3AZMB

Crystal structure of human nucleosome core particle containing h4k79q mutation
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
77
structure length
77
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRQTVTAMDVVYALKRQGRTLYGFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 25
structure length 77
sequence length 77
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3azmB00
3AV2C 3MGSA 4Z5TA 4G91C 3X1TB 3X1VA 1M1AC 1ID3D 2NZDB 3AZND 1R4VA 2CV5C 3AZLA 1KX3C 1P3LA 3AV1B 1TAFA 3C1BC 1EQZB 3X1VC 3MGPD 4H9OA 3AZMD 1P3KD 3NQJB 3MNND 4KGCA 3AZEA 3AZIB 5E5AB 4J8VA 1P3LC 4E44A 2HUEC 3A6NC 5B2ID 4KUDB 3B0BA 1P3IC 3REHD 4X23D 2AROB 4KGCC 3AZEC 1P3BB 5AVBC 2LY8A 5GT3B 4J8VC 1P3AA 4Z66B 3O62B 4QLCC 1F66D 4CAYB 4LD9A 3W99D 4YS3C 4XUJA 5CP6C 5JA4A 4J8XD 1M19B 4JJND 1P3AC 4WU8B 5B0ZD 4LD9C 5DNMC 1HTAA 5B31C 4NE6A 3MGSB 3X1SB 5B40D 4J8UC 5B32D 2FJ7C 3UT9B 1TZYA 3R45B 5CHLB 3V9RB 5GSUA 3MNNA 3WTPE 5C3IB 3KSYA 3AYWD 4YM6B 3AN2B 3W98D 1TZYC 1P3OB 1P34D 5GSUC 5B2JA 4WU9D 3B6FB 3REHA 4X23A 2YFWB 3KWQA 3WAAB 4H9QA 5AV5A 4R8PD 5JRGA 3UTAD 1A7WA 5B33D 5B1LA 5GT0A 5CPID 5CPJD 3REJD 3RELA 3W97C 3WA9B 5B2JC 3MGQC 2F8NH 3B0CT 3KWQC 4XZQA 5AV9C 4H9NA 5AV5C 3AZHB 5F99B 4NFTA 5JRGC 3LELC 1P3MA 5GT0C 5AV8B 4G92B 1U35D 4KHAA 5AY8A 4CSRB 3AZGD 4XZQC 1ID3B 3AZNB 3W96C 4J8WC 3X1TA 2NQBD 2PYOC 4ZBJB 4UUZB 5AY8C 1KX5D 3MGPB 3AZMB 1P3KB 5AV6D 3MNNB 1S32D 2HIOD 3AV1A 1EQZA 3MVDC 3NQJA 3AZFD 5B2IB 2NZDC 3MGRD 1H3OB 5CPJA 1Q9CA 3REHB 4X23B 1ZLAD 3AV1C 4KUDA 1HQ3D 3REKD 1EQZC 3TU4D 1F66B 1KX4D 3KXBC 2CV5D 3W99B 2AROA 5DNND 1KX3D 1P3BA 5GT3A 3AZIC 5E5AC 4Z66A 4J8XB 4KUDC 4CAYA 4JJNB 4M6BA 2AROC 1M19A 1P3BC 5GT3C 1BH9B 4NE5A 5B32B 4WU8A 4Z66C 3O62C 3A6ND 3AFAC 1P3ID 1KX5A 1P3GC 3X1SA 1S32A 1AOID 3UT9A 3AYWB 1M19C 5AVBD 3R45A 3V9RA 4QLCD 1P3PD 3LZ1A 3W98B 5GXQD 3MGSC 4WU9B 4YM6A 3X1SC 3LJAD 4Z5TC 4DRBA 5CP6D 3AN2A 5BO0B 4R8PB 5BT1C 1HQ3A 4Z2MG 1P3OA 3UTAB 3B6FA 5B33B 5B24D 5C3IC 5CPIB 3AZLC 3REJB 2YFWA 5CPJB 3WAAA 5B31D 4YM6C 4J8UD 3AN2C 2FJ7D 1P3OC 3WA9A 1M18D 1U35B 3AZHA 5B0YD 5F99A 3AZGB 5AV8A 5G49B 2F8ND 3WA9C 4CSRA 2NQBB 1P3FD 3AZHC 5F99C 1ID3A 1KX5B 3AZNA 4ZUXD 3KUYD 3W97D 5AV8C 5AV6B 4XUJC 1S32B 4AWLB 3MGQD 3B0DC 4UUZA 3MGPA 3VH6A 3AZMA 1P3KA 4WV4B 1ID3C 3AZJD 3LZ1B 3AZNC 5B24A 3MGRB 2IO5B 3AZKD 1ZLAB 2F8NK 5B2IA 5FUGB 5KDMA 1HQ3B 2YFVB 3REKB 3MGPC 3TU4B 1H3OA 3AZMC 1P3KC 3MNNC 1KX4B 3VH6T 2CV5B 5DNNB 5B1MD 3B0CW 4J8WD 3W96D 2PYOD 5AVCD 1F66A 2RVQC 5BNXA 1F1EA 3W99A 3REHC 4X23C 4J8XA 4HGAB 3WTPD 3MVDD 3WKJD 4JJNA 3A6NB 2NZDD 5B0ZA 5B1LC 1P3IB 3RELC 3W99C 4E45A 5B40A 3C1CD 1AOIB 3REID 1BH9A 5B32A 4J8XC 5AVBB 5BS7A 5CPKD 3B6GD 4JJNC 4QLCB 1P3PB 4NE3A 5GXQB 1P3MC 3KXBD 3AYWA 3LJAB 3LZ0D 5B32C 3W98A 3X1UD 5BS7C 1P34A 4WU9A 5B24B 2BYMB 3X1TC 5B31B 5BO0A 4R8PA 3AYWC 3UTBD 4J8UB 4Z2MH 5AVCA 3UTAA 4H9PA 5KDMB 2FJ7B 5B33A 5CPIA 3AFAD 3REJA 3AV2D 1P3GD 1M18B 4H9SA 1M1AD 5B0YB 4R8PC 5BNXB 3UTAC 5B33C 5CPIC 5CPJC 1U35A 2F8NB 4H9SC 4Z5TD 3C1BD 3AZGA 3X1VD 1P3FB 3VH5A 5BT1D 1B6WA 5B0ZB 5G49A 4ZUXB 3NQUA 3KUYB 3AZLD 4EO5B 5B40B 2NQBA 1P3LD 3MGQB 2CWEA 3LZ0A 4WZSB 3AZGC 1KU5A 5AV6A 3AZJB 2HIOA 3VH5T 4KGCD 3AZED 3AZKB 4J8VD 3AZFA 4WU8C 1KX5C 5BNVA 3MGRA 1P34B 5AV6C 4YS3D 4WNNB 1JFIB 1S32C 4AWLC 1ZLAA 5FUGA 5B1MB 4J8WB 3UT9C 3W96B 2YFVA 3REKA 3TU4A 2PYOB 5AVCB 1P3AD 4H9PB 5B32G 3LZ1C 1KX4A 4LD9D 2CV5A 5DNMD 5DNNA 1KX3A 4XUJD 2IO5C 4H9RA 1ZLAC 3C1BA 3WTPB 1HQ3C 3MVDB 3REKC 3TU4C 3WKJB 4DRAA 3B6FC 1KX4C 3WAAC 5DNNC 1ULYA 3C1CB 1WWSA 3REIB 3A6NA 1TZYD 1P3IA 5CPKB 3B6GB 5GSUD 1AOIA 3NQUB 3KXBB 4HGAC 5AVBA 3LZ0B 4QLCA 1P3PA 2RVQD 3X1UB 5GXQA 4G92C 1BH8A 5B2JD 2HIOB 4YS3A 3LJAA 1AOIC 5CP6A 3KWQD 5AV9D 5AV5D 3UTBB 3AZFB 5JRGD 3LELD 2BYKB 5BNVB 1P3PC 5B1LD 5GT0D 3AFAB 5GXQC 2BYMA 3RELD 3VH6W 5DNMA 3AV2B 5B31A 1P3GB 4J8UA 3LJAC 4ZBJC 4G91B 1M1AB 2FJ7A 4XZQD 2JSSA 1BFMA 1M18A 5B24C 1P3MD 1KX3B 4H9RB 5B0YA 3C1BB 1B67A 4Z5TB 5AY8D 5B2IC 2L5AA 3X1VB 2F8NA 1M18C 3AZLB 3X1TD 1P3FA 1P3LB 5B0YC 1F66C 2HUEB 1TAFB 4H9OB 4ZUXA 3KUYA 3W97A 3MGQA 3AV1D 4KGCB 3AZEB 5AV9A 1EQZD 1N1JA 1P3FC 4J8VB 3AZJA 5B0ZC 3LELA 1BH8B 4ZUXC 3KUYC 4YS3B 4EO5C 5B40C 3AZID 3AZKA 5E5AD 5CP6B 4KUDD 1P3AB 1JFIA 4WNNA 3AZJC 4LD9B 5DNMB 2AROD 3W96A 5B1MA 4J8WA 4XUJB 1P3BD 3AZKC 5GT3D 2PYOA 5JA4B 4Z66D 3O62D 3B0DB 3W98C 1P34C 4WU9C 5B1MC 1M19D 3WTPA 3MVDA 3WKJA 5AVCC 4WU8D 2NZDA 1TZYB 3REJC 5GSUB 3MGSD 3X1SD 3C1CA 3REIA 1WWIA 5B31G 3UT9D 3WTPC 5CPKA 3WKJC 3B6GA 3LZ1D 3W97B 3KXBA 3VH5W 1U35C 5B2JB 4YM6D 3C1CC 3AZIA 5E5AA 3REIC 3KWQB 3AN2D 4H9QB 5AV9B 1N1JB 5AV5B 3X1UA 5CPKC 5JRGB 1P3OD 3B6GC 3LELB 3B6FD 5B1LB 5GT0B 3RELB 3WAAD 2NQBC 3UTBA 2F8NG 3LZ0C 3O62A 2BYKA 4XZQB 4H9NB 3X1UC 3AFAA 3AV2A 1P3GA 3WA9D 2HIOC 1P3MB 1M1AA 4KHAB 3AZHD 5F99D 3UTBC 3AZFC 5AY8B 3MGRC 5AV8D
chains in the Genus database with same CATH superfamily
3AV2C 3MGSA 4Z5TA 4G91C 3X1TB 3X1VA 1M1AC 1ID3D 2NZDB 3AZND 1R4VA 2CV5C 3AZLA 1KX3C 1P3LA 3AV1B 1TAFA 3C1BC 1EQZB 3X1VC 3MGPD 4H9OA 3AZMD 1P3KD 3NQJB 3MNND 2DQNC 2ZM5A 4KGCA 2FFFB 3AZEA 3AZIB 1PZRA 5E5AB 4J8VA 1P3LC 4E44A 2HUEC 3A6NC 5B2ID 4KUDB 3B0BA 1P3IC 3REHD 4X23D 2AROB 4KGCC 3AZEC 1P3BB 5AVBC 2LY8A 5GT3B 4J8VC 1P3AA 4Z66B 3O62B 4QLCC 1F66D 4CAYB 4LD9A 3W99D 3FDDA 4YS3C 4XUJA 5CP6C 5JA4A 4J8XD 1M19B 4JJND 1P3AC 4WU8B 5B0ZD 4LD9C 3IP4C 5DNMC 1HTAA 5B31C 4NE6A 3H0MC 3MGSB 3X1SB 5B40D 4J8UC 5B32D 2FJ7C 3UT9B 1TZYA 3R45B 5CHLB 3V9RB 5GSUA 3MNNA 3WTPE 5C3IB 3KSYA 3AYWD 4YM6B 3AN2B 3W98D 1TZYC 1P3OB 2J8PA 1P34D 5GSUC 5B2JA 4WU9D 3B6FB 3REHA 4X23A 2YFWB 3KWQA 3WAAB 4H9QA 5AV5A 4R8PD 5JRGA 3UTAD 1A7WA 5B33D 5B1LA 5GT0A 5CPID 5CPJD 3REJD 3RELA 3W97C 3WA9B 5B2JC 3MGQC 2F8NH 3B0CT 3KWQC 2Y2KA 4XZQA 5AV9C 4H9NA 5AV5C 3AZHB 5F99B 4NFTA 5JRGC 3LELC 1P3MA 5GT0C 5AV8B 4G92B 1U35D 4KHAA 3H0RC 2Y2PA 5AY8A 3A1KA 4CSRB 3AZGD 4XZQC 1ID3B 3AZNB 3W96C 4J8WC 3X1TA 2NQBD 2PYOC 4ZBJB 4UUZB 5AY8C 1KX5D 3MGPB 3AZMB 1P3KB 5AV6D 3MNNB 1S32D 2HIOD 3AV1A 2Y2GA 1EQZA 3MVDC 3NQJA 3AZFD 5B2IB 2NZDC 3MGRD 1H3OB 2G5IC 5CPJA 1Q9CA 3REHB 4X23B 2Y2LA 1ZLAD 3AV1C 4KUDA 1HQ3D 3REKD 1EQZC 3TU4D 1F66B 1KX4D 3KXBC 2CV5D 3W99B 2AROA 5DNND 1KX3D 1P3BA 5GT3A 3AZIC 5E5AC 4Z66A 4J8XB 4KUDC 4CAYA 4JJNB 4M6BA 2AROC 1M19A 1P3BC 5GT3C 1BH9B 4NE5A 5B32B 4WU8A 4Z66C 3O62C 3A6ND 3AFAC 1P3ID 1KX5A 1P3GC 3X1SA 1S32A 1AOID 3UT9A 3AYWB 1M19C 5AVBD 3R45A 3V9RA 4QLCD 1P3PD 3LZ1A 3W98B 5GXQD 3MGSC 4WU9B 4YM6A 3X1SC 3LJAD 4Z5TC 4DRBA 5CP6D 3AN2A 5BO0B 4R8PB 5BT1C 1HQ3A 4Z2MG 1P3OA 3UTAB 3B6FA 2DF4C 5B33B 5C3IC 5B24D 3AZLC 3REJB 2YFWA 5CPIB 5CPJB 3WAAA 5B31D 4YM6C 4J8UD 2ZY5A 3AN2C 2FJ7D 1T3UA 1P3OC 3WA9A 1M18D 1U35B 3AZHA 5B0YD 5F99A 3AZGB 5AV8A 5G49B 2F8ND 3WA9C 4CSRA 2NQBB 1P3FD 3EG5B 3AZHC 5F99C 1ID3A 1KX5B 3AZNA 3P5JB 4ZUXD 3KUYD 3W97D 5AV8C 5AV6B 4XUJC 1S32B 4AWLB 3MGQD 3B0DC 4UUZA 1Z2CB 3AL0C 4WJ3C 3MGPA 3VH6A 3AZMA 1P3KA 4WV4B 1ID3C 3AZJD 3LZ1B 3AZNC 5B24A 3MGRB 2IO5B 2Y2OA 3AZKD 1ZLAB 2F8NK 3KFUG 5B2IA 5FUGB 5KDMA 1HQ3B 2YFVB 3REKB 3MGPC 3TU4B 1H3OA 3AZMC 1P3KC 3MNNC 2W8SA 1KX4B 2F2AC 3VH6T 2CV5B 5DNNB 5B1MD 3B0CW 4J8WD 3W96D 2PYOD 5AVCD 1F66A 2RVQC 5BNXA 1F1EA 3W99A 3REHC 4X23C 4J8XA 4HGAB 3WTPD 3MVDD 2G5HC 3WKJD 4JJNA 3A6NB 2NZDD 5B0ZA 5B1LC 1P3IB 3RELC 3W99C 4E45A 5B40A 3C1CD 1AOIB 3REID 1BH9A 5B32A 4J8XC 3EPLA 5AVBB 5BS7A 2Y2QA 5CPKD 3B6GD 2BG1A 4JJNC 4QLCB 1P3PB 4NE3A 5GXQB 1P3MC 3KXBD 3AYWA 3LJAB 3LZ0D 5B32C 3W98A 3X1UD 5BS7C 1P34A 4WU9A 5B24B 2BYMB 3X1TC 5B31B 5BO0A 4R8PA 3AYWC 3UTBD 4J8UB 4Z2MH 3H0LC 5AVCA 3UTAA 4H9PA 5KDMB 2FJ7B 5B33A 5CPIA 3AFAD 3REJA 3AV2D 1P3GD 3EPJA 1M18B 4H9SA 1M1AD 5B0YB 4R8PC 2Y2JA 5BNXB 3UTAC 4DQYB 5B33C 5CPIC 2XD5A 5CPJC 1U35A 2F8NB 4H9SC 4Z5TD 3C1BD 3AZGA 3X1VD 1P3FB 3VH5A 5BT1D 1B6WA 5B0ZB 5G49A 4ZUXB 3NQUA 3F6TA 3KUYB 3AZLD 4EO5B 5B40B 2NQBA 1P3LD 3MGQB 2CWEA 3LZ0A 4WZSB 3AZGC 1KU5A 5AV6A 3AZJB 2HIOA 3VH5T 4KGCD 3AZED 3AZKB 4J8VD 3AZFA 4WU8C 1KX5C 5BNVA 3MGRA 1P34B 5AV6C 4YS3D 4WNNB 1JFIB 1S32C 4AWLC 1ZLAA 5FUGA 5B1MB 4J8WB 3UT9C 3W96B 2YFVA 3REKA 3TU4A 2PYOB 5AVCB 1P3AD 4H9PB 5B32G 3LZ1C 1KX4A 4LD9D 2CV5A 5DNMD 5DNNA 4UPKA 4XUJD 2IO5C 1KX3A 4H9RA 1ZLAC 3C1BA 3WTPB 1HQ3C 3MVDB 3REKC 3TU4C 3WKJB 4DRAA 3B6FC 1KX4C 3WAAC 5DNNC 1ULYA 3C1CB 1WWSA 3REIB 3A6NA 1TZYD 1W2EA 1P3IA 5CPKB 3B6GB 5GSUD 1AOIA 3NQUB 3KXBB 2ZY3A 4HGAC 5AVBA 3LZ0B 4QLCA 1P3PA 2RVQD 3X1UB 5GXQA 4G92C 1BH8A 5B2JD 2HIOB 4YS3A 3LJAA 1AOIC 5CP6A 3KWQD 2XD1A 5AV9D 5AV5D 3UTBB 3AZFB 5JRGD 3LELD 2BYKB 5BNVB 1P3PC 5B1LD 5GT0D 3AFAB 5GXQC 2BYMA 3RELD 3VH6W 5DNMA 3AV2B 5B31A 1P3GB 4J8UA 3LJAC 4ZBJC 4G91B 1M1AB 2FJ7A 4XZQD 2JSSA 1BFMA 3EPHA 2Y2NA 1M18A 5B24C 1P3MD 1KX3B 3EPKA 4H9RB 5B0YA 3C1BB 1B67A 4Z5TB 5AY8D 5B2IC 2L5AA 3X1VB 2ZY2A 2F8NA 2UWXA 1M18C 3AZLB 3X1TD 1P3FA 1P3LB 5B0YC 1F66C 2HUEB 1TAFB 4H9OB 4ZUXA 3KUYA 3W97A 3MGQA 3AV1D 4KGCB 3AZEB 5AV9A 1EQZD 1N1JA 1P3FC 4J8VB 2ZY4A 3AZJA 5B0ZC 3LELA 1BH8B 4ZUXC 3KUYC 4YS3B 4EO5C 5B40C 3AZID 3AZKA 5E5AD 5CP6B 2Y2HA 4KUDD 1P3AB 1JFIA 4WNNA 3AZJC 4LD9B 5DNMB 2AROD 3W96A 5B1MA 4J8WA 4XUJB 1P3BD 3AZKC 5GT3D 2PYOA 5JA4B 4Z66D 3O62D 3B0DB 3W98C 1P34C 4WU9C 2JE5A 5B1MC 1M19D 3WTPA 3MVDA 3WKJA 5AVCC 4WU8D 2NZDA 1TZYB 3REJC 5GSUB 3MGSD 3X1SD 3C1CA 2RIQA 3REIA 1WWIA 2VQRA 5B31G 3UT9D 3WTPC 5CPKA 3WKJC 3B6GA 2JCHA 3A1IA 3LZ1D 3W97B 3KXBA 3VH5W 1U35C 5B2JB 4YM6D 3C1CC 3AZIA 5E5AA 3REIC 3KWQB 3AN2D 4H9QB 5AV9B 1N1JB 2Y2MA 5AV5B 3X1UA 5CPKC 5JRGB 1P3OD 3B6GC 3LELB 3B6FD 5B1LB 5GT0B 3RELB 3WAAD 2NQBC 3UTBA 2F8NG 3LZ0C 3O62A 2BYKA 4XZQB 4H9NB 3X1UC 3AFAA 3AV2A 1P3GA 3WA9D 2HIOC 1P3MB 1M1AA 4KHAB 3AZHD 5F99D 3UTBC 3AZFC 2Y2IA 5AY8B 3MGRC 5AV8D
chains in the Genus database with same CATH topology
3AV2C 3MGSA 4Z5TA 4G91C 3X1TB 3X1VA 1M1AC 1ID3D 2NZDB 3AZND 1R4VA 2CV5C 3AZLA 1KX3C 1P3LA 3AV1B 1TAFA 3C1BC 1EQZB 3X1VC 3MGPD 4H9OA 3AZMD 1P3KD 3NQJB 3MNND 2DQNC 2ZM5A 4KGCA 2FFFB 3AZEA 3AZIB 1PZRA 5E5AB 4J8VA 1P3LC 4E44A 2HUEC 3A6NC 5B2ID 4KUDB 3B0BA 1P3IC 3REHD 4X23D 2AROB 4KGCC 3AZEC 1P3BB 5AVBC 2LY8A 5GT3B 4J8VC 1P3AA 4Z66B 3O62B 4QLCC 1F66D 4CAYB 4LD9A 3W99D 3FDDA 4YS3C 4XUJA 5CP6C 5JA4A 4J8XD 1M19B 4JJND 1P3AC 4WU8B 5B0ZD 4LD9C 3IP4C 5DNMC 1HTAA 5B31C 4NE6A 3H0MC 3MGSB 3X1SB 5B40D 4J8UC 5B32D 2FJ7C 3UT9B 1TZYA 3R45B 5CHLB 3V9RB 5GSUA 3MNNA 3WTPE 5C3IB 3KSYA 3AYWD 4YM6B 3AN2B 3W98D 1TZYC 1P3OB 2J8PA 1P34D 5GSUC 5B2JA 4WU9D 3B6FB 3REHA 4X23A 2YFWB 3KWQA 3WAAB 4H9QA 5AV5A 4R8PD 5JRGA 3UTAD 1A7WA 5B33D 5B1LA 5GT0A 5CPID 5CPJD 3REJD 3RELA 3W97C 3WA9B 5B2JC 3MGQC 2F8NH 3B0CT 3KWQC 2Y2KA 4XZQA 5AV9C 4H9NA 5AV5C 3AZHB 5F99B 4NFTA 5JRGC 3LELC 1P3MA 5GT0C 5AV8B 4G92B 1U35D 4KHAA 3H0RC 2Y2PA 5AY8A 3A1KA 4CSRB 3AZGD 4XZQC 1ID3B 3AZNB 3W96C 4J8WC 3X1TA 2NQBD 2PYOC 4ZBJB 4UUZB 5AY8C 1KX5D 3MGPB 3AZMB 1P3KB 5AV6D 3MNNB 1S32D 2HIOD 3AV1A 2Y2GA 1EQZA 3MVDC 3NQJA 3AZFD 5B2IB 2NZDC 3MGRD 1H3OB 2G5IC 5CPJA 1Q9CA 3REHB 4X23B 2Y2LA 1ZLAD 3AV1C 4KUDA 1HQ3D 3REKD 1EQZC 3TU4D 1F66B 1KX4D 3KXBC 2CV5D 3W99B 2AROA 5DNND 1KX3D 1P3BA 5GT3A 3AZIC 5E5AC 4Z66A 4J8XB 4KUDC 4CAYA 4JJNB 4M6BA 2AROC 1M19A 1P3BC 5GT3C 1BH9B 4NE5A 5B32B 4WU8A 4Z66C 3O62C 3A6ND 3AFAC 1P3ID 1KX5A 1P3GC 3X1SA 1S32A 1AOID 3UT9A 3AYWB 1M19C 5AVBD 3R45A 3V9RA 4QLCD 1P3PD 3LZ1A 3W98B 5GXQD 3MGSC 4WU9B 4YM6A 3X1SC 3LJAD 4Z5TC 4DRBA 5CP6D 3AN2A 5BO0B 4R8PB 5BT1C 1HQ3A 4Z2MG 1P3OA 3UTAB 3B6FA 2DF4C 5B33B 5C3IC 5B24D 3AZLC 3REJB 2YFWA 5CPIB 5CPJB 3WAAA 5B31D 4YM6C 4J8UD 2ZY5A 3AN2C 2FJ7D 1T3UA 1P3OC 3WA9A 1M18D 1U35B 3AZHA 5B0YD 5F99A 3AZGB 5AV8A 5G49B 2F8ND 3WA9C 4CSRA 2NQBB 1P3FD 3EG5B 3AZHC 5F99C 1ID3A 1KX5B 3AZNA 3P5JB 4ZUXD 3KUYD 3W97D 5AV8C 5AV6B 4XUJC 1S32B 4AWLB 3MGQD 3B0DC 4UUZA 1Z2CB 3AL0C 4WJ3C 3MGPA 3VH6A 3AZMA 1P3KA 4WV4B 1ID3C 3AZJD 3LZ1B 3AZNC 5B24A 3MGRB 2IO5B 2Y2OA 3AZKD 1ZLAB 2F8NK 3KFUG 5B2IA 5FUGB 5KDMA 1HQ3B 2YFVB 3REKB 3MGPC 3TU4B 1H3OA 3AZMC 1P3KC 3MNNC 2W8SA 1KX4B 2F2AC 3VH6T 2CV5B 5DNNB 5B1MD 3B0CW 4J8WD 3W96D 2PYOD 5AVCD 1F66A 2RVQC 5BNXA 1F1EA 3W99A 3REHC 4X23C 4J8XA 4HGAB 3WTPD 3MVDD 2G5HC 3WKJD 4JJNA 3A6NB 2NZDD 5B0ZA 5B1LC 1P3IB 3RELC 3W99C 4E45A 5B40A 3C1CD 1AOIB 3REID 1BH9A 5B32A 4J8XC 3EPLA 5AVBB 5BS7A 2Y2QA 5CPKD 3B6GD 2BG1A 4JJNC 4QLCB 1P3PB 4NE3A 5GXQB 1P3MC 3KXBD 3AYWA 3LJAB 3LZ0D 5B32C 3W98A 3X1UD 5BS7C 1P34A 4WU9A 5B24B 2BYMB 3X1TC 5B31B 5BO0A 4R8PA 3AYWC 3UTBD 4J8UB 4Z2MH 3H0LC 5AVCA 3UTAA 4H9PA 5KDMB 2FJ7B 5B33A 5CPIA 3AFAD 3REJA 3AV2D 1P3GD 3EPJA 1M18B 4H9SA 1M1AD 5B0YB 4R8PC 2Y2JA 5BNXB 3UTAC 4DQYB 5B33C 5CPIC 2XD5A 5CPJC 1U35A 2F8NB 4H9SC 4Z5TD 3C1BD 3AZGA 3X1VD 1P3FB 3VH5A 5BT1D 1B6WA 5B0ZB 5G49A 4ZUXB 3NQUA 3F6TA 3KUYB 3AZLD 4EO5B 5B40B 2NQBA 1P3LD 3MGQB 2CWEA 3LZ0A 4WZSB 3AZGC 1KU5A 5AV6A 3AZJB 2HIOA 3VH5T 4KGCD 3AZED 3AZKB 4J8VD 3AZFA 4WU8C 1KX5C 5BNVA 3MGRA 1P34B 5AV6C 4YS3D 4WNNB 1JFIB 1S32C 4AWLC 1ZLAA 5FUGA 5B1MB 4J8WB 3UT9C 3W96B 2YFVA 3REKA 3TU4A 2PYOB 5AVCB 1P3AD 4H9PB 5B32G 3LZ1C 1KX4A 4LD9D 2CV5A 5DNMD 5DNNA 4UPKA 4XUJD 2IO5C 1KX3A 4H9RA 1ZLAC 3C1BA 3WTPB 1HQ3C 3MVDB 3REKC 3TU4C 3WKJB 4DRAA 3B6FC 1KX4C 3WAAC 5DNNC 1ULYA 3C1CB 1WWSA 3REIB 3A6NA 1TZYD 1W2EA 1P3IA 5CPKB 3B6GB 5GSUD 1AOIA 3NQUB 3KXBB 2ZY3A 4HGAC 5AVBA 3LZ0B 4QLCA 1P3PA 2RVQD 3X1UB 5GXQA 4G92C 1BH8A 5B2JD 2HIOB 4YS3A 3LJAA 1AOIC 5CP6A 3KWQD 2XD1A 5AV9D 5AV5D 3UTBB 3AZFB 5JRGD 3LELD 2BYKB 5BNVB 1P3PC 5B1LD 5GT0D 3AFAB 5GXQC 2BYMA 3RELD 3VH6W 5DNMA 3AV2B 5B31A 1P3GB 4J8UA 3LJAC 4ZBJC 4G91B 1M1AB 2FJ7A 4XZQD 2JSSA 1BFMA 3EPHA 2Y2NA 1M18A 5B24C 1P3MD 1KX3B 3EPKA 4H9RB 5B0YA 3C1BB 1B67A 4Z5TB 5AY8D 5B2IC 2L5AA 3X1VB 2ZY2A 2F8NA 2UWXA 1M18C 3AZLB 3X1TD 1P3FA 1P3LB 5B0YC 1F66C 2HUEB 1TAFB 4H9OB 4ZUXA 3KUYA 3W97A 3MGQA 3AV1D 4KGCB 3AZEB 5AV9A 1EQZD 1N1JA 1P3FC 4J8VB 2ZY4A 3AZJA 5B0ZC 3LELA 1BH8B 4ZUXC 3KUYC 4YS3B 4EO5C 5B40C 3AZID 3AZKA 5E5AD 5CP6B 2Y2HA 4KUDD 1P3AB 1JFIA 4WNNA 3AZJC 4LD9B 5DNMB 2AROD 3W96A 5B1MA 4J8WA 4XUJB 1P3BD 3AZKC 5GT3D 2PYOA 5JA4B 4Z66D 3O62D 3B0DB 3W98C 1P34C 4WU9C 2JE5A 5B1MC 1M19D 3WTPA 3MVDA 3WKJA 5AVCC 4WU8D 2NZDA 1TZYB 3REJC 5GSUB 3MGSD 3X1SD 3C1CA 2RIQA 3REIA 1WWIA 2VQRA 5B31G 3UT9D 3WTPC 5CPKA 3WKJC 3B6GA 2JCHA 3A1IA 3LZ1D 3W97B 3KXBA 3VH5W 1U35C 5B2JB 4YM6D 3C1CC 3AZIA 5E5AA 3REIC 3KWQB 3AN2D 4H9QB 5AV9B 1N1JB 2Y2MA 5AV5B 3X1UA 5CPKC 5JRGB 1P3OD 3B6GC 3LELB 3B6FD 5B1LB 5GT0B 3RELB 3WAAD 2NQBC 3UTBA 2F8NG 3LZ0C 3O62A 2BYKA 4XZQB 4H9NB 3X1UC 3AFAA 3AV2A 1P3GA 3WA9D 2HIOC 1P3MB 1M1AA 4KHAB 3AZHD 5F99D 3UTBC 3AZFC 2Y2IA 5AY8B 3MGRC 5AV8D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AV2 C;  3MGS A;  4Z5T A;  4G91 C;  3X1T B;  3X1V A;  1M1A C;  1ID3 D;  2NZD B;  3AZN D;  1R4V A;  2CV5 C;  3AZL A;  1KX3 C;  1P3L A;  3AV1 B;  1TAF A;  3C1B C;  1EQZ B;  3X1V C;  3MGP D;  4H9O A;  3AZM D;  1P3K D;  3NQJ B;  3MNN D;  4KGC A;  3AZE A;  3AZI B;  5E5A B;  4J8V A;  1P3L C;  4E44 A;  2HUE C;  3A6N C;  5B2I D;  4KUD B;  3B0B A;  1P3I C;  3REH D;  4X23 D;  2ARO B;  4KGC C;  3AZE C;  1P3B B;  5AVB C;  2LY8 A;  5GT3 B;  4J8V C;  1P3A A;  4Z66 B;  3O62 B;  4QLC C;  1F66 D;  4CAY B;  4LD9 A;  3W99 D;  4YS3 C;  4XUJ A;  5CP6 C;  5JA4 A;  4J8X D;  1M19 B;  4JJN D;  1P3A C;  4WU8 B;  5B0Z D;  4LD9 C;  5DNM C;  1HTA A;  5B31 C;  4NE6 A;  3MGS B;  3X1S B;  5B40 D;  4J8U C;  5B32 D;  2FJ7 C;  3UT9 B;  1TZY A;  3R45 B;  5CHL B;  3V9R B;  5GSU A;  3MNN A;  3WTP E;  5C3I B;  3KSY A;  3AYW D;  4YM6 B;  3AN2 B;  3W98 D;  1TZY C;  1P3O B;  1P34 D;  5GSU C;  5B2J A;  4WU9 D;  3B6F B;  3REH A;  4X23 A;  2YFW B;  3KWQ A;  3WAA B;  4H9Q A;  5AV5 A;  4R8P D;  5JRG A;  3UTA D;  1A7W A;  5B33 D;  5B1L A;  5GT0 A;  5CPI D;  5CPJ D;  3REJ D;  3REL A;  3W97 C;  3WA9 B;  5B2J C;  3MGQ C;  2F8N H;  3B0C T;  3KWQ C;  4XZQ A;  5AV9 C;  4H9N A;  5AV5 C;  3AZH B;  5F99 B;  4NFT A;  5JRG C;  3LEL C;  1P3M A;  5GT0 C;  5AV8 B;  4G92 B;  1U35 D;  4KHA A;  5AY8 A;  4CSR B;  3AZG D;  4XZQ C;  1ID3 B;  3AZN B;  3W96 C;  4J8W C;  3X1T A;  2NQB D;  2PYO C;  4ZBJ B;  4UUZ B;  5AY8 C;  1KX5 D;  3MGP B;  3AZM B;  1P3K B;  5AV6 D;  3MNN B;  1S32 D;  2HIO D;  3AV1 A;  1EQZ A;  3MVD C;  3NQJ A;  3AZF D;  5B2I B;  2NZD C;  3MGR D;  1H3O B;  5CPJ A;  1Q9C A;  3REH B;  4X23 B;  1ZLA D;  3AV1 C;  4KUD A;  1HQ3 D;  3REK D;  1EQZ C;  3TU4 D;  1F66 B;  1KX4 D;  3KXB C;  2CV5 D;  3W99 B;  2ARO A;  5DNN D;  1KX3 D;  1P3B A;  5GT3 A;  3AZI C;  5E5A C;  4Z66 A;  4J8X B;  4KUD C;  4CAY A;  4JJN B;  4M6B A;  2ARO C;  1M19 A;  1P3B C;  5GT3 C;  1BH9 B;  4NE5 A;  5B32 B;  4WU8 A;  4Z66 C;  3O62 C;  3A6N D;  3AFA C;  1P3I D;  1KX5 A;  1P3G C;  3X1S A;  1S32 A;  1AOI D;  3UT9 A;  3AYW B;  1M19 C;  5AVB D;  3R45 A;  3V9R A;  4QLC D;  1P3P D;  3LZ1 A;  3W98 B;  5GXQ D;  3MGS C;  4WU9 B;  4YM6 A;  3X1S C;  3LJA D;  4Z5T C;  4DRB A;  5CP6 D;  3AN2 A;  5BO0 B;  4R8P B;  5BT1 C;  1HQ3 A;  4Z2M G;  1P3O A;  3UTA B;  3B6F A;  5B33 B;  5B24 D;  5C3I C;  5CPI B;  3AZL C;  3REJ B;  2YFW A;  5CPJ B;  3WAA A;  5B31 D;  4YM6 C;  4J8U D;  3AN2 C;  2FJ7 D;  1P3O C;  3WA9 A;  1M18 D;  1U35 B;  3AZH A;  5B0Y D;  5F99 A;  3AZG B;  5AV8 A;  5G49 B;  2F8N D;  3WA9 C;  4CSR A;  2NQB B;  1P3F D;  3AZH C;  5F99 C;  1ID3 A;  1KX5 B;  3AZN A;  4ZUX D;  3KUY D;  3W97 D;  5AV8 C;  5AV6 B;  4XUJ C;  1S32 B;  4AWL B;  3MGQ D;  3B0D C;  4UUZ A;  3MGP A;  3VH6 A;  3AZM A;  1P3K A;  4WV4 B;  1ID3 C;  3AZJ D;  3LZ1 B;  3AZN C;  5B24 A;  3MGR B;  2IO5 B;  3AZK D;  1ZLA B;  2F8N K;  5B2I A;  5FUG B;  5KDM A;  1HQ3 B;  2YFV B;  3REK B;  3MGP C;  3TU4 B;  1H3O A;  3AZM C;  1P3K C;  3MNN C;  1KX4 B;  3VH6 T;  2CV5 B;  5DNN B;  5B1M D;  3B0C W;  4J8W D;  3W96 D;  2PYO D;  5AVC D;  1F66 A;  2RVQ C;  5BNX A;  1F1E A;  3W99 A;  3REH C;  4X23 C;  4J8X A;  4HGA B;  3WTP D;  3MVD D;  3WKJ D;  4JJN A;  3A6N B;  2NZD D;  5B0Z A;  5B1L C;  1P3I B;  3REL C;  3W99 C;  4E45 A;  5B40 A;  3C1C D;  1AOI B;  3REI D;  1BH9 A;  5B32 A;  4J8X C;  5AVB B;  5BS7 A;  5CPK D;  3B6G D;  4JJN C;  4QLC B;  1P3P B;  4NE3 A;  5GXQ B;  1P3M C;  3KXB D;  3AYW A;  3LJA B;  3LZ0 D;  5B32 C;  3W98 A;  3X1U D;  5BS7 C;  1P34 A;  4WU9 A;  5B24 B;  2BYM B;  3X1T C;  5B31 B;  5BO0 A;  4R8P A;  3AYW C;  3UTB D;  4J8U B;  4Z2M H;  5AVC A;  3UTA A;  4H9P A;  5KDM B;  2FJ7 B;  5B33 A;  5CPI A;  3AFA D;  3REJ A;  3AV2 D;  1P3G D;  1M18 B;  4H9S A;  1M1A D;  5B0Y B;  4R8P C;  5BNX B;  3UTA C;  5B33 C;  5CPI C;  5CPJ C;  1U35 A;  2F8N B;  4H9S C;  4Z5T D;  3C1B D;  3AZG A;  3X1V D;  1P3F B;  3VH5 A;  5BT1 D;  1B6W A;  5B0Z B;  5G49 A;  4ZUX B;  3NQU A;  3KUY B;  3AZL D;  4EO5 B;  5B40 B;  2NQB A;  1P3L D;  3MGQ B;  2CWE A;  3LZ0 A;  4WZS B;  3AZG C;  1KU5 A;  5AV6 A;  3AZJ B;  2HIO A;  3VH5 T;  4KGC D;  3AZE D;  3AZK B;  4J8V D;  3AZF A;  4WU8 C;  1KX5 C;  5BNV A;  3MGR A;  1P34 B;  5AV6 C;  4YS3 D;  4WNN B;  1JFI B;  1S32 C;  4AWL C;  1ZLA A;  5FUG A;  5B1M B;  4J8W B;  3UT9 C;  3W96 B;  2YFV A;  3REK A;  3TU4 A;  2PYO B;  5AVC B;  1P3A D;  4H9P B;  5B32 G;  3LZ1 C;  1KX4 A;  4LD9 D;  2CV5 A;  5DNM D;  5DNN A;  1KX3 A;  4XUJ D;  2IO5 C;  4H9R A;  1ZLA C;  3C1B A;  3WTP B;  1HQ3 C;  3MVD B;  3REK C;  3TU4 C;  3WKJ B;  4DRA A;  3B6F C;  1KX4 C;  3WAA C;  5DNN C;  1ULY A;  3C1C B;  1WWS A;  3REI B;  3A6N A;  1TZY D;  1P3I A;  5CPK B;  3B6G B;  5GSU D;  1AOI A;  3NQU B;  3KXB B;  4HGA C;  5AVB A;  3LZ0 B;  4QLC A;  1P3P A;  2RVQ D;  3X1U B;  5GXQ A;  4G92 C;  1BH8 A;  5B2J D;  2HIO B;  4YS3 A;  3LJA A;  1AOI C;  5CP6 A;  3KWQ D;  5AV9 D;  5AV5 D;  3UTB B;  3AZF B;  5JRG D;  3LEL D;  2BYK B;  5BNV B;  1P3P C;  5B1L D;  5GT0 D;  3AFA B;  5GXQ C;  2BYM A;  3REL D;  3VH6 W;  5DNM A;  3AV2 B;  5B31 A;  1P3G B;  4J8U A;  3LJA C;  4ZBJ C;  4G91 B;  1M1A B;  2FJ7 A;  4XZQ D;  2JSS A;  1BFM A;  1M18 A;  5B24 C;  1P3M D;  1KX3 B;  4H9R B;  5B0Y A;  3C1B B;  1B67 A;  4Z5T B;  5AY8 D;  5B2I C;  2L5A A;  3X1V B;  2F8N A;  1M18 C;  3AZL B;  3X1T D;  1P3F A;  1P3L B;  5B0Y C;  1F66 C;  2HUE B;  1TAF B;  4H9O B;  4ZUX A;  3KUY A;  3W97 A;  3MGQ A;  3AV1 D;  4KGC B;  3AZE B;  5AV9 A;  1EQZ D;  1N1J A;  1P3F C;  4J8V B;  3AZJ A;  5B0Z C;  3LEL A;  1BH8 B;  4ZUX C;  3KUY C;  4YS3 B;  4EO5 C;  5B40 C;  3AZI D;  3AZK A;  5E5A D;  5CP6 B;  4KUD D;  1P3A B;  1JFI A;  4WNN A;  3AZJ C;  4LD9 B;  5DNM B;  2ARO D;  3W96 A;  5B1M A;  4J8W A;  4XUJ B;  1P3B D;  3AZK C;  5GT3 D;  2PYO A;  5JA4 B;  4Z66 D;  3O62 D;  3B0D B;  3W98 C;  1P34 C;  4WU9 C;  5B1M C;  1M19 D;  3WTP A;  3MVD A;  3WKJ A;  5AVC C;  4WU8 D;  2NZD A;  1TZY B;  3REJ C;  5GSU B;  3MGS D;  3X1S D;  3C1C A;  3REI A;  1WWI A;  5B31 G;  3UT9 D;  3WTP C;  5CPK A;  3WKJ C;  3B6G A;  3LZ1 D;  3W97 B;  3KXB A;  3VH5 W;  1U35 C;  5B2J B;  4YM6 D;  3C1C C;  3AZI A;  5E5A A;  3REI C;  3KWQ B;  3AN2 D;  4H9Q B;  5AV9 B;  1N1J B;  5AV5 B;  3X1U A;  5CPK C;  5JRG B;  1P3O D;  3B6G C;  3LEL B;  3B6F D;  5B1L B;  5GT0 B;  3REL B;  3WAA D;  2NQB C;  3UTB A;  2F8N G;  3LZ0 C;  3O62 A;  2BYK A;  4XZQ B;  4H9N B;  3X1U C;  3AFA A;  3AV2 A;  1P3G A;  3WA9 D;  2HIO C;  1P3M B;  1M1A A;  4KHA B;  3AZH D;  5F99 D;  3UTB C;  3AZF C;  5AY8 B;  3MGR C;  5AV8 D; 
#chains in the Genus database with same CATH topology
 3AV2 C;  3MGS A;  4Z5T A;  4G91 C;  3X1T B;  3X1V A;  1M1A C;  1ID3 D;  2NZD B;  3AZN D;  1R4V A;  2CV5 C;  3AZL A;  1KX3 C;  1P3L A;  3AV1 B;  1TAF A;  3C1B C;  1EQZ B;  3X1V C;  3MGP D;  4H9O A;  3AZM D;  1P3K D;  3NQJ B;  3MNN D;  2DQN C;  2ZM5 A;  4KGC A;  2FFF B;  3AZE A;  3AZI B;  1PZR A;  5E5A B;  4J8V A;  1P3L C;  4E44 A;  2HUE C;  3A6N C;  5B2I D;  4KUD B;  3B0B A;  1P3I C;  3REH D;  4X23 D;  2ARO B;  4KGC C;  3AZE C;  1P3B B;  5AVB C;  2LY8 A;  5GT3 B;  4J8V C;  1P3A A;  4Z66 B;  3O62 B;  4QLC C;  1F66 D;  4CAY B;  4LD9 A;  3W99 D;  3FDD A;  4YS3 C;  4XUJ A;  5CP6 C;  5JA4 A;  4J8X D;  1M19 B;  4JJN D;  1P3A C;  4WU8 B;  5B0Z D;  4LD9 C;  3IP4 C;  5DNM C;  1HTA A;  5B31 C;  4NE6 A;  3H0M C;  3MGS B;  3X1S B;  5B40 D;  4J8U C;  5B32 D;  2FJ7 C;  3UT9 B;  1TZY A;  3R45 B;  5CHL B;  3V9R B;  5GSU A;  3MNN A;  3WTP E;  5C3I B;  3KSY A;  3AYW D;  4YM6 B;  3AN2 B;  3W98 D;  1TZY C;  1P3O B;  2J8P A;  1P34 D;  5GSU C;  5B2J A;  4WU9 D;  3B6F B;  3REH A;  4X23 A;  2YFW B;  3KWQ A;  3WAA B;  4H9Q A;  5AV5 A;  4R8P D;  5JRG A;  3UTA D;  1A7W A;  5B33 D;  5B1L A;  5GT0 A;  5CPI D;  5CPJ D;  3REJ D;  3REL A;  3W97 C;  3WA9 B;  5B2J C;  3MGQ C;  2F8N H;  3B0C T;  3KWQ C;  2Y2K A;  4XZQ A;  5AV9 C;  4H9N A;  5AV5 C;  3AZH B;  5F99 B;  4NFT A;  5JRG C;  3LEL C;  1P3M A;  5GT0 C;  5AV8 B;  4G92 B;  1U35 D;  4KHA A;  3H0R C;  2Y2P A;  5AY8 A;  3A1K A;  4CSR B;  3AZG D;  4XZQ C;  1ID3 B;  3AZN B;  3W96 C;  4J8W C;  3X1T A;  2NQB D;  2PYO C;  4ZBJ B;  4UUZ B;  5AY8 C;  1KX5 D;  3MGP B;  3AZM B;  1P3K B;  5AV6 D;  3MNN B;  1S32 D;  2HIO D;  3AV1 A;  2Y2G A;  1EQZ A;  3MVD C;  3NQJ A;  3AZF D;  5B2I B;  2NZD C;  3MGR D;  1H3O B;  2G5I C;  5CPJ A;  1Q9C A;  3REH B;  4X23 B;  2Y2L A;  1ZLA D;  3AV1 C;  4KUD A;  1HQ3 D;  3REK D;  1EQZ C;  3TU4 D;  1F66 B;  1KX4 D;  3KXB C;  2CV5 D;  3W99 B;  2ARO A;  5DNN D;  1KX3 D;  1P3B A;  5GT3 A;  3AZI C;  5E5A C;  4Z66 A;  4J8X B;  4KUD C;  4CAY A;  4JJN B;  4M6B A;  2ARO C;  1M19 A;  1P3B C;  5GT3 C;  1BH9 B;  4NE5 A;  5B32 B;  4WU8 A;  4Z66 C;  3O62 C;  3A6N D;  3AFA C;  1P3I D;  1KX5 A;  1P3G C;  3X1S A;  1S32 A;  1AOI D;  3UT9 A;  3AYW B;  1M19 C;  5AVB D;  3R45 A;  3V9R A;  4QLC D;  1P3P D;  3LZ1 A;  3W98 B;  5GXQ D;  3MGS C;  4WU9 B;  4YM6 A;  3X1S C;  3LJA D;  4Z5T C;  4DRB A;  5CP6 D;  3AN2 A;  5BO0 B;  4R8P B;  5BT1 C;  1HQ3 A;  4Z2M G;  1P3O A;  3UTA B;  3B6F A;  2DF4 C;  5B33 B;  5C3I C;  5B24 D;  3AZL C;  3REJ B;  2YFW A;  5CPI B;  5CPJ B;  3WAA A;  5B31 D;  4YM6 C;  4J8U D;  2ZY5 A;  3AN2 C;  2FJ7 D;  1T3U A;  1P3O C;  3WA9 A;  1M18 D;  1U35 B;  3AZH A;  5B0Y D;  5F99 A;  3AZG B;  5AV8 A;  5G49 B;  2F8N D;  3WA9 C;  4CSR A;  2NQB B;  1P3F D;  3EG5 B;  3AZH C;  5F99 C;  1ID3 A;  1KX5 B;  3AZN A;  3P5J B;  4ZUX D;  3KUY D;  3W97 D;  5AV8 C;  5AV6 B;  4XUJ C;  1S32 B;  4AWL B;  3MGQ D;  3B0D C;  4UUZ A;  1Z2C B;  3AL0 C;  4WJ3 C;  3MGP A;  3VH6 A;  3AZM A;  1P3K A;  4WV4 B;  1ID3 C;  3AZJ D;  3LZ1 B;  3AZN C;  5B24 A;  3MGR B;  2IO5 B;  2Y2O A;  3AZK D;  1ZLA B;  2F8N K;  3KFU G;  5B2I A;  5FUG B;  5KDM A;  1HQ3 B;  2YFV B;  3REK B;  3MGP C;  3TU4 B;  1H3O A;  3AZM C;  1P3K C;  3MNN C;  2W8S A;  1KX4 B;  2F2A C;  3VH6 T;  2CV5 B;  5DNN B;  5B1M D;  3B0C W;  4J8W D;  3W96 D;  2PYO D;  5AVC D;  1F66 A;  2RVQ C;  5BNX A;  1F1E A;  3W99 A;  3REH C;  4X23 C;  4J8X A;  4HGA B;  3WTP D;  3MVD D;  2G5H C;  3WKJ D;  4JJN A;  3A6N B;  2NZD D;  5B0Z A;  5B1L C;  1P3I B;  3REL C;  3W99 C;  4E45 A;  5B40 A;  3C1C D;  1AOI B;  3REI D;  1BH9 A;  5B32 A;  4J8X C;  3EPL A;  5AVB B;  5BS7 A;  2Y2Q A;  5CPK D;  3B6G D;  2BG1 A;  4JJN C;  4QLC B;  1P3P B;  4NE3 A;  5GXQ B;  1P3M C;  3KXB D;  3AYW A;  3LJA B;  3LZ0 D;  5B32 C;  3W98 A;  3X1U D;  5BS7 C;  1P34 A;  4WU9 A;  5B24 B;  2BYM B;  3X1T C;  5B31 B;  5BO0 A;  4R8P A;  3AYW C;  3UTB D;  4J8U B;  4Z2M H;  3H0L C;  5AVC A;  3UTA A;  4H9P A;  5KDM B;  2FJ7 B;  5B33 A;  5CPI A;  3AFA D;  3REJ A;  3AV2 D;  1P3G D;  3EPJ A;  1M18 B;  4H9S A;  1M1A D;  5B0Y B;  4R8P C;  2Y2J A;  5BNX B;  3UTA C;  4DQY B;  5B33 C;  5CPI C;  2XD5 A;  5CPJ C;  1U35 A;  2F8N B;  4H9S C;  4Z5T D;  3C1B D;  3AZG A;  3X1V D;  1P3F B;  3VH5 A;  5BT1 D;  1B6W A;  5B0Z B;  5G49 A;  4ZUX B;  3NQU A;  3F6T A;  3KUY B;  3AZL D;  4EO5 B;  5B40 B;  2NQB A;  1P3L D;  3MGQ B;  2CWE A;  3LZ0 A;  4WZS B;  3AZG C;  1KU5 A;  5AV6 A;  3AZJ B;  2HIO A;  3VH5 T;  4KGC D;  3AZE D;  3AZK B;  4J8V D;  3AZF A;  4WU8 C;  1KX5 C;  5BNV A;  3MGR A;  1P34 B;  5AV6 C;  4YS3 D;  4WNN B;  1JFI B;  1S32 C;  4AWL C;  1ZLA A;  5FUG A;  5B1M B;  4J8W B;  3UT9 C;  3W96 B;  2YFV A;  3REK A;  3TU4 A;  2PYO B;  5AVC B;  1P3A D;  4H9P B;  5B32 G;  3LZ1 C;  1KX4 A;  4LD9 D;  2CV5 A;  5DNM D;  5DNN A;  4UPK A;  4XUJ D;  2IO5 C;  1KX3 A;  4H9R A;  1ZLA C;  3C1B A;  3WTP B;  1HQ3 C;  3MVD B;  3REK C;  3TU4 C;  3WKJ B;  4DRA A;  3B6F C;  1KX4 C;  3WAA C;  5DNN C;  1ULY A;  3C1C B;  1WWS A;  3REI B;  3A6N A;  1TZY D;  1W2E A;  1P3I A;  5CPK B;  3B6G B;  5GSU D;  1AOI A;  3NQU B;  3KXB B;  2ZY3 A;  4HGA C;  5AVB A;  3LZ0 B;  4QLC A;  1P3P A;  2RVQ D;  3X1U B;  5GXQ A;  4G92 C;  1BH8 A;  5B2J D;  2HIO B;  4YS3 A;  3LJA A;  1AOI C;  5CP6 A;  3KWQ D;  2XD1 A;  5AV9 D;  5AV5 D;  3UTB B;  3AZF B;  5JRG D;  3LEL D;  2BYK B;  5BNV B;  1P3P C;  5B1L D;  5GT0 D;  3AFA B;  5GXQ C;  2BYM A;  3REL D;  3VH6 W;  5DNM A;  3AV2 B;  5B31 A;  1P3G B;  4J8U A;  3LJA C;  4ZBJ C;  4G91 B;  1M1A B;  2FJ7 A;  4XZQ D;  2JSS A;  1BFM A;  3EPH A;  2Y2N A;  1M18 A;  5B24 C;  1P3M D;  1KX3 B;  3EPK A;  4H9R B;  5B0Y A;  3C1B B;  1B67 A;  4Z5T B;  5AY8 D;  5B2I C;  2L5A A;  3X1V B;  2ZY2 A;  2F8N A;  2UWX A;  1M18 C;  3AZL B;  3X1T D;  1P3F A;  1P3L B;  5B0Y C;  1F66 C;  2HUE B;  1TAF B;  4H9O B;  4ZUX A;  3KUY A;  3W97 A;  3MGQ A;  3AV1 D;  4KGC B;  3AZE B;  5AV9 A;  1EQZ D;  1N1J A;  1P3F C;  4J8V B;  2ZY4 A;  3AZJ A;  5B0Z C;  3LEL A;  1BH8 B;  4ZUX C;  3KUY C;  4YS3 B;  4EO5 C;  5B40 C;  3AZI D;  3AZK A;  5E5A D;  5CP6 B;  2Y2H A;  4KUD D;  1P3A B;  1JFI A;  4WNN A;  3AZJ C;  4LD9 B;  5DNM B;  2ARO D;  3W96 A;  5B1M A;  4J8W A;  4XUJ B;  1P3B D;  3AZK C;  5GT3 D;  2PYO A;  5JA4 B;  4Z66 D;  3O62 D;  3B0D B;  3W98 C;  1P34 C;  4WU9 C;  2JE5 A;  5B1M C;  1M19 D;  3WTP A;  3MVD A;  3WKJ A;  5AVC C;  4WU8 D;  2NZD A;  1TZY B;  3REJ C;  5GSU B;  3MGS D;  3X1S D;  3C1C A;  2RIQ A;  3REI A;  1WWI A;  2VQR A;  5B31 G;  3UT9 D;  3WTP C;  5CPK A;  3WKJ C;  3B6G A;  2JCH A;  3A1I A;  3LZ1 D;  3W97 B;  3KXB A;  3VH5 W;  1U35 C;  5B2J B;  4YM6 D;  3C1C C;  3AZI A;  5E5A A;  3REI C;  3KWQ B;  3AN2 D;  4H9Q B;  5AV9 B;  1N1J B;  2Y2M A;  5AV5 B;  3X1U A;  5CPK C;  5JRG B;  1P3O D;  3B6G C;  3LEL B;  3B6F D;  5B1L B;  5GT0 B;  3REL B;  3WAA D;  2NQB C;  3UTB A;  2F8N G;  3LZ0 C;  3O62 A;  2BYK A;  4XZQ B;  4H9N B;  3X1U C;  3AFA A;  3AV2 A;  1P3G A;  3WA9 D;  2HIO C;  1P3M B;  1M1A A;  4KHA B;  3AZH D;  5F99 D;  3UTB C;  3AZF C;  2Y2I A;  5AY8 B;  3MGR C;  5AV8 D; 
#chains in the Genus database with same CATH homology
 3AV2 C;  3MGS A;  4Z5T A;  4G91 C;  3X1T B;  3X1V A;  1M1A C;  1ID3 D;  2NZD B;  3AZN D;  1R4V A;  2CV5 C;  3AZL A;  1KX3 C;  1P3L A;  3AV1 B;  1TAF A;  3C1B C;  1EQZ B;  3X1V C;  3MGP D;  4H9O A;  3AZM D;  1P3K D;  3NQJ B;  3MNN D;  2DQN C;  2ZM5 A;  4KGC A;  2FFF B;  3AZE A;  3AZI B;  1PZR A;  5E5A B;  4J8V A;  1P3L C;  4E44 A;  2HUE C;  3A6N C;  5B2I D;  4KUD B;  3B0B A;  1P3I C;  3REH D;  4X23 D;  2ARO B;  4KGC C;  3AZE C;  1P3B B;  5AVB C;  2LY8 A;  5GT3 B;  4J8V C;  1P3A A;  4Z66 B;  3O62 B;  4QLC C;  1F66 D;  4CAY B;  4LD9 A;  3W99 D;  3FDD A;  4YS3 C;  4XUJ A;  5CP6 C;  5JA4 A;  4J8X D;  1M19 B;  4JJN D;  1P3A C;  4WU8 B;  5B0Z D;  4LD9 C;  3IP4 C;  5DNM C;  1HTA A;  5B31 C;  4NE6 A;  3H0M C;  3MGS B;  3X1S B;  5B40 D;  4J8U C;  5B32 D;  2FJ7 C;  3UT9 B;  1TZY A;  3R45 B;  5CHL B;  3V9R B;  5GSU A;  3MNN A;  3WTP E;  5C3I B;  3KSY A;  3AYW D;  4YM6 B;  3AN2 B;  3W98 D;  1TZY C;  1P3O B;  2J8P A;  1P34 D;  5GSU C;  5B2J A;  4WU9 D;  3B6F B;  3REH A;  4X23 A;  2YFW B;  3KWQ A;  3WAA B;  4H9Q A;  5AV5 A;  4R8P D;  5JRG A;  3UTA D;  1A7W A;  5B33 D;  5B1L A;  5GT0 A;  5CPI D;  5CPJ D;  3REJ D;  3REL A;  3W97 C;  3WA9 B;  5B2J C;  3MGQ C;  2F8N H;  3B0C T;  3KWQ C;  2Y2K A;  4XZQ A;  5AV9 C;  4H9N A;  5AV5 C;  3AZH B;  5F99 B;  4NFT A;  5JRG C;  3LEL C;  1P3M A;  5GT0 C;  5AV8 B;  4G92 B;  1U35 D;  4KHA A;  3H0R C;  2Y2P A;  5AY8 A;  3A1K A;  4CSR B;  3AZG D;  4XZQ C;  1ID3 B;  3AZN B;  3W96 C;  4J8W C;  3X1T A;  2NQB D;  2PYO C;  4ZBJ B;  4UUZ B;  5AY8 C;  1KX5 D;  3MGP B;  3AZM B;  1P3K B;  5AV6 D;  3MNN B;  1S32 D;  2HIO D;  3AV1 A;  2Y2G A;  1EQZ A;  3MVD C;  3NQJ A;  3AZF D;  5B2I B;  2NZD C;  3MGR D;  1H3O B;  2G5I C;  5CPJ A;  1Q9C A;  3REH B;  4X23 B;  2Y2L A;  1ZLA D;  3AV1 C;  4KUD A;  1HQ3 D;  3REK D;  1EQZ C;  3TU4 D;  1F66 B;  1KX4 D;  3KXB C;  2CV5 D;  3W99 B;  2ARO A;  5DNN D;  1KX3 D;  1P3B A;  5GT3 A;  3AZI C;  5E5A C;  4Z66 A;  4J8X B;  4KUD C;  4CAY A;  4JJN B;  4M6B A;  2ARO C;  1M19 A;  1P3B C;  5GT3 C;  1BH9 B;  4NE5 A;  5B32 B;  4WU8 A;  4Z66 C;  3O62 C;  3A6N D;  3AFA C;  1P3I D;  1KX5 A;  1P3G C;  3X1S A;  1S32 A;  1AOI D;  3UT9 A;  3AYW B;  1M19 C;  5AVB D;  3R45 A;  3V9R A;  4QLC D;  1P3P D;  3LZ1 A;  3W98 B;  5GXQ D;  3MGS C;  4WU9 B;  4YM6 A;  3X1S C;  3LJA D;  4Z5T C;  4DRB A;  5CP6 D;  3AN2 A;  5BO0 B;  4R8P B;  5BT1 C;  1HQ3 A;  4Z2M G;  1P3O A;  3UTA B;  3B6F A;  2DF4 C;  5B33 B;  5C3I C;  5B24 D;  3AZL C;  3REJ B;  2YFW A;  5CPI B;  5CPJ B;  3WAA A;  5B31 D;  4YM6 C;  4J8U D;  2ZY5 A;  3AN2 C;  2FJ7 D;  1T3U A;  1P3O C;  3WA9 A;  1M18 D;  1U35 B;  3AZH A;  5B0Y D;  5F99 A;  3AZG B;  5AV8 A;  5G49 B;  2F8N D;  3WA9 C;  4CSR A;  2NQB B;  1P3F D;  3EG5 B;  3AZH C;  5F99 C;  1ID3 A;  1KX5 B;  3AZN A;  3P5J B;  4ZUX D;  3KUY D;  3W97 D;  5AV8 C;  5AV6 B;  4XUJ C;  1S32 B;  4AWL B;  3MGQ D;  3B0D C;  4UUZ A;  1Z2C B;  3AL0 C;  4WJ3 C;  3MGP A;  3VH6 A;  3AZM A;  1P3K A;  4WV4 B;  1ID3 C;  3AZJ D;  3LZ1 B;  3AZN C;  5B24 A;  3MGR B;  2IO5 B;  2Y2O A;  3AZK D;  1ZLA B;  2F8N K;  3KFU G;  5B2I A;  5FUG B;  5KDM A;  1HQ3 B;  2YFV B;  3REK B;  3MGP C;  3TU4 B;  1H3O A;  3AZM C;  1P3K C;  3MNN C;  2W8S A;  1KX4 B;  2F2A C;  3VH6 T;  2CV5 B;  5DNN B;  5B1M D;  3B0C W;  4J8W D;  3W96 D;  2PYO D;  5AVC D;  1F66 A;  2RVQ C;  5BNX A;  1F1E A;  3W99 A;  3REH C;  4X23 C;  4J8X A;  4HGA B;  3WTP D;  3MVD D;  2G5H C;  3WKJ D;  4JJN A;  3A6N B;  2NZD D;  5B0Z A;  5B1L C;  1P3I B;  3REL C;  3W99 C;  4E45 A;  5B40 A;  3C1C D;  1AOI B;  3REI D;  1BH9 A;  5B32 A;  4J8X C;  3EPL A;  5AVB B;  5BS7 A;  2Y2Q A;  5CPK D;  3B6G D;  2BG1 A;  4JJN C;  4QLC B;  1P3P B;  4NE3 A;  5GXQ B;  1P3M C;  3KXB D;  3AYW A;  3LJA B;  3LZ0 D;  5B32 C;  3W98 A;  3X1U D;  5BS7 C;  1P34 A;  4WU9 A;  5B24 B;  2BYM B;  3X1T C;  5B31 B;  5BO0 A;  4R8P A;  3AYW C;  3UTB D;  4J8U B;  4Z2M H;  3H0L C;  5AVC A;  3UTA A;  4H9P A;  5KDM B;  2FJ7 B;  5B33 A;  5CPI A;  3AFA D;  3REJ A;  3AV2 D;  1P3G D;  3EPJ A;  1M18 B;  4H9S A;  1M1A D;  5B0Y B;  4R8P C;  2Y2J A;  5BNX B;  3UTA C;  4DQY B;  5B33 C;  5CPI C;  2XD5 A;  5CPJ C;  1U35 A;  2F8N B;  4H9S C;  4Z5T D;  3C1B D;  3AZG A;  3X1V D;  1P3F B;  3VH5 A;  5BT1 D;  1B6W A;  5B0Z B;  5G49 A;  4ZUX B;  3NQU A;  3F6T A;  3KUY B;  3AZL D;  4EO5 B;  5B40 B;  2NQB A;  1P3L D;  3MGQ B;  2CWE A;  3LZ0 A;  4WZS B;  3AZG C;  1KU5 A;  5AV6 A;  3AZJ B;  2HIO A;  3VH5 T;  4KGC D;  3AZE D;  3AZK B;  4J8V D;  3AZF A;  4WU8 C;  1KX5 C;  5BNV A;  3MGR A;  1P34 B;  5AV6 C;  4YS3 D;  4WNN B;  1JFI B;  1S32 C;  4AWL C;  1ZLA A;  5FUG A;  5B1M B;  4J8W B;  3UT9 C;  3W96 B;  2YFV A;  3REK A;  3TU4 A;  2PYO B;  5AVC B;  1P3A D;  4H9P B;  5B32 G;  3LZ1 C;  1KX4 A;  4LD9 D;  2CV5 A;  5DNM D;  5DNN A;  4UPK A;  4XUJ D;  2IO5 C;  1KX3 A;  4H9R A;  1ZLA C;  3C1B A;  3WTP B;  1HQ3 C;  3MVD B;  3REK C;  3TU4 C;  3WKJ B;  4DRA A;  3B6F C;  1KX4 C;  3WAA C;  5DNN C;  1ULY A;  3C1C B;  1WWS A;  3REI B;  3A6N A;  1TZY D;  1W2E A;  1P3I A;  5CPK B;  3B6G B;  5GSU D;  1AOI A;  3NQU B;  3KXB B;  2ZY3 A;  4HGA C;  5AVB A;  3LZ0 B;  4QLC A;  1P3P A;  2RVQ D;  3X1U B;  5GXQ A;  4G92 C;  1BH8 A;  5B2J D;  2HIO B;  4YS3 A;  3LJA A;  1AOI C;  5CP6 A;  3KWQ D;  2XD1 A;  5AV9 D;  5AV5 D;  3UTB B;  3AZF B;  5JRG D;  3LEL D;  2BYK B;  5BNV B;  1P3P C;  5B1L D;  5GT0 D;  3AFA B;  5GXQ C;  2BYM A;  3REL D;  3VH6 W;  5DNM A;  3AV2 B;  5B31 A;  1P3G B;  4J8U A;  3LJA C;  4ZBJ C;  4G91 B;  1M1A B;  2FJ7 A;  4XZQ D;  2JSS A;  1BFM A;  3EPH A;  2Y2N A;  1M18 A;  5B24 C;  1P3M D;  1KX3 B;  3EPK A;  4H9R B;  5B0Y A;  3C1B B;  1B67 A;  4Z5T B;  5AY8 D;  5B2I C;  2L5A A;  3X1V B;  2ZY2 A;  2F8N A;  2UWX A;  1M18 C;  3AZL B;  3X1T D;  1P3F A;  1P3L B;  5B0Y C;  1F66 C;  2HUE B;  1TAF B;  4H9O B;  4ZUX A;  3KUY A;  3W97 A;  3MGQ A;  3AV1 D;  4KGC B;  3AZE B;  5AV9 A;  1EQZ D;  1N1J A;  1P3F C;  4J8V B;  2ZY4 A;  3AZJ A;  5B0Z C;  3LEL A;  1BH8 B;  4ZUX C;  3KUY C;  4YS3 B;  4EO5 C;  5B40 C;  3AZI D;  3AZK A;  5E5A D;  5CP6 B;  2Y2H A;  4KUD D;  1P3A B;  1JFI A;  4WNN A;  3AZJ C;  4LD9 B;  5DNM B;  2ARO D;  3W96 A;  5B1M A;  4J8W A;  4XUJ B;  1P3B D;  3AZK C;  5GT3 D;  2PYO A;  5JA4 B;  4Z66 D;  3O62 D;  3B0D B;  3W98 C;  1P34 C;  4WU9 C;  2JE5 A;  5B1M C;  1M19 D;  3WTP A;  3MVD A;  3WKJ A;  5AVC C;  4WU8 D;  2NZD A;  1TZY B;  3REJ C;  5GSU B;  3MGS D;  3X1S D;  3C1C A;  2RIQ A;  3REI A;  1WWI A;  2VQR A;  5B31 G;  3UT9 D;  3WTP C;  5CPK A;  3WKJ C;  3B6G A;  2JCH A;  3A1I A;  3LZ1 D;  3W97 B;  3KXB A;  3VH5 W;  1U35 C;  5B2J B;  4YM6 D;  3C1C C;  3AZI A;  5E5A A;  3REI C;  3KWQ B;  3AN2 D;  4H9Q B;  5AV9 B;  1N1J B;  2Y2M A;  5AV5 B;  3X1U A;  5CPK C;  5JRG B;  1P3O D;  3B6G C;  3LEL B;  3B6F D;  5B1L B;  5GT0 B;  3REL B;  3WAA D;  2NQB C;  3UTB A;  2F8N G;  3LZ0 C;  3O62 A;  2BYK A;  4XZQ B;  4H9N B;  3X1U C;  3AFA A;  3AV2 A;  1P3G A;  3WA9 D;  2HIO C;  1P3M B;  1M1A A;  4KHA B;  3AZH D;  5F99 D;  3UTB C;  3AZF C;  2Y2I A;  5AY8 B;  3MGR C;  5AV8 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...