 A;  3AYW B;  3WAA C;  3AZG D;  1M19 B;  3AV1 D;  1P3P C;  5GSU C;  4H9R A;  1F1E A;  3UTA A;  3WTP C;  3REJ D;  5B33 D;  2FJ7 B;  5B0Z B;  2F8N G;  4H9S A;  5BNV B;  5GSU A;  3AZI B;  4XUJ A;  4Z5T D;  1P3L B;  3X1V B;  3WTP A;  5B2I C;  4H9N B;  5B0Y B;  5B1L C;  5BT1 D;  4KHA A;  3AN2 C;  5B40 B;  1P3O B;  1P3I B;  4CSR A;  5B32 C;  3AZK B;  1P3F A;  1M1A B;  4JJN B;  3X1S D;  4WU9 D;  3REH D;  4LD9 C;  3W96 D;  2NZD B; 
#chains in the Genus database with same CATH topology
 5AV8 A;  4NE6 A;  1AOI B;  4WV4 B;  3UTA D;  4QLC B;  5CPI A;  4X23 B;  2F8N K;  4WNN A;  3WAA D;  3AZM C;  1P3P D;  5GSU D;  3AZE B;  1P3M B;  3MGP A;  3WTP D;  5B31 C;  1KX3 B;  2F2A C;  4Z66 B;  5FUG B;  3H0M C;  4YM6 C;  3O62 B;  3LJA C;  3AYW A;  5B2I D;  3VH5 A;  2NQB C;  5B1L D;  3IP4 C;  1A7W A;  5DNN A;  3EPJ A;  3AN2 D;  1KX5 C;  5AV5 A;  5B32 D;  5B24 C;  4YS3 C;  1JFI B;  4J8X C;  3AZJ B;  5F99 C;  4EO5 B;  5CPK C;  2NQB A;  3AZI A;  4LD9 D;  1P3B C;  2BG1 A;  3KWQ C;  3W97 B;  5KDM B;  5AY8 B;  2BYK A;  3FDD A;  5B0Y A;  5B24 A;  3B6F C;  3W99 C;  5F99 A;  5B1M A;  5CPK A;  4H9Q A;  1TAF B;  3C1C C;  1Q9C A;  3WKJ A;  1P3I A;  2VQR A;  1KX4 C;  3AZK A;  3WTP E;  1M1A A;  3AZM D;  4JJN A;  5AVC C;  3MNN C;  4WU8 C;  1P34 B;  3X1T B;  4H9P A;  2NZD A;  5B31 D;  3KXB B;  1KX4 A;  2CWE A;  4YM6 D;  5CHL B;  4XZQ C;  4WU8 A;  3C1B C;  3LJA D;  5GT0 C;  3UT9 C;  3AZH C;  3LEL B;  1M18 A;  2NQB D;  4KUD B;  3MGQ B;  1TZY B;  2BYM B;  3AZE A;  1HQ3 B;  1P3M A;  2HIO C;  5B2J C;  3KUY B;  4XZQ A;  3C1B A;  4Z66 A;  1B6W A;  3REI C;  4YS3 D;  5B24 D;  3AZH A;  5AV6 A;  4J8X D;  1F66 C;  5F99 D;  5CPK D;  4R8P B;  4DRB A;  2HIO A;  1P3B D;  3KWQ D;  5B2J A;  3O62 A;  5CPJ B;  3X1U C;  2IO5 B;  5JRG C;  3REI A;  3VH5 W;  3REK B;  3B6F D;  3WAA B;  3W99 D;  1H3O B;  2ARO B;  3LZ0 A;  2F8N B;  3A1K A;  3C1C D;  4J8V C;  2CV5 B;  5C3I C;  1JFI A;  5G49 B;  5JRG A;  1KX4 D;  3AV2 C;  5AVC D;  3MNN D;  4WU8 D;  3B0C W;  5KDM A;  2PYO C;  3AV2 A;  1P3K B;  4Z2M G;  4XZQ D;  3C1B D;  1U35 C;  5GT0 D;  3UT9 D;  2PYO A;  3AZH D;  2L5A A;  5AV6 D;  3TU4 B;  2YFV A;  4KGC B;  1ID3 A;  1P34 A;  2HIO D;  4H9S C;  5B2J D;  4XUJ C;  3UTB B;  3MGR C;  3MVD B;  3REI D;  1U35 A;  1F66 D;  5GT3 B;  1EQZ B;  2JSS A;  3LZ0 D;  3REL B;  3AZN B;  3X1U D;  4DRA A;  5BO0 A;  5JRG D;  3MGR A;  3LEL A;  3W98 B;  3MGQ A;  1P3F C;  5E5A B;  5CP6 B;  3KUY A;  3AZM B;  1N1J B;  1BH9 A;  4J8V D;  3V9R B;  4CAY B;  1P3A B;  3B0D C;  3AZL C;  2Y2Q A;  3AV2 D;  3LZ1 C;  5AV8 C;  4R8P A;  3F6T A;  3A6N C;  1S32 B;  5CPI C;  3VH6 T;  4HGA C;  5AVB B;  2PYO D;  3NQJ B;  3REK A;  3AZF B;  1ULY A;  3AZL A;  5B32 G;  1ID3 D;  1H3O A;  2ARO A;  3LZ1 A;  3AL0 C;  2F8N A;  3A6N A;  3MGP C;  1U35 D;  2ZY5 A;  3WA9 C;  1KX5 B;  3MGS C;  3R45 A;  4ZUX C;  1R4V A;  4XUJ D;  3AFA B;  4E45 A;  4ZBJ B;  5GXQ C;  3MGR D;  1BH8 A;  3AYW C;  3WA9 A;  3B6G A;  2YFW B;  4J8U B;  1M19 C;  5DNM B;  1P3K A;  4G92 B;  5DNN C;  3MGS A;  3W99 B;  4ZUX A;  5B31 G;  5GXQ A;  5AV5 C;  5B0Z C;  1P3F D;  1M19 A;  1ZLA B;  2Y2M A;  2ZY3 A;  3AZI C;  3UTB A;  3X1V C;  3MVD A;  1P3G B;  3AZL D;  5B0Y C;  1EQZ A;  2FJ7 A;  3LZ1 D;  5AV8 D;  4J8W B;  5AV9 B;  5B0Z A;  3REL A;  3A6N D;  5B1M C;  5BNV A;  2LY8 A;  5CPI D;  5B40 C;  1P3L A;  3X1V A;  1P3O C;  2Y2H A;  1P3I C;  3WKJ C;  3W98 A;  4AWL B;  4H9N A;  5GT0 B;  3AZK C;  1M1A C;  2DF4 C;  4JJN C;  5CP6 A;  1N1J A;  3MGP D;  3AZG B;  3AV1 B;  4G91 B;  2NZD C;  5B40 A;  3H0L C;  3WA9 D;  1P3O A;  3B6G D;  1WWI A;  3KFU G;  3REJ B;  5B33 B;  3MGS D;  4QLC C;  4ZUX D;  5GXQ D;  3AYW D;  2HUE B;  3NQJ A;  4Z5T B;  3X1U B;  1M19 D;  1M18 C;  3AZE C;  1P3M C;  1AOI A;  5DNN D;  4QLC A;  4X23 A;  4Z66 C;  5AV5 D;  5C3I B;  5B0Z D;  5AV6 C;  3AZI D;  3AFA A;  4H9O B;  3X1V D;  3O62 C;  3X1S B;  3A1I A;  3REH B;  4WU9 B;  1KX3 A;  4J8U A;  5FUG A;  5B0Y D;  3W96 B;  5BS7 C;  5B1M D;  3LZ0 C;  4H9R B;  5B40 D;  2Y2J A;  1P3O D;  3UTA B;  1P3I D;  3WKJ D;  3AZK D;  1M1A D;  3AZJ C;  4JJN D;  4EO5 C;  4WJ3 C;  5BS7 A;  3W97 C;  1P3P B;  5GSU B;  2NZD D;  5AY8 C;  3WTP B;  4J8W A;  3AZJ A;  3H0R C;  4UPK A;  4QLC D;  4X23 D;  3W97 A;  1PZR A;  4KHA B;  5AY8 A;  1M18 D;  2RVQ C;  5B2I B;  4CSR B;  3AZE D;  3B0B A;  1P34 C;  1P3M D;  1ID3 C;  1TAF A;  3X1T C;  5B1L B;  3KXB C;  2Y2G A;  4Z66 D;  4E44 A;  3AN2 B;  5B32 B;  3O62 D;  3X1T A;  4LD9 B;  4HGA B;  3KXB A;  2Y2K A;  3LEL C;  4KUD C;  2Y2N A;  3MGQ C;  1TZY C;  1HQ3 C;  4WNN B;  3KUY C;  3EG5 B;  2XD1 A;  4KUD A;  3AZJ D;  2J8P A;  1TZY A;  2BYM A;  4R8P C;  1HQ3 A;  1T3U A;  3W97 D;  5CPJ C;  3X1S A;  3REH A;  2IO5 C;  5AY8 D;  5B31 B;  3REK C;  2F8N H;  2ARO C;  2ZY4 A;  5DNN B;  5CPJ A;  2CV5 C;  4YM6 B;  5JA4 B;  2RVQ D;  3LJA B;  5AV5 B;  2UWX A;  3WAA A;  1P34 D;  2NQB B;  3X1T D;  1P3P A;  3KXB D;  2CV5 A;  5G49 A;  3B6G C;  2BYK B;  1W2E A;  1P3K C;  4YS3 B;  5B24 B;  4J8X B;  5F99 B;  5B1M B;  5CPK B;  4H9Q B;  1P3B B;  3KWQ B;  3LEL D;  4KUD D;  3WKJ B;  3TU4 C;  3MGQ D;  1TZY D;  5B2I A;  4KGC C;  1HQ3 D;  3KUY D;  5B1L A;  3UTB C;  3B6F B;  3MVD C;  4H9P B;  3AN2 A;  3C1C B;  4M6B A;  5GT3 C;  1EQZ C;  2FJ7 C;  3TU4 A;  4R8P D;  3REL C;  1Z2C B;  5B32 A;  4KGC A;  3AZN C;  1HTA A;  1KX4 B;  5CPJ D;  4LD9 A;  1P3L C;  5AVC B;  4WU8 B;  3MNN B;  3W98 C;  3REK D;  5GT3 A;  5E5A C;  2ARO D;  5CP6 C;  1M18 B;  3EPL A;  2F8N D;  3AZN A;  2XD5 A;  3NQU B;  2CV5 D;  1P3A C;  5BNX B;  4XZQ B;  3C1B B;  3UT9 B;  5E5A A;  5AV6 B;  3AZH B;  3AZM A;  1S32 C;  2FFF B;  3V9R A;  5AVB C;  2HIO B;  3VH6 W;  5B2J B;  4CAY A;  2ZY2 A;  1P3A A;  1BFM A;  5B31 A;  3AZF C;  4WZS B;  3REI B;  1P3K D;  1AOI C;  1S32 A;  1F66 B;  4YM6 A;  4X23 C;  5JA4 A;  3LZ0 B;  5AVB A;  4NFT A;  3LJA A;  3TU4 D;  3AZF A;  3VH5 T;  4KGC D;  5JRG B;  3AFA C;  3UTB D;  4ZBJ C;  1WWS A;  3MVD D;  2G5I C;  4NE5 A;  1KX3 C;  4J8V B;  4J8U C;  5GT3 D;  5DNM C;  1KX5 A;  1EQZ D;  2FJ7 D;  3REL D;  4G92 C;  4YS3 A;  3AZN D;  4J8X A;  3AV2 B;  4UUZ B;  1P3L D;  1P3B A;  3B0C T;  3KWQ A;  3W98 D;  2YFW A;  1ZLA C;  2PYO B;  2RIQ A;  5E5A D;  5DNM A;  2Y2I A;  5CP6 D;  2YFV B;  2Y2L A;  1ID3 B;  3B6F A;  3W99 A;  1P3G C;  1P3A D;  3C1C A;  3KSY A;  1U35 B;  4J8W C;  5AV9 C;  1ZLA A;  1S32 D;  4NE3 A;  5AVB D;  5AVC A;  3MNN A;  1P3G A;  4AWL C;  4XUJ B;  3AZF D;  3EPK A;  2G5H C;  5BO0 B;  3MGR B;  5AV9 A;  1AOI D;  3AZG C;  3NQU A;  3AV1 C;  4G91 C;  1BH9 B;  5BNX A;  2JCH A;  1KX5 D;  5GT0 A;  3UT9 A;  3REJ C;  5B33 C;  3AFA D;  2W8S A;  3AZG A;  1P3F B;  3AV1 A;  2HUE C;  1KX3 D;  4Z5T C;  4J8U D;  5DNM D;  1KU5 A;  3B0D B;  3REJ A;  5B33 A;  3AZL B;  1F66 A;  3LZ1 B;  5AV8 B;  3A6N B;  5BT1 C;  5CPI B;  3X1U A;  3P5J B;  4Z5T A;  1B67 A;  1ZLA D;  4Z2M H;  2ZM5 A;  3X1S C;  4WU9 C;  3R45 B;  3REH C;  1P3G D;  4J8V A;  3MGP B;  3W96 C;  1BH8 B;  4J8W D;  5AV9 D;  3WA9 B;  3B6G B;  4UUZ A;  4H9O A;  3MGS B;  3UTA C;  4WU9 A;  3VH6 A;  4ZUX B;  2Y2O A;  5GXQ B;  3W96 A;  3AYW B;  3WAA C;  3AZG D;  1M19 B;  2Y2P A;  3AV1 D;  5GSU C;  1P3P C;  4H9R A;  1F1E A;  3UTA A;  3WTP C;  3REJ D;  5B33 D;  2FJ7 B;  5B0Z B;  2F8N G;  4H9S A;  5BNV B;  5GSU A;  4DQY B;  3AZI B;  4XUJ A;  4Z5T D;  1P3L B;  3X1V B;  3WTP A;  5B2I C;  4H9N B;  5B0Y B;  3EPH A;  5B1L C;  2JE5 A;  5BT1 D;  4KHA A;  3AN2 C;  5B40 B;  1P3O B;  1P3I B;  2DQN C;  4CSR A;  5B32 C;  3AZK B;  1P3F A;  1M1A B;  4JJN B;  3X1S D;  4WU9 D;  3REH D;  4LD9 C;  3W96 D;  2NZD B; 
#chains in the Genus database with same CATH homology
 5AV8 A;  4NE6 A;  1AOI B;  4WV4 B;  3UTA D;  4QLC B;  5CPI A;  4X23 B;  2F8N K;  4WNN A;  3WAA D;  3AZM C;  1P3P D;  5GSU D;  3AZE B;  1P3M B;  3MGP A;  3WTP D;  5B31 C;  1KX3 B;  2F2A C;  4Z66 B;  5FUG B;  3H0M C;  4YM6 C;  3O62 B;  3LJA C;  3AYW A;  5B2I D;  3VH5 A;  2NQB C;  5B1L D;  3IP4 C;  1A7W A;  5DNN A;  3EPJ A;  3AN2 D;  1KX5 C;  5AV5 A;  5B32 D;  5B24 C;  4YS3 C;  1JFI B;  4J8X C;  3AZJ B;  5F99 C;  4EO5 B;  5CPK C;  2NQB A;  3AZI A;  4LD9 D;  1P3B C;  2BG1 A;  3KWQ C;  3W97 B;  5KDM B;  5AY8 B;  2BYK A;  3FDD A;  5B0Y A;  5B24 A;  3B6F C;  3W99 C;  5F99 A;  5B1M A;  5CPK A;  4H9Q A;  1TAF B;  3C1C C;  1Q9C A;  3WKJ A;  1P3I A;  2VQR A;  1KX4 C;  3AZK A;  3WTP E;  1M1A A;  3AZM D;  4JJN A;  5AVC C;  3MNN C;  4WU8 C;  1P34 B;  3X1T B;  4H9P A;  2NZD A;  5B31 D;  3KXB B;  1KX4 A;  2CWE A;  4YM6 D;  5CHL B;  4XZQ C;  4WU8 A;  3C1B C;  3LJA D;  5GT0 C;  3UT9 C;  3AZH C;  3LEL B;  1M18 A;  2NQB D;  4KUD B;  3MGQ B;  1TZY B;  2BYM B;  3AZE A;  1HQ3 B;  1P3M A;  2HIO C;  5B2J C;  3KUY B;  4XZQ A;  3C1B A;  4Z66 A;  1B6W A;  3REI C;  4YS3 D;  5B24 D;  3AZH A;  5AV6 A;  4J8X D;  1F66 C;  5F99 D;  5CPK D;  4R8P B;  4DRB A;  2HIO A;  1P3B D;  3KWQ D;  5B2J A;  3O62 A;  5CPJ B;  3X1U C;  2IO5 B;  5JRG C;  3REI A;  3VH5 W;  3REK B;  3B6F D;  3WAA B;  3W99 D;  1H3O B;  2ARO B;  3LZ0 A;  2F8N B;  3A1K A;  3C1C D;  4J8V C;  2CV5 B;  5C3I C;  1JFI A;  5G49 B;  5JRG A;  1KX4 D;  3AV2 C;  5AVC D;  3MNN D;  4WU8 D;  3B0C W;  5KDM A;  2PYO C;  3AV2 A;  1P3K B;  4Z2M G;  4XZQ D;  3C1B D;  1U35 C;  5GT0 D;  3UT9 D;  2PYO A;  3AZH D;  2L5A A;  5AV6 D;  3TU4 B;  2YFV A;  4KGC B;  1ID3 A;  1P34 A;  2HIO D;  4H9S C;  5B2J D;  4XUJ C;  3UTB B;  3MGR C;  3MVD B;  3REI D;  1U35 A;  1F66 D;  5GT3 B;  1EQZ B;  2JSS A;  3LZ0 D;  3REL B;  3AZN B;  3X1U D;  4DRA A;  5BO0 A;  5JRG D;  3MGR A;  3LEL A;  3W98 B;  3MGQ A;  1P3F C;  5E5A B;  5CP6 B;  3KUY A;  3AZM B;  1N1J B;  1BH9 A;  4J8V D;  3V9R B;  4CAY B;  1P3A B;  3B0D C;  3AZL C;  2Y2Q A;  3AV2 D;  3LZ1 C;  5AV8 C;  4R8P A;  3F6T A;  3A6N C;  1S32 B;  5CPI C;  3VH6 T;  4HGA C;  5AVB B;  2PYO D;  3NQJ B;  3REK A;  3AZF B;  1ULY A;  3AZL A;  5B32 G;  1ID3 D;  1H3O A;  2ARO A;  3LZ1 A;  3AL0 C;  2F8N A;  3A6N A;  3MGP C;  1U35 D;  2ZY5 A;  3WA9 C;  1KX5 B;  3MGS C;  3R45 A;  4ZUX C;  1R4V A;  4XUJ D;  3AFA B;  4E45 A;  4ZBJ B;  5GXQ C;  3MGR D;  1BH8 A;  3AYW C;  3WA9 A;  3B6G A;  2YFW B;  4J8U B;  1M19 C;  5DNM B;  1P3K A;  4G92 B;  5DNN C;  3MGS A;  3W99 B;  4ZUX A;  5B31 G;  5GXQ A;  5AV5 C;  5B0Z C;  1P3F D;  1M19 A;  1ZLA B;  2Y2M A;  2ZY3 A;  3AZI C;  3UTB A;  3X1V C;  3MVD A;  1P3G B;  3AZL D;  5B0Y C;  1EQZ A;  2FJ7 A;  3LZ1 D;  5AV8 D;  4J8W B;  5AV9 B;  5B0Z A;  3REL A;  3A6N D;  5B1M C;  5BNV A;  2LY8 A;  5CPI D;  5B40 C;  1P3L A;  3X1V A;  1P3O C;  2Y2H A;  1P3I C;  3WKJ C;  3W98 A;  4AWL B;  4H9N A;  5GT0 B;  3AZK C;  1M1A C;  2DF4 C;  4JJN C;  5CP6 A;  1N1J A;  3MGP D;  3AZG B;  3AV1 B;  4G91 B;  2NZD C;  5B40 A;  3H0L C;  3WA9 D;  1P3O A;  3B6G D;  1WWI A;  3KFU G;  3REJ B;  5B33 B;  3MGS D;  4QLC C;  4ZUX D;  5GXQ D;  3AYW D;  2HUE B;  3NQJ A;  4Z5T B;  3X1U B;  1M19 D;  1M18 C;  3AZE C;  1P3M C;  1AOI A;  5DNN D;  4QLC A;  4X23 A;  4Z66 C;  5AV5 D;  5C3I B;  5B0Z D;  5AV6 C;  3AZI D;  3AFA A;  4H9O B;  3X1V D;  3O62 C;  3X1S B;  3A1I A;  3REH B;  4WU9 B;  1KX3 A;  4J8U A;  5FUG A;  5B0Y D;  3W96 B;  5BS7 C;  5B1M D;  3LZ0 C;  4H9R B;  5B40 D;  2Y2J A;  1P3O D;  3UTA B;  1P3I D;  3WKJ D;  3AZK D;  1M1A D;  3AZJ C;  4JJN D;  4EO5 C;  4WJ3 C;  5BS7 A;  3W97 C;  1P3P B;  5GSU B;  2NZD D;  5AY8 C;  3WTP B;  4J8W A;  3AZJ A;  3H0R C;  4UPK A;  4QLC D;  4X23 D;  3W97 A;  1PZR A;  4KHA B;  5AY8 A;  1M18 D;  2RVQ C;  5B2I B;  4CSR B;  3AZE D;  3B0B A;  1P34 C;  1P3M D;  1ID3 C;  1TAF A;  3X1T C;  5B1L B;  3KXB C;  2Y2G A;  4Z66 D;  4E44 A;  3AN2 B;  5B32 B;  3O62 D;  3X1T A;  4LD9 B;  4HGA B;  3KXB A;  2Y2K A;  3LEL C;  4KUD C;  2Y2N A;  3MGQ C;  1TZY C;  1HQ3 C;  4WNN B;  3KUY C;  3EG5 B;  2XD1 A;  4KUD A;  3AZJ D;  2J8P A;  1TZY A;  2BYM A;  4R8P C;  1HQ3 A;  1T3U A;  3W97 D;  5CPJ C;  3X1S A;  3REH A;  2IO5 C;  5AY8 D;  5B31 B;  3REK C;  2F8N H;  2ARO C;  2ZY4 A;  5DNN B;  5CPJ A;  2CV5 C;  4YM6 B;  5JA4 B;  2RVQ D;  3LJA B;  5AV5 B;  2UWX A;  3WAA A;  1P34 D;  2NQB B;  3X1T D;  1P3P A;  3KXB D;  2CV5 A;  5G49 A;  3B6G C;  2BYK B;  1W2E A;  1P3K C;  4YS3 B;  5B24 B;  4J8X B;  5F99 B;  5B1M B;  5CPK B;  4H9Q B;  1P3B B;  3KWQ B;  3LEL D;  4KUD D;  3WKJ B;  3TU4 C;  3MGQ D;  1TZY D;  5B2I A;  4KGC C;  1HQ3 D;  3KUY D;  5B1L A;  3UTB C;  3B6F B;  3MVD C;  4H9P B;  3AN2 A;  3C1C B;  4M6B A;  5GT3 C;  1EQZ C;  2FJ7 C;  3TU4 A;  4R8P D;  3REL C;  1Z2C B;  5B32 A;  4KGC A;  3AZN C;  1HTA A;  1KX4 B;  5CPJ D;  4LD9 A;  1P3L C;  5AVC B;  4WU8 B;  3MNN B;  3W98 C;  3REK D;  5GT3 A;  5E5A C;  2ARO D;  5CP6 C;  1M18 B;  3EPL A;  2F8N D;  3AZN A;  2XD5 A;  3NQU B;  2CV5 D;  1P3A C;  5BNX B;  4XZQ B;  3C1B B;  3UT9 B;  5E5A A;  5AV6 B;  3AZH B;  3AZM A;  1S32 C;  2FFF B;  3V9R A;  5AVB C;  2HIO B;  3VH6 W;  5B2J B;  4CAY A;  2ZY2 A;  1P3A A;  1BFM A;  5B31 A;  3AZF C;  4WZS B;  3REI B;  1P3K D;  1AOI C;  1S32 A;  1F66 B;  4YM6 A;  4X23 C;  5JA4 A;  3LZ0 B;  5AVB A;  4NFT A;  3LJA A;  3TU4 D;  3AZF A;  3VH5 T;  4KGC D;  5JRG B;  3AFA C;  3UTB D;  4ZBJ C;  1WWS A;  3MVD D;  2G5I C;  4NE5 A;  1KX3 C;  4J8V B;  4J8U C;  5GT3 D;  5DNM C;  1KX5 A;  1EQZ D;  2FJ7 D;  3REL D;  4G92 C;  4YS3 A;  3AZN D;  4J8X A;  3AV2 B;  4UUZ B;  1P3L D;  1P3B A;  3B0C T;  3KWQ A;  3W98 D;  2YFW A;  1ZLA C;  2PYO B;  2RIQ A;  5E5A D;  5DNM A;  2Y2I A;  5CP6 D;  2YFV B;  2Y2L A;  1ID3 B;  3B6F A;  3W99 A;  1P3G C;  1P3A D;  3C1C A;  3KSY A;  1U35 B;  4J8W C;  5AV9 C;  1ZLA A;  1S32 D;  4NE3 A;  5AVB D;  5AVC A;  3MNN A;  1P3G A;  4AWL C;  4XUJ B;  3AZF D;  3EPK A;  2G5H C;  5BO0 B;  3MGR B;  5AV9 A;  1AOI D;  3AZG C;  3NQU A;  3AV1 C;  4G91 C;  1BH9 B;  5BNX A;  2JCH A;  1KX5 D;  5GT0 A;  3UT9 A;  3REJ C;  5B33 C;  3AFA D;  2W8S A;  3AZG A;  1P3F B;  3AV1 A;  2HUE C;  1KX3 D;  4Z5T C;  4J8U D;  5DNM D;  1KU5 A;  3B0D B;  3REJ A;  5B33 A;  3AZL B;  1F66 A;  3LZ1 B;  5AV8 B;  3A6N B;  5BT1 C;  5CPI B;  3X1U A;  3P5J B;  4Z5T A;  1B67 A;  1ZLA D;  4Z2M H;  2ZM5 A;  3X1S C;  4WU9 C;  3R45 B;  3REH C;  1P3G D;  4J8V A;  3MGP B;  3W96 C;  1BH8 B;  4J8W D;  5AV9 D;  3WA9 B;  3B6G B;  4UUZ A;  4H9O A;  3MGS B;  3UTA C;  4WU9 A;  3VH6 A;  4ZUX B;  2Y2O A;  5GXQ B;  3W96 A;  3AYW B;  3WAA C;  3AZG D;  1M19 B;  2Y2P A;  3AV1 D;  5GSU C;  1P3P C;  4H9R A;  1F1E A;  3UTA A;  3WTP C;  3REJ D;  5B33 D;  2FJ7 B;  5B0Z B;  2F8N G;  4H9S A;  5BNV B;  5GSU A;  4DQY B;  3AZI B;  4XUJ A;  4Z5T D;  1P3L B;  3X1V B;  3WTP A;  5B2I C;  4H9N B;  5B0Y B;  3EPH A;  5B1L C;  2JE5 A;  5BT1 D;  4KHA A;  3AN2 C;  5B40 B;  1P3O B;  1P3I B;  2DQN C;  4CSR A;  5B32 C;  3AZK B;  1P3F A;  1M1A B;  4JJN B;  3X1S D;  4WU9 D;  3REH D;  4LD9 C;  3W96 D;  2NZD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...