3AZMB

Crystal structure of human nucleosome core particle containing h4k79q mutation
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
77
structure length
77
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRQTVTAMDVVYALKRQGRTLYGFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 77
sequence length 77
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3azmB00
3NQUB 2F8NK 4JJNC 3W96C 4ZUXC 5B2IA 1S32B 4CAYA 3AYWD 3KUYD 3MGSA 1P3GC 3X1TC 3A6NA 2L5AA 5E5AB 4LD9A 2F8NH 4H9OB 3W96B 3AV1A 4ZUXB 1TZYD 4H9QB 1KX3A 3REID 1BH8B 1F1EA 4X23A 5GT3D 3AN2D 1P3GB 1M18A 2HIOB 3AZND 3MGRC 3WAAD 1HQ3B 5B33C 2F8NB 5GSUB 5AV8D 2BYKA 5AV6C 5B1MD 3MGQC 1P3BD 5B1LC 3KXBD 3B6FA 1P3AA 1ULYA 5AV5B 1P34B 4J8WA 3LZ0D 1WWIA 4YS3B 1P3KC 4H9SC 3X1UC 1BH9B 2AROA 5AV6B 4QLCD 4NE6A 4KUDD 5DNNC 5GXQD 3UTBC 5B32G 3REHB 5CPKD 1Q9CA 1WWSA 3LELB 2BYMB 4G92B 1AOID 1P3MC 3AFAD 2JSSA 3AZFD 5B31G 3X1UB 4H9PA 3AV2D 3NQUA 3W98A 4J8VC 3WKJB 5AV9C 5B0ZD 3B0DC 3UTBB 3WTPB 1S32A 1H3OB 3B0CT 3X1SC 4Z5TD 3KWQD 3TU4D 3MGPD 4H9NB 5B0YB 4M6BA 4JJND 5B2IC 2CV5B 1M1AA 4KGCC 3VH5T 5AVBD 3AZLA 4WU8D 3MGSC 3REKD 3VH5A 4XUJD 1BH8A 3X1TD 5AVCB 3X1SB 2LY8A 3MVDD 3UT9D 5BNVA 5B2JD 1KX3C 5F99A 3C1CD 2PYOA 5JRGA 4CAYB 3MGSB 2NQBD 3X1VC 5BS7A 1M18C 3A6NB 4Z2MH 3W97A 4NE5A 5CPJD 4LD9B 3O62B 4YM6D 3MGRD 1HTAA 4EO5C 4WU9D 3AV1B 1KX3B 3WA9A 5B31C 4X23B 2RVQC 1M18B 3RELC 3B6FC 5B1LD 5KDMA 4J8WC 1U35C 4KHAA 2F8NG 3REHA 4J8XC 1P3PA 1ID3A 2BYMA 1P3KD 3AYWB 2BYKB 1B6WA 5C3IB 1KX5A 2FJ7D 1P3LA 4ZBJB 3LZ1A 1P3AB 1M19A 3VH6T 3W99D 5DNND 4J8WB 1P3OD 3WTPA 3VH6A 5CP6D 1P3MD 4Z66A 2AROB 3W98C 2CWEA 5GT0A 5B0YA 1P3IA 4J8VD 3AZNB 3AZGA 2CV5A 5AV9D 1S32C 4NFTA 3AZJA 1F66D 5DNMD 4CSRA 5BNXA 3W98B 1M1AC 5JA4B 4UUZB 1P3FA 3AZED 1N1JA 4KGCD 1KX4B 5FUGA 5B24D 3LZ0B 3UTAA 4WNNA 4XZQA 1A7WA 2HIOC 3LJAA 3AZMA 3AZKA 1HQ3C 3O62A 1M1AB 3AZLB 5GSUC 3B6GA 5CHLB 5BS7C 5CPIA 3W97C 5B40A 3AFAB 3X1VD 5AV5C 5BNVB 1P34C 5B32D 1EQZD 5F99B 4YS3C 2PYOB 5B0ZB 5JRGB 3WTPE 3WA9C 3AZID 3AYWA 5B31D 3KUYA 3W97B 3RELD 4AWLB 3REHC 1U35D 1P3PC 1ID3C 3LELC 5AY8D 4G92C 4J8XD 3REKB 1TZYA 3WA9B 3REIA 4DRAA 5GT3A 3MNNB 3WKJC 5KDMB 3REJD 3AZNA 2NZDB 3WAAA 4Z2MG 3WTPC 4KHAB 3C1BD 4R8PD 1P3PB 1ID3B 4Z66C 1KX5B 2NQBB 1P3LB 5GT0C 4WV4B 5B0YC 5B1MA 1P3IC 1ZLAD 1P3BA 3LZ1B 2CV5C 1M19B 3KXBA 3V9RA 5JA4A 4UUZA 3AZHD 5G49A 1S32D 1KX4A 4J8UB 3LZ0A 3AZJC 3NQJA 5AVCC 4Z66B 5E5AD 5BO0B 5GT0B 1P3IB 4QLCA 4E45A 3AZGB 3W96D 4KUDA 4ZUXD 5GXQA 3UTAC 3AZMC 3A6NC 3AZJB 1AOIA 5BT1C 1P3GD 3AFAA 4LD9C 4CSRB 5BNXB 3O62C 2HIOD 3AZFA 3AV2A 1HQ3D 1P3FB 3AV1C 3B6GC 1N1JB 2F8ND 5FUGB 5GSUD 5B0ZA 4X23C 3UTAB 4WNNB 5CP6B 4XZQB 3AZMB 3LJAB 4Z5TA 3AZKB 3KWQA 3TU4A 5AV5D 3MGPA 1P34D 4JJNA 3B6GB 5AVBA 5B33D 4WU8A 1BFMA 4YS3D 3AYWC 2IO5B 5C3IC 3KUYC 3REKA 5CPIB 4XUJA 5B40B 5AV6D 3MGQD 4ZBJC 1F66B 1P3AC 3MNNA 5DNMB 3X1TA 3MVDA 3UT9A 2NZDA 5B2JA 3AZEB 3LELD 3REIC 3C1CA 5B24B 1R4VA 2AROC 3KUYB 3X1UD 2NQBA 4E44A 3AZNC 3WKJD 5CPJA 4YM6A 3MGRA 3UTBD 4J8UA 4WU9A 1TAFA 1TZYB 3REIB 5B1MC 1P3BC 4NE3A 5GT3B 5BO0A 3AN2B 1KX4C 3WAAB 3LZ0C 5AV8B 1P3KA 2FJ7A 4H9SA 5AVCD 3X1SD 5B1MB 4QLCC 1P3BB 4KUDC 3AZLC 5GXQC 3KXBB 3V9RB 5B2ID 1JFIA 5G49B 3W99A 5DNNA 1P3OA 3MGSD 4HGAB 3NQJB 3AFAC 3A6ND 5CP6A 1P3MA 4LD9D 2HUEC 4QLCB 5F99C 3REJB 2PYOC 4J8VA 5B0ZC 5JRGC 5GXQB 3AV1D 4KUDB 5AV9A 1KX3D 5CPKB 4WZSB 4X23D 1AOIB 1M18D 3KWQC 4AWLC 3TU4C 3MGPC 3AZFB 1F66A 5DNMA 3AV2B 2HUEB 5AVBC 4WU8C 3REKC 3AZEA 3AZHB 4KGCA 4XUJC 5B24A 3MNNC 2RVQD 4Z5TB 1B67A 3MVDC 3KWQB 3UT9C 3TU4B 1P3AD 3MGPB 3B6FD 2NZDC 3R45A 5B2JC 4JJNB 4J8WD 3C1CC 5AVBB 4WU8B 1KX5C 2NQBC 1P3LC 4XUJB 2AROD 5CPJC 4H9RA 3LZ1C 3X1VA 3X1TB 1M19C 3AN2A 4YM6C 3MVDB 3UT9B 1EQZA 5B32A 4J8UC 5B2JB 4WU9C 3C1CB 3AZIA 5AV8A 5B31A 3W98D 3AZGC 5CPJB 3RELA 4YM6B 3MGRB 1KX4D 2YFVB 1U35A 2YFWA 1TAFB 5B33B 5AY8A 4WU9B 2FJ7C 4J8XA 3MGQB 1P3FC 5B1LB 1M1AD 3W99C 3AZLD 3REJA 1P3OC 3C1BA 4R8PA 5CPKA 5CP6C 4XZQC 3LJAC 1P3KB 2FJ7B 3AZKC 1ZLAA 5F99D 1JFIB 2PYOD 5CPIC 2IO5C 5JRGD 5DNNB 3AZHA 3W99B 1P3OB 5B40C 4DRBA 1F66C 3W97D 5DNMC 1P3MB 3KSYA 5E5AA 3AZEC 4J8VB 4H9OA 3W96A 5AV9B 5B24C 3B0CW 4ZUXA 4H9QA 3B0DB 3WA9D 3MNND 1P3GA 2HIOA 2NZDD 3VH5W 1HQ3A 3REHD 5B2IB 1P3PD 1ID3D 1TZYC 2F8NA 4KGCB 1KX5D 5GSUA 1P3LD 5GT3C 3AN2C 3LZ1D 1M19D 3WAAC 1KU5A 5B32C 1EQZC 3R45B 5AV5A 1P34A 4J8UD 3WTPD 2YFVA 3AZIC 5B33A 5AV8C 4YS3A 4Z66D 1BH9A 4H9RB 5B0YD 5GT0D 5AV6A 3X1VB 3MGQA 1P3ID 3KXBC 3AZGD 5B1LA 2CV5D 1EQZB 5B32B 5AY8C 4HGAC 4EO5B 3LELA 3B0BA 3AZIB 3AZJD 5B31B 3X1UA 3REJC 3RELB 3B6FB 1P3FD 4G91C 3WKJA 3C1BC 4R8PC 5CPKC 1U35B 3UTBA 2YFWB 5AY8B 1H3OA 3UTAD 1AOIC 4J8XB 4XZQD 3AZMD 3LJAD 3AZFC 1ZLAC 5BT1D 3AZKD 3AV2C 3O62D 4H9NA 3VH6W 3AZHC 3B6GD 4G91B 5CPID 3C1BB 4R8PB 5B40D 4Z5TC 5E5AC 4H9PB 1ZLAB 5AVCA 3X1SA
chains in the Genus database with same CATH superfamily
3NQUB 2F8NK 4JJNC 3W96C 4ZUXC 2Y2GA 5B2IA 1S32B 4CAYA 3AYWD 3KUYD 3MGSA 1P3GC 3X1TC 3A6NA 2L5AA 5E5AB 4LD9A 2F8NH 2ZY4A 4H9OB 3W96B 3H0RC 3AV1A 4ZUXB 1TZYD 4H9QB 1KX3A 3REID 1BH8B 1F1EA 4X23A 5GT3D 3AN2D 1P3GB 1M18A 2HIOB 3AZND 3MGRC 3WAAD 2JCHA 1HQ3B 2ZY2A 5B33C 2F8NB 5GSUB 5AV8D 2BYKA 5AV6C 5B1MD 3MGQC 1P3BD 5B1LC 3KXBD 3B6FA 1P3AA 1ULYA 5AV5B 1P34B 4J8WA 3LZ0D 1WWIA 4YS3B 1P3KC 4H9SC 3X1UC 2Y2LA 1BH9B 2AROA 5AV6B 4QLCD 2FFFB 4NE6A 4KUDD 5DNNC 5GXQD 3UTBC 5B32G 3REHB 5CPKD 1Q9CA 1WWSA 3LELB 2BYMB 4G92B 1AOID 1P3MC 3AFAD 2JSSA 3AZFD 5B31G 3X1UB 4H9PA 3AV2D 3NQUA 3W98A 4J8VC 3WKJB 5AV9C 5B0ZD 3B0DC 3UTBB 3WTPB 2UWXA 1S32A 1H3OB 3B0CT 3X1SC 4Z5TD 3KWQD 3TU4D 3MGPD 4H9NB 5B0YB 2Y2MA 4M6BA 4JJND 5B2IC 2CV5B 1M1AA 4KGCC 3VH5T 5AVBD 3AZLA 4WU8D 3MGSC 3REKD 3VH5A 4XUJD 1BH8A 3X1TD 5AVCB 3X1SB 2LY8A 3MVDD 3UT9D 5BNVA 2G5HC 5B2JD 1KX3C 5F99A 3C1CD 2PYOA 5JRGA 4CAYB 3MGSB 2NQBD 3X1VC 5BS7A 1M18C 3A6NB 4Z2MH 3W97A 4NE5A 5CPJD 4LD9B 3O62B 4YM6D 3MGRD 2BG1A 1HTAA 1T3UA 4EO5C 4WU9D 3AV1B 1KX3B 2DF4C 3WA9A 5B31C 4X23B 2RVQC 1M18B 3RELC 3B6FC 5B1LD 5KDMA 4J8WC 1U35C 4KHAA 2F8NG 3REHA 4J8XC 1P3PA 1ID3A 2BYMA 1P3KD 3AYWB 2BYKB 1B6WA 5C3IB 1KX5A 2FJ7D 1P3LA 2Y2QA 4ZBJB 3LZ1A 1P3AB 3P5JB 1M19A 3EG5B 3W99D 3VH6T 5DNND 4J8WB 1P3OD 3WTPA 3VH6A 2Y2IA 5CP6D 1P3MD 4Z66A 2AROB 3W98C 2CWEA 5GT0A 5B0YA 1P3IA 4J8VD 3AZNB 3AZGA 3A1IA 5AV9D 2CV5A 1S32C 4NFTA 2ZY3A 3AZJA 1F66D 5DNMD 4CSRA 5BNXA 3W98B 1M1AC 5JA4B 4UUZB 1P3FA 3AZED 1N1JA 4KGCD 1KX4B 5FUGA 5B24D 3LZ0B 3UTAA 4WNNA 4XZQA 1A7WA 2HIOC 3LJAA 3AZMA 3AZKA 1HQ3C 3O62A 1M1AB 3AZLB 5GSUC 3B6GA 5CHLB 5BS7C 5CPIA 3W97C 5B40A 3AFAB 3X1VD 5AV5C 5BNVB 1P34C 5B32D 1EQZD 5F99B 4YS3C 2PYOB 5B0ZB 5JRGB 3WTPE 3WA9C 3AZID 3AYWA 5B31D 3KUYA 3W97B 3RELD 4AWLB 3REHC 1U35D 1P3PC 1ID3C 3LELC 5AY8D 4G92C 4J8XD 3REKB 1TZYA 3WA9B 3REIA 3EPHA 4DRAA 5GT3A 3MNNB 3WKJC 5KDMB 3REJD 3AZNA 2NZDB 3WAAA 4Z2MG 3WTPC 4KHAB 3C1BD 4R8PD 1P3PB 1ID3B 4Z66C 1KX5B 2NQBB 1P3LB 3KFUG 5GT0C 4WV4B 5B0YC 5B1MA 1P3IC 1ZLAD 1P3BA 3LZ1B 2CV5C 1M19B 3KXBA 3V9RA 5JA4A 4UUZA 3AZHD 5G49A 1S32D 1KX4A 4J8UB 3LZ0A 3AZJC 3NQJA 5AVCC 4Z66B 5E5AD 5BO0B 3FDDA 5GT0B 1P3IB 4QLCA 4E45A 3AZGB 3W96D 4KUDA 4ZUXD 5GXQA 3UTAC 3AZMC 3A6NC 3AZJB 1AOIA 5BT1C 1P3GD 3AFAA 4LD9C 4CSRB 5BNXB 3O62C 2HIOD 3AZFA 3AV2A 1HQ3D 1P3FB 3AV1C 3B6GC 1N1JB 2F8ND 5FUGB 5GSUD 5B0ZA 4X23C 3UTAB 4WNNB 2ZY5A 4XZQB 5CP6B 3LJAB 3AZMB 4Z5TA 3AZKB 3KWQA 3TU4A 5AV5D 3MGPA 1P34D 4JJNA 3B6GB 5AVBA 5B33D 2F2AC 4WU8A 4YS3D 1BFMA 2VQRA 2IO5B 5C3IC 3KUYC 3REKA 3AYWC 5CPIB 4XUJA 5B40B 5AV6D 3H0LC 3MGQD 4ZBJC 1F66B 1P3AC 3MNNA 5DNMB 3X1TA 2XD1A 3MVDA 3UT9A 2NZDA 2JE5A 5B2JA 3AZEB 3LELD 3REIC 3C1CA 5B24B 1R4VA 2AROC 3KUYB 3X1UD 2NQBA 1Z2CB 4UPKA 4E44A 3AZNC 3WKJD 5CPJA 4YM6A 3MGRA 3UTBD 4J8UA 4WU9A 1TAFA 3EPJA 1TZYB 3REIB 5B1MC 1P3BC 2Y2NA 4NE3A 5GT3B 5BO0A 3AN2B 1KX4C 3WAAB 3LZ0C 2DQNC 5AV8B 1P3KA 2FJ7A 4H9SA 5AVCD 3X1SD 5B1MB 4QLCC 1P3BB 4KUDC 3AZLC 5GXQC 3KXBB 3V9RB 5B2ID 1JFIA 5G49B 3W99A 5DNNA 1P3OA 3MGSD 4HGAB 3NQJB 3AFAC 3A6ND 5CP6A 1P3MA 4LD9D 2J8PA 2HUEC 4QLCB 5F99C 3REJB 2PYOC 4J8VA 5B0ZC 5JRGC 5GXQB 3AV1D 4KUDB 5AV9A 1KX3D 5CPKB 4WZSB 4X23D 1AOIB 1M18D 3KWQC 4AWLC 3TU4C 3MGPC 3AZFB 1F66A 5DNMA 2G5IC 3AV2B 2HUEB 5AVBC 4WU8C 3REKC 3AZEA 3AZHB 4KGCA 4XUJC 5B24A 3MNNC 2RVQD 4Z5TB 1B67A 3MVDC 3KWQB 3UT9C 3TU4B 1P3AD 3MGPB 3B6FD 2NZDC 3R45A 5B2JC 4JJNB 4J8WD 3C1CC 5AVBB 4WU8B 1KX5C 2NQBC 1P3LC 4XUJB 2AROD 5CPJC 4H9RA 3LZ1C 3X1VA 3X1TB 1M19C 3AN2A 4YM6C 3MVDB 3UT9B 1EQZA 5B32A 4J8UC 5B2JB 4WU9C 3C1CB 2Y2OA 3AZIA 5AV8A 5B31A 2ZM5A 3W98D 3AZGC 5CPJB 3RELA 4YM6B 3MGRB 1KX4D 2YFVB 1U35A 2YFWA 1TAFB 5B33B 5AY8A 4WU9B 2FJ7C 2XD5A 4J8XA 3MGQB 1P3FC 5B1LB 1M1AD 3W99C 3AZLD 3REJA 1P3OC 3C1BA 4R8PA 5CPKA 2Y2PA 5CP6C 4XZQC 3LJAC 1P3KB 2FJ7B 3AZKC 1ZLAA 5F99D 1JFIB 3F6TA 2PYOD 5CPIC 2IO5C 5JRGD 5DNNB 3AZHA 3W99B 1P3OB 5B40C 4DRBA 1F66C 3W97D 5DNMC 1P3MB 3KSYA 5E5AA 3AZEC 4J8VB 4H9OA 3W96A 3EPKA 5AV9B 5B24C 2Y2JA 3B0CW 4ZUXA 4H9QA 3B0DB 3WA9D 2Y2HA 3MNND 1P3GA 1W2EA 2HIOA 2NZDD 3VH5W 1HQ3A 3REHD 5B2IB 1P3PD 1ID3D 1TZYC 2F8NA 4KGCB 1KX5D 5GSUA 2W8SA 1P3LD 5GT3C 3AN2C 3LZ1D 1M19D 3WAAC 1KU5A 5B32C 2Y2KA 3R45B 1EQZC 5AV5A 1P34A 4J8UD 3WTPD 2YFVA 3AZIC 5B33A 5AV8C 4YS3A 4Z66D 1BH9A 4H9RB 5B0YD 5GT0D 5AV6A 3X1VB 3MGQA 1P3ID 3KXBC 3AZGD 5B1LA 2CV5D 1EQZB 5B32B 5AY8C 4HGAC 4EO5B 3LELA 3B0BA 4WJ3C 3AZIB 3AZJD 3EPLA 4DQYB 5B31B 3X1UA 3REJC 3RELB 3B6FB 1PZRA 1P3FD 4G91C 3WKJA 3A1KA 3C1BC 4R8PC 5CPKC 1U35B 3UTBA 2YFWB 5AY8B 1H3OA 3UTAD 3H0MC 1AOIC 4J8XB 4XZQD 3AZMD 3LJAD 3AZFC 1ZLAC 5BT1D 2RIQA 3AZKD 3AV2C 3O62D 4H9NA 3VH6W 3AL0C 3AZHC 3B6GD 4G91B 5CPID 3C1BB 4R8PB 3IP4C 5B40D 4Z5TC 5E5AC 4H9PB 1ZLAB 5AVCA 3X1SA
chains in the Genus database with same CATH topology
3NQUB 2F8NK 4JJNC 3W96C 4ZUXC 2Y2GA 5B2IA 1S32B 4CAYA 3AYWD 3KUYD 3MGSA 1P3GC 3X1TC 3A6NA 2L5AA 5E5AB 4LD9A 2F8NH 2ZY4A 4H9OB 3W96B 3H0RC 3AV1A 4ZUXB 1TZYD 4H9QB 1KX3A 3REID 1BH8B 1F1EA 4X23A 5GT3D 3AN2D 1P3GB 1M18A 2HIOB 3AZND 3MGRC 3WAAD 2JCHA 1HQ3B 2ZY2A 5B33C 2F8NB 5GSUB 5AV8D 2BYKA 5AV6C 5B1MD 3MGQC 1P3BD 5B1LC 3KXBD 3B6FA 1P3AA 1ULYA 5AV5B 1P34B 4J8WA 3LZ0D 1WWIA 4YS3B 1P3KC 4H9SC 3X1UC 2Y2LA 1BH9B 2AROA 5AV6B 4QLCD 2FFFB 4NE6A 4KUDD 5DNNC 5GXQD 3UTBC 5B32G 3REHB 5CPKD 1Q9CA 1WWSA 3LELB 2BYMB 4G92B 1AOID 1P3MC 3AFAD 2JSSA 3AZFD 5B31G 3X1UB 4H9PA 3AV2D 3NQUA 3W98A 4J8VC 3WKJB 5AV9C 5B0ZD 3B0DC 3UTBB 3WTPB 2UWXA 1S32A 1H3OB 3B0CT 3X1SC 4Z5TD 3KWQD 3TU4D 3MGPD 4H9NB 5B0YB 2Y2MA 4M6BA 4JJND 5B2IC 2CV5B 1M1AA 4KGCC 3VH5T 5AVBD 3AZLA 4WU8D 3MGSC 3REKD 3VH5A 4XUJD 1BH8A 3X1TD 5AVCB 3X1SB 2LY8A 3MVDD 3UT9D 5BNVA 2G5HC 5B2JD 1KX3C 5F99A 3C1CD 2PYOA 5JRGA 4CAYB 3MGSB 2NQBD 3X1VC 5BS7A 1M18C 3A6NB 4Z2MH 3W97A 4NE5A 5CPJD 4LD9B 3O62B 4YM6D 3MGRD 2BG1A 1HTAA 1T3UA 4EO5C 4WU9D 3AV1B 1KX3B 2DF4C 3WA9A 5B31C 4X23B 2RVQC 1M18B 3RELC 3B6FC 5B1LD 5KDMA 4J8WC 1U35C 4KHAA 2F8NG 3REHA 4J8XC 1P3PA 1ID3A 2BYMA 1P3KD 3AYWB 2BYKB 1B6WA 5C3IB 1KX5A 2FJ7D 1P3LA 2Y2QA 4ZBJB 3LZ1A 1P3AB 3P5JB 1M19A 3EG5B 3W99D 3VH6T 5DNND 4J8WB 1P3OD 3WTPA 3VH6A 2Y2IA 5CP6D 1P3MD 4Z66A 2AROB 3W98C 2CWEA 5GT0A 5B0YA 1P3IA 4J8VD 3AZNB 3AZGA 3A1IA 5AV9D 2CV5A 1S32C 4NFTA 2ZY3A 3AZJA 1F66D 5DNMD 4CSRA 5BNXA 3W98B 1M1AC 5JA4B 4UUZB 1P3FA 3AZED 1N1JA 4KGCD 1KX4B 5FUGA 5B24D 3LZ0B 3UTAA 4WNNA 4XZQA 1A7WA 2HIOC 3LJAA 3AZMA 3AZKA 1HQ3C 3O62A 1M1AB 3AZLB 5GSUC 3B6GA 5CHLB 5BS7C 5CPIA 3W97C 5B40A 3AFAB 3X1VD 5AV5C 5BNVB 1P34C 5B32D 1EQZD 5F99B 4YS3C 2PYOB 5B0ZB 5JRGB 3WTPE 3WA9C 3AZID 3AYWA 5B31D 3KUYA 3W97B 3RELD 4AWLB 3REHC 1U35D 1P3PC 1ID3C 3LELC 5AY8D 4G92C 4J8XD 3REKB 1TZYA 3WA9B 3REIA 3EPHA 4DRAA 5GT3A 3MNNB 3WKJC 5KDMB 3REJD 3AZNA 2NZDB 3WAAA 4Z2MG 3WTPC 4KHAB 3C1BD 4R8PD 1P3PB 1ID3B 4Z66C 1KX5B 2NQBB 1P3LB 3KFUG 5GT0C 4WV4B 5B0YC 5B1MA 1P3IC 1ZLAD 1P3BA 3LZ1B 2CV5C 1M19B 3KXBA 3V9RA 5JA4A 4UUZA 3AZHD 5G49A 1S32D 1KX4A 4J8UB 3LZ0A 3AZJC 3NQJA 5AVCC 4Z66B 5E5AD 5BO0B 3FDDA 5GT0B 1P3IB 4QLCA 4E45A 3AZGB 3W96D 4KUDA 4ZUXD 5GXQA 3UTAC 3AZMC 3A6NC 3AZJB 1AOIA 5BT1C 1P3GD 3AFAA 4LD9C 4CSRB 5BNXB 3O62C 2HIOD 3AZFA 3AV2A 1HQ3D 1P3FB 3AV1C 3B6GC 1N1JB 2F8ND 5FUGB 5GSUD 5B0ZA 4X23C 3UTAB 4WNNB 2ZY5A 4XZQB 5CP6B 3LJAB 3AZMB 4Z5TA 3AZKB 3KWQA 3TU4A 5AV5D 3MGPA 1P34D 4JJNA 3B6GB 5AVBA 5B33D 2F2AC 4WU8A 4YS3D 1BFMA 2VQRA 2IO5B 5C3IC 3KUYC 3REKA 3AYWC 5CPIB 4XUJA 5B40B 5AV6D 3H0LC 3MGQD 4ZBJC 1F66B 1P3AC 3MNNA 5DNMB 3X1TA 2XD1A 3MVDA 3UT9A 2NZDA 2JE5A 5B2JA 3AZEB 3LELD 3REIC 3C1CA 5B24B 1R4VA 2AROC 3KUYB 3X1UD 2NQBA 1Z2CB 4UPKA 4E44A 3AZNC 3WKJD 5CPJA 4YM6A 3MGRA 3UTBD 4J8UA 4WU9A 1TAFA 3EPJA 1TZYB 3REIB 5B1MC 1P3BC 2Y2NA 4NE3A 5GT3B 5BO0A 3AN2B 1KX4C 3WAAB 3LZ0C 2DQNC 5AV8B 1P3KA 2FJ7A 4H9SA 5AVCD 3X1SD 5B1MB 4QLCC 1P3BB 4KUDC 3AZLC 5GXQC 3KXBB 3V9RB 5B2ID 1JFIA 5G49B 3W99A 5DNNA 1P3OA 3MGSD 4HGAB 3NQJB 3AFAC 3A6ND 5CP6A 1P3MA 4LD9D 2J8PA 2HUEC 4QLCB 5F99C 3REJB 2PYOC 4J8VA 5B0ZC 5JRGC 5GXQB 3AV1D 4KUDB 5AV9A 1KX3D 5CPKB 4WZSB 4X23D 1AOIB 1M18D 3KWQC 4AWLC 3TU4C 3MGPC 3AZFB 1F66A 5DNMA 2G5IC 3AV2B 2HUEB 5AVBC 4WU8C 3REKC 3AZEA 3AZHB 4KGCA 4XUJC 5B24A 3MNNC 2RVQD 4Z5TB 1B67A 3MVDC 3KWQB 3UT9C 3TU4B 1P3AD 3MGPB 3B6FD 2NZDC 3R45A 5B2JC 4JJNB 4J8WD 3C1CC 5AVBB 4WU8B 1KX5C 2NQBC 1P3LC 4XUJB 2AROD 5CPJC 4H9RA 3LZ1C 3X1VA 3X1TB 1M19C 3AN2A 4YM6C 3MVDB 3UT9B 1EQZA 5B32A 4J8UC 5B2JB 4WU9C 3C1CB 2Y2OA 3AZIA 5AV8A 5B31A 2ZM5A 3W98D 3AZGC 5CPJB 3RELA 4YM6B 3MGRB 1KX4D 2YFVB 1U35A 2YFWA 1TAFB 5B33B 5AY8A 4WU9B 2FJ7C 2XD5A 4J8XA 3MGQB 1P3FC 5B1LB 1M1AD 3W99C 3AZLD 3REJA 1P3OC 3C1BA 4R8PA 5CPKA 2Y2PA 5CP6C 4XZQC 3LJAC 1P3KB 2FJ7B 3AZKC 1ZLAA 5F99D 1JFIB 3F6TA 2PYOD 5CPIC 2IO5C 5JRGD 5DNNB 3AZHA 3W99B 1P3OB 5B40C 4DRBA 1F66C 3W97D 5DNMC 1P3MB 3KSYA 5E5AA 3AZEC 4J8VB 4H9OA 3W96A 3EPKA 5AV9B 5B24C 2Y2JA 3B0CW 4ZUXA 4H9QA 3B0DB 3WA9D 2Y2HA 3MNND 1P3GA 1W2EA 2HIOA 2NZDD 3VH5W 1HQ3A 3REHD 5B2IB 1P3PD 1ID3D 1TZYC 2F8NA 4KGCB 1KX5D 5GSUA 2W8SA 1P3LD 5GT3C 3AN2C 3LZ1D 1M19D 3WAAC 1KU5A 5B32C 2Y2KA 3R45B 1EQZC 5AV5A 1P34A 4J8UD 3WTPD 2YFVA 3AZIC 5B33A 5AV8C 4YS3A 4Z66D 1BH9A 4H9RB 5B0YD 5GT0D 5AV6A 3X1VB 3MGQA 1P3ID 3KXBC 3AZGD 5B1LA 2CV5D 1EQZB 5B32B 5AY8C 4HGAC 4EO5B 3LELA 3B0BA 4WJ3C 3AZIB 3AZJD 3EPLA 4DQYB 5B31B 3X1UA 3REJC 3RELB 3B6FB 1PZRA 1P3FD 4G91C 3WKJA 3A1KA 3C1BC 4R8PC 5CPKC 1U35B 3UTBA 2YFWB 5AY8B 1H3OA 3UTAD 3H0MC 1AOIC 4J8XB 4XZQD 3AZMD 3LJAD 3AZFC 1ZLAC 5BT1D 2RIQA 3AZKD 3AV2C 3O62D 4H9NA 3VH6W 3AL0C 3AZHC 3B6GD 4G91B 5CPID 3C1BB 4R8PB 3IP4C 5B40D 4Z5TC 5E5AC 4H9PB 1ZLAB 5AVCA 3X1SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NQU B;  2F8N K;  4JJN C;  3W96 C;  4ZUX C;  5B2I A;  1S32 B;  4CAY A;  3AYW D;  3KUY D;  3MGS A;  1P3G C;  3X1T C;  3A6N A;  2L5A A;  5E5A B;  4LD9 A;  2F8N H;  4H9O B;  3W96 B;  3AV1 A;  4ZUX B;  1TZY D;  4H9Q B;  1KX3 A;  3REI D;  1BH8 B;  1F1E A;  4X23 A;  5GT3 D;  3AN2 D;  1P3G B;  1M18 A;  2HIO B;  3AZN D;  3MGR C;  3WAA D;  1HQ3 B;  5B33 C;  2F8N B;  5GSU B;  5AV8 D;  2BYK A;  5AV6 C;  5B1M D;  3MGQ C;  1P3B D;  5B1L C;  3KXB D;  3B6F A;  1P3A A;  1ULY A;  5AV5 B;  1P34 B;  4J8W A;  3LZ0 D;  1WWI A;  4YS3 B;  1P3K C;  4H9S C;  3X1U C;  1BH9 B;  2ARO A;  5AV6 B;  4QLC D;  4NE6 A;  4KUD D;  5DNN C;  5GXQ D;  3UTB C;  5B32 G;  3REH B;  5CPK D;  1Q9C A;  1WWS A;  3LEL B;  2BYM B;  4G92 B;  1AOI D;  1P3M C;  3AFA D;  2JSS A;  3AZF D;  5B31 G;  3X1U B;  4H9P A;  3AV2 D;  3NQU A;  3W98 A;  4J8V C;  3WKJ B;  5AV9 C;  5B0Z D;  3B0D C;  3UTB B;  3WTP B;  1S32 A;  1H3O B;  3B0C T;  3X1S C;  4Z5T D;  3KWQ D;  3TU4 D;  3MGP D;  4H9N B;  5B0Y B;  4M6B A;  4JJN D;  5B2I C;  2CV5 B;  1M1A A;  4KGC C;  3VH5 T;  5AVB D;  3AZL A;  4WU8 D;  3MGS C;  3REK D;  3VH5 A;  4XUJ D;  1BH8 A;  3X1T D;  5AVC B;  3X1S B;  2LY8 A;  3MVD D;  3UT9 D;  5BNV A;  5B2J D;  1KX3 C;  5F99 A;  3C1C D;  2PYO A;  5JRG A;  4CAY B;  3MGS B;  2NQB D;  3X1V C;  5BS7 A;  1M18 C;  3A6N B;  4Z2M H;  3W97 A;  4NE5 A;  5CPJ D;  4LD9 B;  3O62 B;  4YM6 D;  3MGR D;  1HTA A;  4EO5 C;  4WU9 D;  3AV1 B;  1KX3 B;  3WA9 A;  5B31 C;  4X23 B;  2RVQ C;  1M18 B;  3REL C;  3B6F C;  5B1L D;  5KDM A;  4J8W C;  1U35 C;  4KHA A;  2F8N G;  3REH A;  4J8X C;  1P3P A;  1ID3 A;  2BYM A;  1P3K D;  3AYW B;  2BYK B;  1B6W A;  5C3I B;  1KX5 A;  2FJ7 D;  1P3L A;  4ZBJ B;  3LZ1 A;  1P3A B;  1M19 A;  3VH6 T;  3W99 D;  5DNN D;  4J8W B;  1P3O D;  3WTP A;  3VH6 A;  5CP6 D;  1P3M D;  4Z66 A;  2ARO B;  3W98 C;  2CWE A;  5GT0 A;  5B0Y A;  1P3I A;  4J8V D;  3AZN B;  3AZG A;  2CV5 A;  5AV9 D;  1S32 C;  4NFT A;  3AZJ A;  1F66 D;  5DNM D;  4CSR A;  5BNX A;  3W98 B;  1M1A C;  5JA4 B;  4UUZ B;  1P3F A;  3AZE D;  1N1J A;  4KGC D;  1KX4 B;  5FUG A;  5B24 D;  3LZ0 B;  3UTA A;  4WNN A;  4XZQ A;  1A7W A;  2HIO C;  3LJA A;  3AZM A;  3AZK A;  1HQ3 C;  3O62 A;  1M1A B;  3AZL B;  5GSU C;  3B6G A;  5CHL B;  5BS7 C;  5CPI A;  3W97 C;  5B40 A;  3AFA B;  3X1V D;  5AV5 C;  5BNV B;  1P34 C;  5B32 D;  1EQZ D;  5F99 B;  4YS3 C;  2PYO B;  5B0Z B;  5JRG B;  3WTP E;  3WA9 C;  3AZI D;  3AYW A;  5B31 D;  3KUY A;  3W97 B;  3REL D;  4AWL B;  3REH C;  1U35 D;  1P3P C;  1ID3 C;  3LEL C;  5AY8 D;  4G92 C;  4J8X D;  3REK B;  1TZY A;  3WA9 B;  3REI A;  4DRA A;  5GT3 A;  3MNN B;  3WKJ C;  5KDM B;  3REJ D;  3AZN A;  2NZD B;  3WAA A;  4Z2M G;  3WTP C;  4KHA B;  3C1B D;  4R8P D;  1P3P B;  1ID3 B;  4Z66 C;  1KX5 B;  2NQB B;  1P3L B;  5GT0 C;  4WV4 B;  5B0Y C;  5B1M A;  1P3I C;  1ZLA D;  1P3B A;  3LZ1 B;  2CV5 C;  1M19 B;  3KXB A;  3V9R A;  5JA4 A;  4UUZ A;  3AZH D;  5G49 A;  1S32 D;  1KX4 A;  4J8U B;  3LZ0 A;  3AZJ C;  3NQJ A;  5AVC C;  4Z66 B;  5E5A D;  5BO0 B;  5GT0 B;  1P3I B;  4QLC A;  4E45 A;  3AZG B;  3W96 D;  4KUD A;  4ZUX D;  5GXQ A;  3UTA C;  3AZM C;  3A6N C;  3AZJ B;  1AOI A;  5BT1 C;  1P3G D;  3AFA A;  4LD9 C;  4CSR B;  5BNX B;  3O62 C;  2HIO D;  3AZF A;  3AV2 A;  1HQ3 D;  1P3F B;  3AV1 C;  3B6G C;  1N1J B;  2F8N D;  5FUG B;  5GSU D;  5B0Z A;  4X23 C;  3UTA B;  4WNN B;  5CP6 B;  4XZQ B;  3AZM B;  3LJA B;  4Z5T A;  3AZK B;  3KWQ A;  3TU4 A;  5AV5 D;  3MGP A;  1P34 D;  4JJN A;  3B6G B;  5AVB A;  5B33 D;  4WU8 A;  1BFM A;  4YS3 D;  3AYW C;  2IO5 B;  5C3I C;  3KUY C;  3REK A;  5CPI B;  4XUJ A;  5B40 B;  5AV6 D;  3MGQ D;  4ZBJ C;  1F66 B;  1P3A C;  3MNN A;  5DNM B;  3X1T A;  3MVD A;  3UT9 A;  2NZD A;  5B2J A;  3AZE B;  3LEL D;  3REI C;  3C1C A;  5B24 B;  1R4V A;  2ARO C;  3KUY B;  3X1U D;  2NQB A;  4E44 A;  3AZN C;  3WKJ D;  5CPJ A;  4YM6 A;  3MGR A;  3UTB D;  4J8U A;  4WU9 A;  1TAF A;  1TZY B;  3REI B;  5B1M C;  1P3B C;  4NE3 A;  5GT3 B;  5BO0 A;  3AN2 B;  1KX4 C;  3WAA B;  3LZ0 C;  5AV8 B;  1P3K A;  2FJ7 A;  4H9S A;  5AVC D;  3X1S D;  5B1M B;  4QLC C;  1P3B B;  4KUD C;  3AZL C;  5GXQ C;  3KXB B;  3V9R B;  5B2I D;  1JFI A;  5G49 B;  3W99 A;  5DNN A;  1P3O A;  3MGS D;  4HGA B;  3NQJ B;  3AFA C;  3A6N D;  5CP6 A;  1P3M A;  4LD9 D;  2HUE C;  4QLC B;  5F99 C;  3REJ B;  2PYO C;  4J8V A;  5B0Z C;  5JRG C;  5GXQ B;  3AV1 D;  4KUD B;  5AV9 A;  1KX3 D;  5CPK B;  4WZS B;  4X23 D;  1AOI B;  1M18 D;  3KWQ C;  4AWL C;  3TU4 C;  3MGP C;  3AZF B;  1F66 A;  5DNM A;  3AV2 B;  2HUE B;  5AVB C;  4WU8 C;  3REK C;  3AZE A;  3AZH B;  4KGC A;  4XUJ C;  5B24 A;  3MNN C;  2RVQ D;  4Z5T B;  1B67 A;  3MVD C;  3KWQ B;  3UT9 C;  3TU4 B;  1P3A D;  3MGP B;  3B6F D;  2NZD C;  3R45 A;  5B2J C;  4JJN B;  4J8W D;  3C1C C;  5AVB B;  4WU8 B;  1KX5 C;  2NQB C;  1P3L C;  4XUJ B;  2ARO D;  5CPJ C;  4H9R A;  3LZ1 C;  3X1V A;  3X1T B;  1M19 C;  3AN2 A;  4YM6 C;  3MVD B;  3UT9 B;  1EQZ A;  5B32 A;  4J8U C;  5B2J B;  4WU9 C;  3C1C B;  3AZI A;  5AV8 A;  5B31 A;  3W98 D;  3AZG C;  5CPJ B;  3REL A;  4YM6 B;  3MGR B;  1KX4 D;  2YFV B;  1U35 A;  2YFW A;  1TAF B;  5B33 B;  5AY8 A;  4WU9 B;  2FJ7 C;  4J8X A;  3MGQ B;  1P3F C;  5B1L B;  1M1A D;  3W99 C;  3AZL D;  3REJ A;  1P3O C;  3C1B A;  4R8P A;  5CPK A;  5CP6 C;  4XZQ C;  3LJA C;  1P3K B;  2FJ7 B;  3AZK C;  1ZLA A;  5F99 D;  1JFI B;  2PYO D;  5CPI C;  2IO5 C;  5JRG D;  5DNN B;  3AZH A;  3W99 B;  1P3O B;  5B40 C;  4DRB A;  1F66 C;  3W97 D;  5DNM C;  1P3M B;  3KSY A;  5E5A A;  3AZE C;  4J8V B;  4H9O A;  3W96 A;  5AV9 B;  5B24 C;  3B0C W;  4ZUX A;  4H9Q A;  3B0D B;  3WA9 D;  3MNN D;  1P3G A;  2HIO A;  2NZD D;  3VH5 W;  1HQ3 A;  3REH D;  5B2I B;  1P3P D;  1ID3 D;  1TZY C;  2F8N A;  4KGC B;  1KX5 D;  5GSU A;  1P3L D;  5GT3 C;  3AN2 C;  3LZ1 D;  1M19 D;  3WAA C;  1KU5 A;  5B32 C;  1EQZ C;  3R45 B;  5AV5 A;  1P34 A;  4J8U D;  3WTP D;  2YFV A;  3AZI C;  5B33 A;  5AV8 C;  4YS3 A;  4Z66 D;  1BH9 A;  4H9R B;  5B0Y D;  5GT0 D;  5AV6 A;  3X1V B;  3MGQ A;  1P3I D;  3KXB C;  3AZG D;  5B1L A;  2CV5 D;  1EQZ B;  5B32 B;  5AY8 C;  4HGA C;  4EO5 B;  3LEL A;  3B0B A;  3AZI B;  3AZJ D;  5B31 B;  3X1U A;  3REJ C;  3REL B;  3B6F B;  1P3F D;  4G91 C;  3WKJ A;  3C1B C;  4R8P C;  5CPK C;  1U35 B;  3UTB A;  2YFW B;  5AY8 B;  1H3O A;  3UTA D;  1AOI C;  4J8X B;  4XZQ D;  3AZM D;  3LJA D;  3AZF C;  1ZLA C;  5BT1 D;  3AZK D;  3AV2 C;  3O62 D;  4H9N A;  3VH6 W;  3AZH C;  3B6G D;  4G91 B;  5CPI D;  3C1B B;  4R8P B;  5B40 D;  4Z5T C;  5E5A C;  4H9P B;  1ZLA B;  5AVC A;  3X1S A; 
#chains in the Genus database with same CATH topology
 3NQU B;  2F8N K;  4JJN C;  3W96 C;  4ZUX C;  2Y2G A;  5B2I A;  1S32 B;  4CAY A;  3AYW D;  3KUY D;  3MGS A;  1P3G C;  3X1T C;  3A6N A;  2L5A A;  5E5A B;  4LD9 A;  2F8N H;  2ZY4 A;  4H9O B;  3W96 B;  3H0R C;  3AV1 A;  4ZUX B;  1TZY D;  4H9Q B;  1KX3 A;  3REI D;  1BH8 B;  1F1E A;  4X23 A;  5GT3 D;  3AN2 D;  1P3G B;  1M18 A;  2HIO B;  3AZN D;  3MGR C;  3WAA D;  2JCH A;  1HQ3 B;  2ZY2 A;  5B33 C;  2F8N B;  5GSU B;  5AV8 D;  2BYK A;  5AV6 C;  5B1M D;  3MGQ C;  1P3B D;  5B1L C;  3KXB D;  3B6F A;  1P3A A;  1ULY A;  5AV5 B;  1P34 B;  4J8W A;  3LZ0 D;  1WWI A;  4YS3 B;  1P3K C;  4H9S C;  3X1U C;  2Y2L A;  1BH9 B;  2ARO A;  5AV6 B;  4QLC D;  2FFF B;  4NE6 A;  4KUD D;  5DNN C;  5GXQ D;  3UTB C;  5B32 G;  3REH B;  5CPK D;  1Q9C A;  1WWS A;  3LEL B;  2BYM B;  4G92 B;  1AOI D;  1P3M C;  3AFA D;  2JSS A;  3AZF D;  5B31 G;  3X1U B;  4H9P A;  3AV2 D;  3NQU A;  3W98 A;  4J8V C;  3WKJ B;  5AV9 C;  5B0Z D;  3B0D C;  3UTB B;  3WTP B;  2UWX A;  1S32 A;  1H3O B;  3B0C T;  3X1S C;  4Z5T D;  3KWQ D;  3TU4 D;  3MGP D;  4H9N B;  5B0Y B;  2Y2M A;  4M6B A;  4JJN D;  5B2I C;  2CV5 B;  1M1A A;  4KGC C;  3VH5 T;  5AVB D;  3AZL A;  4WU8 D;  3MGS C;  3REK D;  3VH5 A;  4XUJ D;  1BH8 A;  3X1T D;  5AVC B;  3X1S B;  2LY8 A;  3MVD D;  3UT9 D;  5BNV A;  2G5H C;  5B2J D;  1KX3 C;  5F99 A;  3C1C D;  2PYO A;  5JRG A;  4CAY B;  3MGS B;  2NQB D;  3X1V C;  5BS7 A;  1M18 C;  3A6N B;  4Z2M H;  3W97 A;  4NE5 A;  5CPJ D;  4LD9 B;  3O62 B;  4YM6 D;  3MGR D;  2BG1 A;  1HTA A;  1T3U A;  4EO5 C;  4WU9 D;  3AV1 B;  1KX3 B;  2DF4 C;  3WA9 A;  5B31 C;  4X23 B;  2RVQ C;  1M18 B;  3REL C;  3B6F C;  5B1L D;  5KDM A;  4J8W C;  1U35 C;  4KHA A;  2F8N G;  3REH A;  4J8X C;  1P3P A;  1ID3 A;  2BYM A;  1P3K D;  3AYW B;  2BYK B;  1B6W A;  5C3I B;  1KX5 A;  2FJ7 D;  1P3L A;  2Y2Q A;  4ZBJ B;  3LZ1 A;  1P3A B;  3P5J B;  1M19 A;  3EG5 B;  3W99 D;  3VH6 T;  5DNN D;  4J8W B;  1P3O D;  3WTP A;  3VH6 A;  2Y2I A;  5CP6 D;  1P3M D;  4Z66 A;  2ARO B;  3W98 C;  2CWE A;  5GT0 A;  5B0Y A;  1P3I A;  4J8V D;  3AZN B;  3AZG A;  3A1I A;  5AV9 D;  2CV5 A;  1S32 C;  4NFT A;  2ZY3 A;  3AZJ A;  1F66 D;  5DNM D;  4CSR A;  5BNX A;  3W98 B;  1M1A C;  5JA4 B;  4UUZ B;  1P3F A;  3AZE D;  1N1J A;  4KGC D;  1KX4 B;  5FUG A;  5B24 D;  3LZ0 B;  3UTA A;  4WNN A;  4XZQ A;  1A7W A;  2HIO C;  3LJA A;  3AZM A;  3AZK A;  1HQ3 C;  3O62 A;  1M1A B;  3AZL B;  5GSU C;  3B6G A;  5CHL B;  5BS7 C;  5CPI A;  3W97 C;  5B40 A;  3AFA B;  3X1V D;  5AV5 C;  5BNV B;  1P34 C;  5B32 D;  1EQZ D;  5F99 B;  4YS3 C;  2PYO B;  5B0Z B;  5JRG B;  3WTP E;  3WA9 C;  3AZI D;  3AYW A;  5B31 D;  3KUY A;  3W97 B;  3REL D;  4AWL B;  3REH C;  1U35 D;  1P3P C;  1ID3 C;  3LEL C;  5AY8 D;  4G92 C;  4J8X D;  3REK B;  1TZY A;  3WA9 B;  3REI A;  3EPH A;  4DRA A;  5GT3 A;  3MNN B;  3WKJ C;  5KDM B;  3REJ D;  3AZN A;  2NZD B;  3WAA A;  4Z2M G;  3WTP C;  4KHA B;  3C1B D;  4R8P D;  1P3P B;  1ID3 B;  4Z66 C;  1KX5 B;  2NQB B;  1P3L B;  3KFU G;  5GT0 C;  4WV4 B;  5B0Y C;  5B1M A;  1P3I C;  1ZLA D;  1P3B A;  3LZ1 B;  2CV5 C;  1M19 B;  3KXB A;  3V9R A;  5JA4 A;  4UUZ A;  3AZH D;  5G49 A;  1S32 D;  1KX4 A;  4J8U B;  3LZ0 A;  3AZJ C;  3NQJ A;  5AVC C;  4Z66 B;  5E5A D;  5BO0 B;  3FDD A;  5GT0 B;  1P3I B;  4QLC A;  4E45 A;  3AZG B;  3W96 D;  4KUD A;  4ZUX D;  5GXQ A;  3UTA C;  3AZM C;  3A6N C;  3AZJ B;  1AOI A;  5BT1 C;  1P3G D;  3AFA A;  4LD9 C;  4CSR B;  5BNX B;  3O62 C;  2HIO D;  3AZF A;  3AV2 A;  1HQ3 D;  1P3F B;  3AV1 C;  3B6G C;  1N1J B;  2F8N D;  5FUG B;  5GSU D;  5B0Z A;  4X23 C;  3UTA B;  4WNN B;  2ZY5 A;  4XZQ B;  5CP6 B;  3LJA B;  3AZM B;  4Z5T A;  3AZK B;  3KWQ A;  3TU4 A;  5AV5 D;  3MGP A;  1P34 D;  4JJN A;  3B6G B;  5AVB A;  5B33 D;  2F2A C;  4WU8 A;  4YS3 D;  1BFM A;  2VQR A;  2IO5 B;  5C3I C;  3KUY C;  3REK A;  3AYW C;  5CPI B;  4XUJ A;  5B40 B;  5AV6 D;  3H0L C;  3MGQ D;  4ZBJ C;  1F66 B;  1P3A C;  3MNN A;  5DNM B;  3X1T A;  2XD1 A;  3MVD A;  3UT9 A;  2NZD A;  2JE5 A;  5B2J A;  3AZE B;  3LEL D;  3REI C;  3C1C A;  5B24 B;  1R4V A;  2ARO C;  3KUY B;  3X1U D;  2NQB A;  1Z2C B;  4UPK A;  4E44 A;  3AZN C;  3WKJ D;  5CPJ A;  4YM6 A;  3MGR A;  3UTB D;  4J8U A;  4WU9 A;  1TAF A;  3EPJ A;  1TZY B;  3REI B;  5B1M C;  1P3B C;  2Y2N A;  4NE3 A;  5GT3 B;  5BO0 A;  3AN2 B;  1KX4 C;  3WAA B;  3LZ0 C;  2DQN C;  5AV8 B;  1P3K A;  2FJ7 A;  4H9S A;  5AVC D;  3X1S D;  5B1M B;  4QLC C;  1P3B B;  4KUD C;  3AZL C;  5GXQ C;  3KXB B;  3V9R B;  5B2I D;  1JFI A;  5G49 B;  3W99 A;  5DNN A;  1P3O A;  3MGS D;  4HGA B;  3NQJ B;  3AFA C;  3A6N D;  5CP6 A;  1P3M A;  4LD9 D;  2J8P A;  2HUE C;  4QLC B;  5F99 C;  3REJ B;  2PYO C;  4J8V A;  5B0Z C;  5JRG C;  5GXQ B;  3AV1 D;  4KUD B;  5AV9 A;  1KX3 D;  5CPK B;  4WZS B;  4X23 D;  1AOI B;  1M18 D;  3KWQ C;  4AWL C;  3TU4 C;  3MGP C;  3AZF B;  1F66 A;  5DNM A;  2G5I C;  3AV2 B;  2HUE B;  5AVB C;  4WU8 C;  3REK C;  3AZE A;  3AZH B;  4KGC A;  4XUJ C;  5B24 A;  3MNN C;  2RVQ D;  4Z5T B;  1B67 A;  3MVD C;  3KWQ B;  3UT9 C;  3TU4 B;  1P3A D;  3MGP B;  3B6F D;  2NZD C;  3R45 A;  5B2J C;  4JJN B;  4J8W D;  3C1C C;  5AVB B;  4WU8 B;  1KX5 C;  2NQB C;  1P3L C;  4XUJ B;  2ARO D;  5CPJ C;  4H9R A;  3LZ1 C;  3X1V A;  3X1T B;  1M19 C;  3AN2 A;  4YM6 C;  3MVD B;  3UT9 B;  1EQZ A;  5B32 A;  4J8U C;  5B2J B;  4WU9 C;  3C1C B;  2Y2O A;  3AZI A;  5AV8 A;  5B31 A;  2ZM5 A;  3W98 D;  3AZG C;  5CPJ B;  3REL A;  4YM6 B;  3MGR B;  1KX4 D;  2YFV B;  1U35 A;  2YFW A;  1TAF B;  5B33 B;  5AY8 A;  4WU9 B;  2FJ7 C;  2XD5 A;  4J8X A;  3MGQ B;  1P3F C;  5B1L B;  1M1A D;  3W99 C;  3AZL D;  3REJ A;  1P3O C;  3C1B A;  4R8P A;  5CPK A;  2Y2P A;  5CP6 C;  4XZQ C;  3LJA C;  1P3K B;  2FJ7 B;  3AZK C;  1ZLA A;  5F99 D;  1JFI B;  3F6T A;  2PYO D;  5CPI C;  2IO5 C;  5JRG D;  5DNN B;  3AZH A;  3W99 B;  1P3O B;  5B40 C;  4DRB A;  1F66 C;  3W97 D;  5DNM C;  1P3M B;  3KSY A;  5E5A A;  3AZE C;  4J8V B;  4H9O A;  3W96 A;  3EPK A;  5AV9 B;  5B24 C;  2Y2J A;  3B0C W;  4ZUX A;  4H9Q A;  3B0D B;  3WA9 D;  2Y2H A;  3MNN D;  1P3G A;  1W2E A;  2HIO A;  2NZD D;  3VH5 W;  1HQ3 A;  3REH D;  5B2I B;  1P3P D;  1ID3 D;  1TZY C;  2F8N A;  4KGC B;  1KX5 D;  5GSU A;  2W8S A;  1P3L D;  5GT3 C;  3AN2 C;  3LZ1 D;  1M19 D;  3WAA C;  1KU5 A;  5B32 C;  2Y2K A;  3R45 B;  1EQZ C;  5AV5 A;  1P34 A;  4J8U D;  3WTP D;  2YFV A;  3AZI C;  5B33 A;  5AV8 C;  4YS3 A;  4Z66 D;  1BH9 A;  4H9R B;  5B0Y D;  5GT0 D;  5AV6 A;  3X1V B;  3MGQ A;  1P3I D;  3KXB C;  3AZG D;  5B1L A;  2CV5 D;  1EQZ B;  5B32 B;  5AY8 C;  4HGA C;  4EO5 B;  3LEL A;  3B0B A;  4WJ3 C;  3AZI B;  3AZJ D;  3EPL A;  4DQY B;  5B31 B;  3X1U A;  3REJ C;  3REL B;  3B6F B;  1PZR A;  1P3F D;  4G91 C;  3WKJ A;  3A1K A;  3C1B C;  4R8P C;  5CPK C;  1U35 B;  3UTB A;  2YFW B;  5AY8 B;  1H3O A;  3UTA D;  3H0M C;  1AOI C;  4J8X B;  4XZQ D;  3AZM D;  3LJA D;  3AZF C;  1ZLA C;  5BT1 D;  2RIQ A;  3AZK D;  3AV2 C;  3O62 D;  4H9N A;  3VH6 W;  3AL0 C;  3AZH C;  3B6G D;  4G91 B;  5CPI D;  3C1B B;  4R8P B;  3IP4 C;  5B40 D;  4Z5T C;  5E5A C;  4H9P B;  1ZLA B;  5AVC A;  3X1S A; 
#chains in the Genus database with same CATH homology
 3NQU B;  2F8N K;  4JJN C;  3W96 C;  4ZUX C;  2Y2G A;  5B2I A;  1S32 B;  4CAY A;  3AYW D;  3KUY D;  3MGS A;  1P3G C;  3X1T C;  3A6N A;  2L5A A;  5E5A B;  4LD9 A;  2F8N H;  2ZY4 A;  4H9O B;  3W96 B;  3H0R C;  3AV1 A;  4ZUX B;  1TZY D;  4H9Q B;  1KX3 A;  3REI D;  1BH8 B;  1F1E A;  4X23 A;  5GT3 D;  3AN2 D;  1P3G B;  1M18 A;  2HIO B;  3AZN D;  3MGR C;  3WAA D;  2JCH A;  1HQ3 B;  2ZY2 A;  5B33 C;  2F8N B;  5GSU B;  5AV8 D;  2BYK A;  5AV6 C;  5B1M D;  3MGQ C;  1P3B D;  5B1L C;  3KXB D;  3B6F A;  1P3A A;  1ULY A;  5AV5 B;  1P34 B;  4J8W A;  3LZ0 D;  1WWI A;  4YS3 B;  1P3K C;  4H9S C;  3X1U C;  2Y2L A;  1BH9 B;  2ARO A;  5AV6 B;  4QLC D;  2FFF B;  4NE6 A;  4KUD D;  5DNN C;  5GXQ D;  3UTB C;  5B32 G;  3REH B;  5CPK D;  1Q9C A;  1WWS A;  3LEL B;  2BYM B;  4G92 B;  1AOI D;  1P3M C;  3AFA D;  2JSS A;  3AZF D;  5B31 G;  3X1U B;  4H9P A;  3AV2 D;  3NQU A;  3W98 A;  4J8V C;  3WKJ B;  5AV9 C;  5B0Z D;  3B0D C;  3UTB B;  3WTP B;  2UWX A;  1S32 A;  1H3O B;  3B0C T;  3X1S C;  4Z5T D;  3KWQ D;  3TU4 D;  3MGP D;  4H9N B;  5B0Y B;  2Y2M A;  4M6B A;  4JJN D;  5B2I C;  2CV5 B;  1M1A A;  4KGC C;  3VH5 T;  5AVB D;  3AZL A;  4WU8 D;  3MGS C;  3REK D;  3VH5 A;  4XUJ D;  1BH8 A;  3X1T D;  5AVC B;  3X1S B;  2LY8 A;  3MVD D;  3UT9 D;  5BNV A;  2G5H C;  5B2J D;  1KX3 C;  5F99 A;  3C1C D;  2PYO A;  5JRG A;  4CAY B;  3MGS B;  2NQB D;  3X1V C;  5BS7 A;  1M18 C;  3A6N B;  4Z2M H;  3W97 A;  4NE5 A;  5CPJ D;  4LD9 B;  3O62 B;  4YM6 D;  3MGR D;  2BG1 A;  1HTA A;  1T3U A;  4EO5 C;  4WU9 D;  3AV1 B;  1KX3 B;  2DF4 C;  3WA9 A;  5B31 C;  4X23 B;  2RVQ C;  1M18 B;  3REL C;  3B6F C;  5B1L D;  5KDM A;  4J8W C;  1U35 C;  4KHA A;  2F8N G;  3REH A;  4J8X C;  1P3P A;  1ID3 A;  2BYM A;  1P3K D;  3AYW B;  2BYK B;  1B6W A;  5C3I B;  1KX5 A;  2FJ7 D;  1P3L A;  2Y2Q A;  4ZBJ B;  3LZ1 A;  1P3A B;  3P5J B;  1M19 A;  3EG5 B;  3W99 D;  3VH6 T;  5DNN D;  4J8W B;  1P3O D;  3WTP A;  3VH6 A;  2Y2I A;  5CP6 D;  1P3M D;  4Z66 A;  2ARO B;  3W98 C;  2CWE A;  5GT0 A;  5B0Y A;  1P3I A;  4J8V D;  3AZN B;  3AZG A;  3A1I A;  5AV9 D;  2CV5 A;  1S32 C;  4NFT A;  2ZY3 A;  3AZJ A;  1F66 D;  5DNM D;  4CSR A;  5BNX A;  3W98 B;  1M1A C;  5JA4 B;  4UUZ B;  1P3F A;  3AZE D;  1N1J A;  4KGC D;  1KX4 B;  5FUG A;  5B24 D;  3LZ0 B;  3UTA A;  4WNN A;  4XZQ A;  1A7W A;  2HIO C;  3LJA A;  3AZM A;  3AZK A;  1HQ3 C;  3O62 A;  1M1A B;  3AZL B;  5GSU C;  3B6G A;  5CHL B;  5BS7 C;  5CPI A;  3W97 C;  5B40 A;  3AFA B;  3X1V D;  5AV5 C;  5BNV B;  1P34 C;  5B32 D;  1EQZ D;  5F99 B;  4YS3 C;  2PYO B;  5B0Z B;  5JRG B;  3WTP E;  3WA9 C;  3AZI D;  3AYW A;  5B31 D;  3KUY A;  3W97 B;  3REL D;  4AWL B;  3REH C;  1U35 D;  1P3P C;  1ID3 C;  3LEL C;  5AY8 D;  4G92 C;  4J8X D;  3REK B;  1TZY A;  3WA9 B;  3REI A;  3EPH A;  4DRA A;  5GT3 A;  3MNN B;  3WKJ C;  5KDM B;  3REJ D;  3AZN A;  2NZD B;  3WAA A;  4Z2M G;  3WTP C;  4KHA B;  3C1B D;  4R8P D;  1P3P B;  1ID3 B;  4Z66 C;  1KX5 B;  2NQB B;  1P3L B;  3KFU G;  5GT0 C;  4WV4 B;  5B0Y C;  5B1M A;  1P3I C;  1ZLA D;  1P3B A;  3LZ1 B;  2CV5 C;  1M19 B;  3KXB A;  3V9R A;  5JA4 A;  4UUZ A;  3AZH D;  5G49 A;  1S32 D;  1KX4 A;  4J8U B;  3LZ0 A;  3AZJ C;  3NQJ A;  5AVC C;  4Z66 B;  5E5A D;  5BO0 B;  3FDD A;  5GT0 B;  1P3I B;  4QLC A;  4E45 A;  3AZG B;  3W96 D;  4KUD A;  4ZUX D;  5GXQ A;  3UTA C;  3AZM C;  3A6N C;  3AZJ B;  1AOI A;  5BT1 C;  1P3G D;  3AFA A;  4LD9 C;  4CSR B;  5BNX B;  3O62 C;  2HIO D;  3AZF A;  3AV2 A;  1HQ3 D;  1P3F B;  3AV1 C;  3B6G C;  1N1J B;  2F8N D;  5FUG B;  5GSU D;  5B0Z A;  4X23 C;  3UTA B;  4WNN B;  2ZY5 A;  4XZQ B;  5CP6 B;  3LJA B;  3AZM B;  4Z5T A;  3AZK B;  3KWQ A;  3TU4 A;  5AV5 D;  3MGP A;  1P34 D;  4JJN A;  3B6G B;  5AVB A;  5B33 D;  2F2A C;  4WU8 A;  4YS3 D;  1BFM A;  2VQR A;  2IO5 B;  5C3I C;  3KUY C;  3REK A;  3AYW C;  5CPI B;  4XUJ A;  5B40 B;  5AV6 D;  3H0L C;  3MGQ D;  4ZBJ C;  1F66 B;  1P3A C;  3MNN A;  5DNM B;  3X1T A;  2XD1 A;  3MVD A;  3UT9 A;  2NZD A;  2JE5 A;  5B2J A;  3AZE B;  3LEL D;  3REI C;  3C1C A;  5B24 B;  1R4V A;  2ARO C;  3KUY B;  3X1U D;  2NQB A;  1Z2C B;  4UPK A;  4E44 A;  3AZN C;  3WKJ D;  5CPJ A;  4YM6 A;  3MGR A;  3UTB D;  4J8U A;  4WU9 A;  1TAF A;  3EPJ A;  1TZY B;  3REI B;  5B1M C;  1P3B C;  2Y2N A;  4NE3 A;  5GT3 B;  5BO0 A;  3AN2 B;  1KX4 C;  3WAA B;  3LZ0 C;  2DQN C;  5AV8 B;  1P3K A;  2FJ7 A;  4H9S A;  5AVC D;  3X1S D;  5B1M B;  4QLC C;  1P3B B;  4KUD C;  3AZL C;  5GXQ C;  3KXB B;  3V9R B;  5B2I D;  1JFI A;  5G49 B;  3W99 A;  5DNN A;  1P3O A;  3MGS D;  4HGA B;  3NQJ B;  3AFA C;  3A6N D;  5CP6 A;  1P3M A;  4LD9 D;  2J8P A;  2HUE C;  4QLC B;  5F99 C;  3REJ B;  2PYO C;  4J8V A;  5B0Z C;  5JRG C;  5GXQ B;  3AV1 D;  4KUD B;  5AV9 A;  1KX3 D;  5CPK B;  4WZS B;  4X23 D;  1AOI B;  1M18 D;  3KWQ C;  4AWL C;  3TU4 C;  3MGP C;  3AZF B;  1F66 A;  5DNM A;  2G5I C;  3AV2 B;  2HUE B;  5AVB C;  4WU8 C;  3REK C;  3AZE A;  3AZH B;  4KGC A;  4XUJ C;  5B24 A;  3MNN C;  2RVQ D;  4Z5T B;  1B67 A;  3MVD C;  3KWQ B;  3UT9 C;  3TU4 B;  1P3A D;  3MGP B;  3B6F D;  2NZD C;  3R45 A;  5B2J C;  4JJN B;  4J8W D;  3C1C C;  5AVB B;  4WU8 B;  1KX5 C;  2NQB C;  1P3L C;  4XUJ B;  2ARO D;  5CPJ C;  4H9R A;  3LZ1 C;  3X1V A;  3X1T B;  1M19 C;  3AN2 A;  4YM6 C;  3MVD B;  3UT9 B;  1EQZ A;  5B32 A;  4J8U C;  5B2J B;  4WU9 C;  3C1C B;  2Y2O A;  3AZI A;  5AV8 A;  5B31 A;  2ZM5 A;  3W98 D;  3AZG C;  5CPJ B;  3REL A;  4YM6 B;  3MGR B;  1KX4 D;  2YFV B;  1U35 A;  2YFW A;  1TAF B;  5B33 B;  5AY8 A;  4WU9 B;  2FJ7 C;  2XD5 A;  4J8X A;  3MGQ B;  1P3F C;  5B1L B;  1M1A D;  3W99 C;  3AZL D;  3REJ A;  1P3O C;  3C1B A;  4R8P A;  5CPK A;  2Y2P A;  5CP6 C;  4XZQ C;  3LJA C;  1P3K B;  2FJ7 B;  3AZK C;  1ZLA A;  5F99 D;  1JFI B;  3F6T A;  2PYO D;  5CPI C;  2IO5 C;  5JRG D;  5DNN B;  3AZH A;  3W99 B;  1P3O B;  5B40 C;  4DRB A;  1F66 C;  3W97 D;  5DNM C;  1P3M B;  3KSY A;  5E5A A;  3AZE C;  4J8V B;  4H9O A;  3W96 A;  3EPK A;  5AV9 B;  5B24 C;  2Y2J A;  3B0C W;  4ZUX A;  4H9Q A;  3B0D B;  3WA9 D;  2Y2H A;  3MNN D;  1P3G A;  1W2E A;  2HIO A;  2NZD D;  3VH5 W;  1HQ3 A;  3REH D;  5B2I B;  1P3P D;  1ID3 D;  1TZY C;  2F8N A;  4KGC B;  1KX5 D;  5GSU A;  2W8S A;  1P3L D;  5GT3 C;  3AN2 C;  3LZ1 D;  1M19 D;  3WAA C;  1KU5 A;  5B32 C;  2Y2K A;  3R45 B;  1EQZ C;  5AV5 A;  1P34 A;  4J8U D;  3WTP D;  2YFV A;  3AZI C;  5B33 A;  5AV8 C;  4YS3 A;  4Z66 D;  1BH9 A;  4H9R B;  5B0Y D;  5GT0 D;  5AV6 A;  3X1V B;  3MGQ A;  1P3I D;  3KXB C;  3AZG D;  5B1L A;  2CV5 D;  1EQZ B;  5B32 B;  5AY8 C;  4HGA C;  4EO5 B;  3LEL A;  3B0B A;  4WJ3 C;  3AZI B;  3AZJ D;  3EPL A;  4DQY B;  5B31 B;  3X1U A;  3REJ C;  3REL B;  3B6F B;  1PZR A;  1P3F D;  4G91 C;  3WKJ A;  3A1K A;  3C1B C;  4R8P C;  5CPK C;  1U35 B;  3UTB A;  2YFW B;  5AY8 B;  1H3O A;  3UTA D;  3H0M C;  1AOI C;  4J8X B;  4XZQ D;  3AZM D;  3LJA D;  3AZF C;  1ZLA C;  5BT1 D;  2RIQ A;  3AZK D;  3AV2 C;  3O62 D;  4H9N A;  3VH6 W;  3AL0 C;  3AZH C;  3B6G D;  4G91 B;  5CPI D;  3C1B B;  4R8P B;  3IP4 C;  5B40 D;  4Z5T C;  5E5A C;  4H9P B;  1ZLA B;  5AVC A;  3X1S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...