3AZMB

Crystal structure of human nucleosome core particle containing h4k79q mutation
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
77
structure length
77
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRQTVTAMDVVYALKRQGRTLYGFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 25
structure length 77
sequence length 77
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3azmB00
3MVDB 2AROB 3MVDC 2AROC 3AV2A 2CV5B 1B6WA 3X1UA 1P3BD 3LZ1A 2CV5C 1ULYA 5JRGD 3LJAB 3AZKD 2NQBB 3KSYA 3W99A 3LJAC 1M19A 2NQBC 4XUJB 3X1TB 5B2IA 5B31B 1P34A 4XUJC 3MNND 3AZFB 3X1TC 5CPKA 5AY8B 3TU4A 5B31C 3AZFC 3AV1D 1M1AD 5AY8C 1S32A 3X1VB 3AZEB 3AV2B 1P3FD 3WA9A 3X1VC 3LZ1B 3AZEC 4JJNA 5B33A 5B32A 3LZ1C 4WU9D 3REKA 3LELD 1TZYD 3X1SA 5B2IB 4H9PA 3AZMA 1P34B 3AZHA 1BH8B 3A6ND 5B2IC 5DNMB 1P34C 3C1BA 5DNMC 4E44A 5AVCA 4KUDD 1TAFA 5GSUD 4JJNB 3AN2D 4YS3A 3B6FA 5B32B 4H9RB 5B2JC 1HQ3A 2F8NB 1N1JA 3WAAC 3LZ0A 3UTBD 4YM6D 4G91B 4JJNC 3REKB 3W98A 3AFAB 1F66D 3X1SB 4G91C 3AZMB 1P3IB 5B0ZD 5GT0A 3AFAC 2FJ7D 3X1SC 4H9NA 1M19D 3AZMC 1P3IC 3C1BB 4KGCA 5B0YD 5GT3A 1KX4D 4DRAA 5AVCB 3C1BC 5AV9A 3AZJA 3UTAB 4YS3B 5G49A 5AVCC 3B6FB 1HQ3B 1AOID 4YS3C 3UTAC 3W98B 3W96B 1P3MB 3MGSD 4G92B 3W96C 3W98C 2HUEB 5GT0B 4KHAB 1P3MC 4H9NB 4Z5TA 5B40A 4G92C 3AZNA 2HUEC 5GT0C 4KGCB 4WU8B 4AWLB 1KX3A 3VH6A 4CAYB 2NZDA 4ZUXA 2HIOD 4J8VA 4KGCC 4WU8C 2F8NH 3AZJB 3AZLA 1A7WA 3AZID 4H9QA 1M18B 1P3PA 1P3OD 1EQZB 1M18C 3KWQA 5CPJA 1EQZC 4Z5TB 1U35A 5AV8D 2LY8A 5B40B 3REIA 3AZNB 4Z5TC 5B40C 3AZNC 2NZDB 4J8VB 5B1MA 4J8XC 4CSRA 4J8UD 3AYWD 5CPID 2PYOD 5B1LD 3W97C 2NZDC 3WTPD 3B6GD 1P3PB 4ZBJB 5AV6D 5DNND 4LD9B 1P3PC 3KWQB 4ZBJC 5FUGA 4DRBA 3REJA 1KX5B 4LD9C 2BYMA 3KWQC 3MVDA 3REIB 1KX5C 5CHLB 2RVQD 3REIC 4Z66B 3WKJD 2CV5A 5B1MB 4Z66C 3REHD 1KX3D 3RELB 5B1MC 3MGPB 3KXBD 5KDMA 3RELC 3X1TA 3MGPC 3AZLD 5FUGB 5B32G 1P3AC 3REJB 5B31A 4R8PD 2BYMB 3AZFA 5AY8A 3REJC 4X23D 3C1CD 4NE5A 1P3BB 1P3GA 3X1VA 3AZEA 5JRGB 3AZKB 1P3BC 4H9OB 1H3OB 5JRGC 3AZKC 5KDMB 1ID3D 3VH5W 3KUYD 5BNXB 1BH8A 1M1AB 5DNMA 5AV5D 4WV4B 3B0CT 1M1AC 1P3GB 1P3FB 5B2JA 2AROD 1P3GC 1P3FC 3WAAA 1Q9CA 4WU9B 4H9RA 2F8NA 1TZYB 2L5AA 4WU9C 3LELC 3AFAA 3A6NB 1TZYC 3LJAD 2NQBD 1P3IA 3A6NC 4XUJD 4XZQA 4KUDB 5B2JB 4KUDC 3WAAB 3UTBB 3MGQA 4QLCB 3UTAA 4Z2MH 3AN2C 1HTAA 3AV2D 3UTBC 3X1UD 4QLCC 3W96A 5C3IC 5B0ZB 3LZ1D 1P3MA 5F99A 4HGAB 4WZSB 2BYKB 4WNNB 3W99D 5B0ZC 4KHAA 4HGAC 3B0DB 4XZQB 4NE3A 5JA4B 5B2ID 4WU8A 3B0DC 1P34D 5CPKD 4CAYA 3UT9B 4XZQC 3TU4D 5DNMD 3MGQB 3UT9C 1S32D 3NQUB 1M18A 3VH5T 3MGSB 3MGQC 1EQZA 1AOIC 5GXQB 3AZGA 3WA9D 5F99B 3MGSC 4JJND 3NQJB 5B33D 5B32D 3WTPE 5GXQC 5F99C 3MGRB 3REKD 5BO0B 3X1SD 4J8WA 3MGRC 1WWIA 3O62A 4J8XA 3AZMD 3AZHD 3W97A 5BT1D 3C1BD 5AVCD 3AZGB 4LD9A 4YS3D 3B6FD 1HQ3D 3AZGC 3LZ0D 1KX5A 1P3LB 4Z2MG 5E5AB 3W98D 3W96D 5AVBA 1P3LC 4J8WB 4H9SC 5B31G 3O62B 4J8XB 5E5AC 4Z66A 5GT0D 5CPIB 3W97B 4J8WC 3B6GB 3O62C 4UUZA 4KGCD 5CPIC 5AV6B 5B1LC 5GT3D 5DNNB 3RELA 3B6GC 3MGPA 3V9RB 1P3AA 5AV6C 5AV9D 1JFIB 5DNNC 1ZLAA 3AZJD 1P3KB 1BFMA 1P3KC 1BH9A 5AVBB 2F8NK 3WKJB 1P3BA 5AVBC 5CP6B 3WKJC 5JRGA 4Z5TD 3AZKA 5B40D 4H9OA 5B24B 4UUZB 3AZND 3KXBB 1H3OA 5CP6C 5B24C 2NZDD 4ZUXD 4J8VD 3KXBC 1P3AB 4R8PB 1ZLAB 3MNNA 2F8NG 1P3PD 4R8PC 1ZLAC 3C1CB 5BNXA 1M1AA 1BH9B 3KWQD 5CPJD 3C1CC 1KX5D 1P3FA 1U35D 3REID 2YFVB 4WU9A 3LELA 1TZYA 5B1MD 3MNNB 3A6NA 3MGPD 3AV1B 3MNNC 1KU5A 5AV5C 3AV1C 3REJD 4KUDA 5GSUA 3MVDD 3AN2A 3UTBA 3R45B 4QLCA 4YM6A 3LELB 2CV5D 1F66A 5B0ZA 2FJ7A 3VH6W 2BYKA 4WNNA 5B0YA 3X1TD 1KX4A 5JA4A 5B31D 3AZFD 5GSUB 4EO5B 3UT9A 5AY8D 3AN2B 3X1UB 5GSUC 4YM6B 4EO5C 5C3IB 1AOIA 1P3GD 3X1VD 3NQUA 3AZED 1F66B 3MGSA 3AV2C 3X1UC 4YM6C 5GXQA 3W99B 1F66C 2FJ7B 3NQJA 1M19B 3W99C 2FJ7C 5B0YB 3MGRA 1M19C 5CPKB 1KX4B 5BO0A 2HIOA 3TU4B 5B0YC 5CPKC 1KX4C 3AZIA 1S32B 3TU4C 1P3OA 2JSSA 1AOIB 1F1EA 1S32C 3WA9B 5B33B 5B2JD 3WAAD 3WA9C 4QLCD 5B33C 5B32C 5AV8A 5BNVA 2F8ND 1P3LA 4H9PB 4H9SA 3REKC 5E5AA 3AFAD 3AZHB 1B67A 2HIOB 1P3ID 3AZHC 4J8UA 3AYWA 3AZIB 5BS7A 2HIOC 5B1LA 5CPIA 2PYOA 3VH5A 3WTPA 3B6GA 1P3OB 5BT1C 4XZQD 3AZIC 5AV6A 5DNNA 1TAFB 1P3OC 3UT9D 3V9RA 3VH6T 1JFIA 1N1JB 3LZ0B 3MGQD 3UTAD 1P3KA 3B6FC 5AV8B 4M6BA 5BNVB 1HQ3C 3LZ0C 5GXQD 5AV8C 1P3MD 5F99D 3WKJA 4J8UB 3AYWB 2PYOB 5CP6A 5B1LB 3MGRD 5GT3B 3REHA 3WTPB 5B24A 3KXBA 4J8UC 3AYWC 4WU8D 5BS7C 2PYOC 5AV9B 5GT3C 4AWLC 3WTPC 5G49B 4NFTA 5AV9C 4R8PA 3AZJC 1M18D 4X23A 1EQZD 3C1CA 3AZGD 2YFWA 2IO5B 2RVQC 2IO5C 1P3LD 3REHB 5E5AD 1KX3B 2YFVA 4NE6A 4ZUXB 4J8WD 3B0CW 3O62D 4J8XD 3REHC 1KX3C 1ID3A 3AZLB 4ZUXC 4J8VC 3W97D 4H9QB 3KUYA 3AZLC 4E45A 1WWSA 5AV5A 4X23B 5CPJB 3AV1A 2YFWB 4LD9D 4X23C 5CPJC 1U35B 1P3KD 2AROA 2CWEA 3B0BA 1U35C 5AVBD 3R45A 4Z66D 4CSRB 1ID3B 5CP6D 1R4VA 3LJAA 2NQBA 5B24D 3KUYB 1ID3C 3RELD 5AV5B 4XUJA 3KUYC 1P3AD 1ZLAD
chains in the Genus database with same CATH superfamily
3MVDB 2F2AC 2AROB 1PZRA 3MVDC 2AROC 3AV2A 2CV5B 1B6WA 3X1UA 1P3BD 3LZ1A 2CV5C 1ULYA 5JRGD 3LJAB 1Z2CB 3AZKD 2NQBB 3KSYA 3W99A 3LJAC 1M19A 2NQBC 4XUJB 3X1TB 5B2IA 5B31B 1P34A 4XUJC 3MNND 3AZFB 3X1TC 5CPKA 5AY8B 3TU4A 5B31C 3AZFC 3AV1D 1M1AD 5AY8C 1S32A 3X1VB 3AZEB 3AV2B 2Y2KA 1P3FD 3WA9A 3X1VC 3LZ1B 3AZEC 4JJNA 5B33A 5B32A 3LZ1C 4WU9D 3REKA 3LELD 1TZYD 3X1SA 5B2IB 4H9PA 1W2EA 3AZMA 1P34B 3AZHA 1BH8B 3A6ND 5B2IC 5DNMB 3KFUG 1P34C 3C1BA 5DNMC 2RIQA 2XD1A 4E44A 5AVCA 4KUDD 1TAFA 5GSUD 4JJNB 3AN2D 4YS3A 3B6FA 5B32B 4H9RB 5B2JC 1HQ3A 2F8NB 1N1JA 3WAAC 3LZ0A 3UTBD 4YM6D 4G91B 4JJNC 3REKB 3W98A 3AFAB 1F66D 3X1SB 4G91C 3AZMB 1P3IB 5B0ZD 5GT0A 3AFAC 2FJ7D 3X1SC 4H9NA 1M19D 3AZMC 1P3IC 3C1BB 4KGCA 5B0YD 5GT3A 1KX4D 4DRAA 5AVCB 3C1BC 2Y2PA 5AV9A 2BG1A 3AZJA 3UTAB 3H0RC 5G49A 5AVCC 4YS3B 3B6FB 1HQ3B 1AOID 4YS3C 3UTAC 3W98B 3W96B 1P3MB 3MGSD 4G92B 3W96C 3W98C 2HUEB 5GT0B 4KHAB 1P3MC 4H9NB 4Z5TA 5B40A 4G92C 3AZNA 2HUEC 5GT0C 4KGCB 4WU8B 4AWLB 1KX3A 3VH6A 4CAYB 2NZDA 4ZUXA 2HIOD 4J8VA 4KGCC 4WU8C 2F8NH 2DF4C 3AZJB 3AZLA 1A7WA 3AZID 4H9QA 1M18B 1P3PA 1P3OD 1EQZB 1M18C 3KWQA 5CPJA 1EQZC 2JCHA 4Z5TB 1U35A 5AV8D 2LY8A 5B40B 3REIA 3AZNB 3H0MC 4Z5TC 5B40C 3AZNC 2NZDB 4J8VB 3F6TA 5B1MA 4J8XC 4CSRA 1T3UA 4J8UD 3AYWD 5CPID 5B1LD 2PYOD 3W97C 2NZDC 3A1IA 3WTPD 1P3PB 3B6GD 4ZBJB 5AV6D 5DNND 4LD9B 1P3PC 3KWQB 4ZBJC 5FUGA 4DRBA 3REJA 1KX5B 4LD9C 2BYMA 3KWQC 3MVDA 3REIB 2J8PA 1KX5C 5CHLB 2RVQD 3REIC 4Z66B 4WJ3C 3WKJD 2CV5A 5B1MB 4Z66C 3REHD 1KX3D 3RELB 5B1MC 3MGPB 3KXBD 5KDMA 2VQRA 3RELC 2XD5A 3X1TA 3MGPC 3AZLD 5FUGB 5B32G 1P3AC 3REJB 5B31A 4R8PD 2BYMB 3AZFA 5AY8A 3REJC 4X23D 3C1CD 2FFFB 4NE5A 1P3BB 1P3GA 3X1VA 3AZEA 5JRGB 3AZKB 1P3BC 4H9OB 1H3OB 5JRGC 3AZKC 5KDMB 3EPHA 1ID3D 3VH5W 3KUYD 5BNXB 1BH8A 1M1AB 5DNMA 5AV5D 4WV4B 2G5HC 3B0CT 2G5IC 1M1AC 1P3GB 1P3FB 5B2JA 2DQNC 2AROD 1P3GC 1P3FC 3WAAA 4DQYB 1Q9CA 4WU9B 4H9RA 2F8NA 1TZYB 2L5AA 4WU9C 3LELC 3AFAA 3A6NB 1TZYC 3LJAD 2NQBD 1P3IA 2Y2MA 3A6NC 4XUJD 4XZQA 4KUDB 5B2JB 4KUDC 3WAAB 3UTBB 3MGQA 4QLCB 3UTAA 4Z2MH 3AN2C 1HTAA 3AV2D 3UTBC 3X1UD 4QLCC 3W96A 5C3IC 5B0ZB 3LZ1D 1P3MA 5F99A 4HGAB 4WZSB 2BYKB 4WNNB 3W99D 5B0ZC 4KHAA 4HGAC 3B0DB 4XZQB 4NE3A 5JA4B 5B2ID 4WU8A 3B0DC 1P34D 5CPKD 4CAYA 3UT9B 4XZQC 3TU4D 5DNMD 3MGQB 3UT9C 1S32D 3NQUB 1M18A 3A1KA 3VH5T 3MGSB 3MGQC 1EQZA 1AOIC 5GXQB 3AZGA 3WA9D 2Y2IA 5F99B 3MGSC 4JJND 3NQJB 5B33D 5B32D 5GXQC 3WTPE 5F99C 3MGRB 3REKD 5BO0B 3X1SD 4J8WA 3MGRC 1WWIA 3O62A 4J8XA 3AZMD 3AZHD 3W97A 5BT1D 3C1BD 2ZM5A 5AVCD 3AZGB 4LD9A 4YS3D 3B6FD 1HQ3D 3AZGC 3LZ0D 1KX5A 1P3LB 4Z2MG 5E5AB 3W98D 3W96D 5AVBA 1P3LC 4J8WB 4H9SC 5B31G 3O62B 4J8XB 5E5AC 4Z66A 5GT0D 5CPIB 3W97B 4J8WC 3B6GB 3O62C 4UUZA 4KGCD 5CPIC 5AV6B 5B1LC 5GT3D 5DNNB 3AL0C 3RELA 3B6GC 3MGPA 3V9RB 1P3AA 2Y2HA 2ZY4A 5AV6C 5AV9D 5DNNC 1JFIB 1ZLAA 3AZJD 1P3KB 1BFMA 1P3KC 1BH9A 5AVBB 2F8NK 3WKJB 1P3BA 5AVBC 5CP6B 3WKJC 5JRGA 4Z5TD 3AZKA 5B40D 4H9OA 5B24B 4UUZB 3AZND 3KXBB 1H3OA 5CP6C 3EPKA 2Y2GA 5B24C 2NZDD 4ZUXD 4J8VD 3KXBC 1P3AB 4R8PB 1ZLAB 3MNNA 2F8NG 1P3PD 4R8PC 1ZLAC 3C1CB 5BNXA 1M1AA 1BH9B 3KWQD 5CPJD 3C1CC 1KX5D 1P3FA 1U35D 3REID 2YFVB 4WU9A 3LELA 1TZYA 5B1MD 3MNNB 3A6NA 3MGPD 3AV1B 3MNNC 1KU5A 3H0LC 5AV5C 3AV1C 3REJD 4KUDA 5GSUA 3MVDD 2Y2QA 3AN2A 3UTBA 3R45B 4QLCA 4YM6A 3LELB 2CV5D 1F66A 5B0ZA 2FJ7A 3VH6W 2BYKA 4WNNA 5B0YA 3X1TD 1KX4A 5JA4A 5B31D 3AZFD 5GSUB 4EO5B 3UT9A 5AY8D 3AN2B 5GSUC 3X1UB 4YM6B 4EO5C 5C3IB 4UPKA 1AOIA 1P3GD 3X1VD 3NQUA 3AZED 1F66B 3MGSA 3AV2C 3X1UC 4YM6C 5GXQA 3W99B 3IP4C 1F66C 2FJ7B 3NQJA 1M19B 3W99C 3EPJA 2FJ7C 5B0YB 3MGRA 1M19C 5CPKB 1KX4B 5BO0A 2HIOA 3TU4B 5B0YC 5CPKC 1KX4C 3AZIA 1S32B 3TU4C 3P5JB 1P3OA 2JSSA 1AOIB 1F1EA 1S32C 3WA9B 5B33B 5B2JD 3WAAD 3WA9C 4QLCD 5B33C 5B32C 5AV8A 5BNVA 2F8ND 1P3LA 4H9PB 4H9SA 3REKC 5E5AA 3AFAD 3AZHB 1B67A 2HIOB 1P3ID 3AZHC 4J8UA 3AYWA 3AZIB 5BS7A 2HIOC 5B1LA 5CPIA 2PYOA 3VH5A 3WTPA 3B6GA 1P3OB 5BT1C 4XZQD 3AZIC 5AV6A 3EG5B 5DNNA 1TAFB 1P3OC 3UT9D 3V9RA 3VH6T 1JFIA 1N1JB 3LZ0B 3MGQD 3UTAD 1P3KA 3B6FC 5AV8B 4M6BA 5BNVB 1HQ3C 3LZ0C 2Y2OA 5GXQD 5AV8C 1P3MD 5F99D 2Y2JA 3WKJA 4J8UB 3AYWB 2PYOB 5CP6A 5B1LB 3MGRD 5GT3B 3REHA 3WTPB 2ZY2A 5B24A 3KXBA 4J8UC 3AYWC 4WU8D 5BS7C 2PYOC 5AV9B 5GT3C 4AWLC 3WTPC 5G49B 4NFTA 5AV9C 4R8PA 3AZJC 3EPLA 1M18D 4X23A 1EQZD 3C1CA 3AZGD 2YFWA 2IO5B 2RVQC 2IO5C 1P3LD 2JE5A 5E5AD 3REHB 1KX3B 2YFVA 4NE6A 4ZUXB 2ZY5A 4J8WD 3B0CW 3O62D 4J8XD 3REHC 1KX3C 1ID3A 3AZLB 4ZUXC 4J8VC 3W97D 4H9QB 3KUYA 2ZY3A 3AZLC 4E45A 1WWSA 5AV5A 4X23B 5CPJB 3AV1A 2Y2LA 2YFWB 4LD9D 2UWXA 4X23C 5CPJC 1U35B 1P3KD 2Y2NA 2AROA 2CWEA 3B0BA 1U35C 5AVBD 3R45A 2W8SA 3FDDA 4Z66D 4CSRB 1ID3B 5CP6D 1R4VA 3LJAA 2NQBA 5B24D 3KUYB 1ID3C 3RELD 5AV5B 4XUJA 3KUYC 1P3AD 1ZLAD
chains in the Genus database with same CATH topology
3MVDB 2F2AC 2AROB 1PZRA 3MVDC 2AROC 3AV2A 2CV5B 1B6WA 3X1UA 1P3BD 3LZ1A 2CV5C 1ULYA 5JRGD 3LJAB 1Z2CB 3AZKD 2NQBB 3KSYA 3W99A 3LJAC 1M19A 2NQBC 4XUJB 3X1TB 5B2IA 5B31B 1P34A 4XUJC 3MNND 3AZFB 3X1TC 5CPKA 5AY8B 3TU4A 5B31C 3AZFC 3AV1D 1M1AD 5AY8C 1S32A 3X1VB 3AZEB 3AV2B 2Y2KA 1P3FD 3WA9A 3X1VC 3LZ1B 3AZEC 4JJNA 5B33A 5B32A 3LZ1C 4WU9D 3REKA 3LELD 1TZYD 3X1SA 5B2IB 4H9PA 1W2EA 3AZMA 1P34B 3AZHA 1BH8B 3A6ND 5B2IC 5DNMB 3KFUG 1P34C 3C1BA 5DNMC 2RIQA 2XD1A 4E44A 5AVCA 4KUDD 1TAFA 5GSUD 4JJNB 3AN2D 4YS3A 3B6FA 5B32B 4H9RB 5B2JC 1HQ3A 2F8NB 1N1JA 3WAAC 3LZ0A 3UTBD 4YM6D 4G91B 4JJNC 3REKB 3W98A 3AFAB 1F66D 3X1SB 4G91C 3AZMB 1P3IB 5B0ZD 5GT0A 3AFAC 2FJ7D 3X1SC 4H9NA 1M19D 3AZMC 1P3IC 3C1BB 4KGCA 5B0YD 5GT3A 1KX4D 4DRAA 5AVCB 3C1BC 2Y2PA 5AV9A 2BG1A 3AZJA 3UTAB 3H0RC 5G49A 5AVCC 4YS3B 3B6FB 1HQ3B 1AOID 4YS3C 3UTAC 3W98B 3W96B 1P3MB 3MGSD 4G92B 3W96C 3W98C 2HUEB 5GT0B 4KHAB 1P3MC 4H9NB 4Z5TA 5B40A 4G92C 3AZNA 2HUEC 5GT0C 4KGCB 4WU8B 4AWLB 1KX3A 3VH6A 4CAYB 2NZDA 4ZUXA 2HIOD 4J8VA 4KGCC 4WU8C 2F8NH 2DF4C 3AZJB 3AZLA 1A7WA 3AZID 4H9QA 1M18B 1P3PA 1P3OD 1EQZB 1M18C 3KWQA 5CPJA 1EQZC 2JCHA 4Z5TB 1U35A 5AV8D 2LY8A 5B40B 3REIA 3AZNB 3H0MC 4Z5TC 5B40C 3AZNC 2NZDB 4J8VB 3F6TA 5B1MA 4J8XC 4CSRA 1T3UA 4J8UD 3AYWD 5CPID 5B1LD 2PYOD 3W97C 2NZDC 3A1IA 3WTPD 1P3PB 3B6GD 4ZBJB 5AV6D 5DNND 4LD9B 1P3PC 3KWQB 4ZBJC 5FUGA 4DRBA 3REJA 1KX5B 4LD9C 2BYMA 3KWQC 3MVDA 3REIB 2J8PA 1KX5C 5CHLB 2RVQD 3REIC 4Z66B 4WJ3C 3WKJD 2CV5A 5B1MB 4Z66C 3REHD 1KX3D 3RELB 5B1MC 3MGPB 3KXBD 5KDMA 2VQRA 3RELC 2XD5A 3X1TA 3MGPC 3AZLD 5FUGB 5B32G 1P3AC 3REJB 5B31A 4R8PD 2BYMB 3AZFA 5AY8A 3REJC 4X23D 3C1CD 2FFFB 4NE5A 1P3BB 1P3GA 3X1VA 3AZEA 5JRGB 3AZKB 1P3BC 4H9OB 1H3OB 5JRGC 3AZKC 5KDMB 3EPHA 1ID3D 3VH5W 3KUYD 5BNXB 1BH8A 1M1AB 5DNMA 5AV5D 4WV4B 2G5HC 3B0CT 2G5IC 1M1AC 1P3GB 1P3FB 5B2JA 2DQNC 2AROD 1P3GC 1P3FC 3WAAA 4DQYB 1Q9CA 4WU9B 4H9RA 2F8NA 1TZYB 2L5AA 4WU9C 3LELC 3AFAA 3A6NB 1TZYC 3LJAD 2NQBD 1P3IA 2Y2MA 3A6NC 4XUJD 4XZQA 4KUDB 5B2JB 4KUDC 3WAAB 3UTBB 3MGQA 4QLCB 3UTAA 4Z2MH 3AN2C 1HTAA 3AV2D 3UTBC 3X1UD 4QLCC 3W96A 5C3IC 5B0ZB 3LZ1D 1P3MA 5F99A 4HGAB 4WZSB 2BYKB 4WNNB 3W99D 5B0ZC 4KHAA 4HGAC 3B0DB 4XZQB 4NE3A 5JA4B 5B2ID 4WU8A 3B0DC 1P34D 5CPKD 4CAYA 3UT9B 4XZQC 3TU4D 5DNMD 3MGQB 3UT9C 1S32D 3NQUB 1M18A 3A1KA 3VH5T 3MGSB 3MGQC 1EQZA 1AOIC 5GXQB 3AZGA 3WA9D 2Y2IA 5F99B 3MGSC 4JJND 3NQJB 5B33D 5B32D 5GXQC 3WTPE 5F99C 3MGRB 3REKD 5BO0B 3X1SD 4J8WA 3MGRC 1WWIA 3O62A 4J8XA 3AZMD 3AZHD 3W97A 5BT1D 3C1BD 2ZM5A 5AVCD 3AZGB 4LD9A 4YS3D 3B6FD 1HQ3D 3AZGC 3LZ0D 1KX5A 1P3LB 4Z2MG 5E5AB 3W98D 3W96D 5AVBA 1P3LC 4J8WB 4H9SC 5B31G 3O62B 4J8XB 5E5AC 4Z66A 5GT0D 5CPIB 3W97B 4J8WC 3B6GB 3O62C 4UUZA 4KGCD 5CPIC 5AV6B 5B1LC 5GT3D 5DNNB 3AL0C 3RELA 3B6GC 3MGPA 3V9RB 1P3AA 2Y2HA 2ZY4A 5AV6C 5AV9D 5DNNC 1JFIB 1ZLAA 3AZJD 1P3KB 1BFMA 1P3KC 1BH9A 5AVBB 2F8NK 3WKJB 1P3BA 5AVBC 5CP6B 3WKJC 5JRGA 4Z5TD 3AZKA 5B40D 4H9OA 5B24B 4UUZB 3AZND 3KXBB 1H3OA 5CP6C 3EPKA 2Y2GA 5B24C 2NZDD 4ZUXD 4J8VD 3KXBC 1P3AB 4R8PB 1ZLAB 3MNNA 2F8NG 1P3PD 4R8PC 1ZLAC 3C1CB 5BNXA 1M1AA 1BH9B 3KWQD 5CPJD 3C1CC 1KX5D 1P3FA 1U35D 3REID 2YFVB 4WU9A 3LELA 1TZYA 5B1MD 3MNNB 3A6NA 3MGPD 3AV1B 3MNNC 1KU5A 3H0LC 5AV5C 3AV1C 3REJD 4KUDA 5GSUA 3MVDD 2Y2QA 3AN2A 3UTBA 3R45B 4QLCA 4YM6A 3LELB 2CV5D 1F66A 5B0ZA 2FJ7A 3VH6W 2BYKA 4WNNA 5B0YA 3X1TD 1KX4A 5JA4A 5B31D 3AZFD 5GSUB 4EO5B 3UT9A 5AY8D 3AN2B 5GSUC 3X1UB 4YM6B 4EO5C 5C3IB 4UPKA 1AOIA 1P3GD 3X1VD 3NQUA 3AZED 1F66B 3MGSA 3AV2C 3X1UC 4YM6C 5GXQA 3W99B 3IP4C 1F66C 2FJ7B 3NQJA 1M19B 3W99C 3EPJA 2FJ7C 5B0YB 3MGRA 1M19C 5CPKB 1KX4B 5BO0A 2HIOA 3TU4B 5B0YC 5CPKC 1KX4C 3AZIA 1S32B 3TU4C 3P5JB 1P3OA 2JSSA 1AOIB 1F1EA 1S32C 3WA9B 5B33B 5B2JD 3WAAD 3WA9C 4QLCD 5B33C 5B32C 5AV8A 5BNVA 2F8ND 1P3LA 4H9PB 4H9SA 3REKC 5E5AA 3AFAD 3AZHB 1B67A 2HIOB 1P3ID 3AZHC 4J8UA 3AYWA 3AZIB 5BS7A 2HIOC 5B1LA 5CPIA 2PYOA 3VH5A 3WTPA 3B6GA 1P3OB 5BT1C 4XZQD 3AZIC 5AV6A 3EG5B 5DNNA 1TAFB 1P3OC 3UT9D 3V9RA 3VH6T 1JFIA 1N1JB 3LZ0B 3MGQD 3UTAD 1P3KA 3B6FC 5AV8B 4M6BA 5BNVB 1HQ3C 3LZ0C 2Y2OA 5GXQD 5AV8C 1P3MD 5F99D 2Y2JA 3WKJA 4J8UB 3AYWB 2PYOB 5CP6A 5B1LB 3MGRD 5GT3B 3REHA 3WTPB 2ZY2A 5B24A 3KXBA 4J8UC 3AYWC 4WU8D 5BS7C 2PYOC 5AV9B 5GT3C 4AWLC 3WTPC 5G49B 4NFTA 5AV9C 4R8PA 3AZJC 3EPLA 1M18D 4X23A 1EQZD 3C1CA 3AZGD 2YFWA 2IO5B 2RVQC 2IO5C 1P3LD 2JE5A 5E5AD 3REHB 1KX3B 2YFVA 4NE6A 4ZUXB 2ZY5A 4J8WD 3B0CW 3O62D 4J8XD 3REHC 1KX3C 1ID3A 3AZLB 4ZUXC 4J8VC 3W97D 4H9QB 3KUYA 2ZY3A 3AZLC 4E45A 1WWSA 5AV5A 4X23B 5CPJB 3AV1A 2Y2LA 2YFWB 4LD9D 2UWXA 4X23C 5CPJC 1U35B 1P3KD 2Y2NA 2AROA 2CWEA 3B0BA 1U35C 5AVBD 3R45A 2W8SA 3FDDA 4Z66D 4CSRB 1ID3B 5CP6D 1R4VA 3LJAA 2NQBA 5B24D 3KUYB 1ID3C 3RELD 5AV5B 4XUJA 3KUYC 1P3AD 1ZLAD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MVD B;  2ARO B;  3MVD C;  2ARO C;  3AV2 A;  2CV5 B;  1B6W A;  3X1U A;  1P3B D;  3LZ1 A;  2CV5 C;  1ULY A;  5JRG D;  3LJA B;  3AZK D;  2NQB B;  3KSY A;  3W99 A;  3LJA C;  1M19 A;  2NQB C;  4XUJ B;  3X1T B;  5B2I A;  5B31 B;  1P34 A;  4XUJ C;  3MNN D;  3AZF B;  3X1T C;  5CPK A;  5AY8 B;  3TU4 A;  5B31 C;  3AZF C;  3AV1 D;  1M1A D;  5AY8 C;  1S32 A;  3X1V B;  3AZE B;  3AV2 B;  1P3F D;  3WA9 A;  3X1V C;  3LZ1 B;  3AZE C;  4JJN A;  5B33 A;  5B32 A;  3LZ1 C;  4WU9 D;  3REK A;  3LEL D;  1TZY D;  3X1S A;  5B2I B;  4H9P A;  3AZM A;  1P34 B;  3AZH A;  1BH8 B;  3A6N D;  5B2I C;  5DNM B;  1P34 C;  3C1B A;  5DNM C;  4E44 A;  5AVC A;  4KUD D;  1TAF A;  5GSU D;  4JJN B;  3AN2 D;  4YS3 A;  3B6F A;  5B32 B;  4H9R B;  5B2J C;  1HQ3 A;  2F8N B;  1N1J A;  3WAA C;  3LZ0 A;  3UTB D;  4YM6 D;  4G91 B;  4JJN C;  3REK B;  3W98 A;  3AFA B;  1F66 D;  3X1S B;  4G91 C;  3AZM B;  1P3I B;  5B0Z D;  5GT0 A;  3AFA C;  2FJ7 D;  3X1S C;  4H9N A;  1M19 D;  3AZM C;  1P3I C;  3C1B B;  4KGC A;  5B0Y D;  5GT3 A;  1KX4 D;  4DRA A;  5AVC B;  3C1B C;  5AV9 A;  3AZJ A;  3UTA B;  4YS3 B;  5G49 A;  5AVC C;  3B6F B;  1HQ3 B;  1AOI D;  4YS3 C;  3UTA C;  3W98 B;  3W96 B;  1P3M B;  3MGS D;  4G92 B;  3W96 C;  3W98 C;  2HUE B;  5GT0 B;  4KHA B;  1P3M C;  4H9N B;  4Z5T A;  5B40 A;  4G92 C;  3AZN A;  2HUE C;  5GT0 C;  4KGC B;  4WU8 B;  4AWL B;  1KX3 A;  3VH6 A;  4CAY B;  2NZD A;  4ZUX A;  2HIO D;  4J8V A;  4KGC C;  4WU8 C;  2F8N H;  3AZJ B;  3AZL A;  1A7W A;  3AZI D;  4H9Q A;  1M18 B;  1P3P A;  1P3O D;  1EQZ B;  1M18 C;  3KWQ A;  5CPJ A;  1EQZ C;  4Z5T B;  1U35 A;  5AV8 D;  2LY8 A;  5B40 B;  3REI A;  3AZN B;  4Z5T C;  5B40 C;  3AZN C;  2NZD B;  4J8V B;  5B1M A;  4J8X C;  4CSR A;  4J8U D;  3AYW D;  5CPI D;  2PYO D;  5B1L D;  3W97 C;  2NZD C;  3WTP D;  3B6G D;  1P3P B;  4ZBJ B;  5AV6 D;  5DNN D;  4LD9 B;  1P3P C;  3KWQ B;  4ZBJ C;  5FUG A;  4DRB A;  3REJ A;  1KX5 B;  4LD9 C;  2BYM A;  3KWQ C;  3MVD A;  3REI B;  1KX5 C;  5CHL B;  2RVQ D;  3REI C;  4Z66 B;  3WKJ D;  2CV5 A;  5B1M B;  4Z66 C;  3REH D;  1KX3 D;  3REL B;  5B1M C;  3MGP B;  3KXB D;  5KDM A;  3REL C;  3X1T A;  3MGP C;  3AZL D;  5FUG B;  5B32 G;  1P3A C;  3REJ B;  5B31 A;  4R8P D;  2BYM B;  3AZF A;  5AY8 A;  3REJ C;  4X23 D;  3C1C D;  4NE5 A;  1P3B B;  1P3G A;  3X1V A;  3AZE A;  5JRG B;  3AZK B;  1P3B C;  4H9O B;  1H3O B;  5JRG C;  3AZK C;  5KDM B;  1ID3 D;  3VH5 W;  3KUY D;  5BNX B;  1BH8 A;  1M1A B;  5DNM A;  5AV5 D;  4WV4 B;  3B0C T;  1M1A C;  1P3G B;  1P3F B;  5B2J A;  2ARO D;  1P3G C;  1P3F C;  3WAA A;  1Q9C A;  4WU9 B;  4H9R A;  2F8N A;  1TZY B;  2L5A A;  4WU9 C;  3LEL C;  3AFA A;  3A6N B;  1TZY C;  3LJA D;  2NQB D;  1P3I A;  3A6N C;  4XUJ D;  4XZQ A;  4KUD B;  5B2J B;  4KUD C;  3WAA B;  3UTB B;  3MGQ A;  4QLC B;  3UTA A;  4Z2M H;  3AN2 C;  1HTA A;  3AV2 D;  3UTB C;  3X1U D;  4QLC C;  3W96 A;  5C3I C;  5B0Z B;  3LZ1 D;  1P3M A;  5F99 A;  4HGA B;  4WZS B;  2BYK B;  4WNN B;  3W99 D;  5B0Z C;  4KHA A;  4HGA C;  3B0D B;  4XZQ B;  4NE3 A;  5JA4 B;  5B2I D;  4WU8 A;  3B0D C;  1P34 D;  5CPK D;  4CAY A;  3UT9 B;  4XZQ C;  3TU4 D;  5DNM D;  3MGQ B;  3UT9 C;  1S32 D;  3NQU B;  1M18 A;  3VH5 T;  3MGS B;  3MGQ C;  1EQZ A;  1AOI C;  5GXQ B;  3AZG A;  3WA9 D;  5F99 B;  3MGS C;  4JJN D;  3NQJ B;  5B33 D;  5B32 D;  3WTP E;  5GXQ C;  5F99 C;  3MGR B;  3REK D;  5BO0 B;  3X1S D;  4J8W A;  3MGR C;  1WWI A;  3O62 A;  4J8X A;  3AZM D;  3AZH D;  3W97 A;  5BT1 D;  3C1B D;  5AVC D;  3AZG B;  4LD9 A;  4YS3 D;  3B6F D;  1HQ3 D;  3AZG C;  3LZ0 D;  1KX5 A;  1P3L B;  4Z2M G;  5E5A B;  3W98 D;  3W96 D;  5AVB A;  1P3L C;  4J8W B;  4H9S C;  5B31 G;  3O62 B;  4J8X B;  5E5A C;  4Z66 A;  5GT0 D;  5CPI B;  3W97 B;  4J8W C;  3B6G B;  3O62 C;  4UUZ A;  4KGC D;  5CPI C;  5AV6 B;  5B1L C;  5GT3 D;  5DNN B;  3REL A;  3B6G C;  3MGP A;  3V9R B;  1P3A A;  5AV6 C;  5AV9 D;  1JFI B;  5DNN C;  1ZLA A;  3AZJ D;  1P3K B;  1BFM A;  1P3K C;  1BH9 A;  5AVB B;  2F8N K;  3WKJ B;  1P3B A;  5AVB C;  5CP6 B;  3WKJ C;  5JRG A;  4Z5T D;  3AZK A;  5B40 D;  4H9O A;  5B24 B;  4UUZ B;  3AZN D;  3KXB B;  1H3O A;  5CP6 C;  5B24 C;  2NZD D;  4ZUX D;  4J8V D;  3KXB C;  1P3A B;  4R8P B;  1ZLA B;  3MNN A;  2F8N G;  1P3P D;  4R8P C;  1ZLA C;  3C1C B;  5BNX A;  1M1A A;  1BH9 B;  3KWQ D;  5CPJ D;  3C1C C;  1KX5 D;  1P3F A;  1U35 D;  3REI D;  2YFV B;  4WU9 A;  3LEL A;  1TZY A;  5B1M D;  3MNN B;  3A6N A;  3MGP D;  3AV1 B;  3MNN C;  1KU5 A;  5AV5 C;  3AV1 C;  3REJ D;  4KUD A;  5GSU A;  3MVD D;  3AN2 A;  3UTB A;  3R45 B;  4QLC A;  4YM6 A;  3LEL B;  2CV5 D;  1F66 A;  5B0Z A;  2FJ7 A;  3VH6 W;  2BYK A;  4WNN A;  5B0Y A;  3X1T D;  1KX4 A;  5JA4 A;  5B31 D;  3AZF D;  5GSU B;  4EO5 B;  3UT9 A;  5AY8 D;  3AN2 B;  3X1U B;  5GSU C;  4YM6 B;  4EO5 C;  5C3I B;  1AOI A;  1P3G D;  3X1V D;  3NQU A;  3AZE D;  1F66 B;  3MGS A;  3AV2 C;  3X1U C;  4YM6 C;  5GXQ A;  3W99 B;  1F66 C;  2FJ7 B;  3NQJ A;  1M19 B;  3W99 C;  2FJ7 C;  5B0Y B;  3MGR A;  1M19 C;  5CPK B;  1KX4 B;  5BO0 A;  2HIO A;  3TU4 B;  5B0Y C;  5CPK C;  1KX4 C;  3AZI A;  1S32 B;  3TU4 C;  1P3O A;  2JSS A;  1AOI B;  1F1E A;  1S32 C;  3WA9 B;  5B33 B;  5B2J D;  3WAA D;  3WA9 C;  4QLC D;  5B33 C;  5B32 C;  5AV8 A;  5BNV A;  2F8N D;  1P3L A;  4H9P B;  4H9S A;  3REK C;  5E5A A;  3AFA D;  3AZH B;  1B67 A;  2HIO B;  1P3I D;  3AZH C;  4J8U A;  3AYW A;  3AZI B;  5BS7 A;  2HIO C;  5B1L A;  5CPI A;  2PYO A;  3VH5 A;  3WTP A;  3B6G A;  1P3O B;  5BT1 C;  4XZQ D;  3AZI C;  5AV6 A;  5DNN A;  1TAF B;  1P3O C;  3UT9 D;  3V9R A;  3VH6 T;  1JFI A;  1N1J B;  3LZ0 B;  3MGQ D;  3UTA D;  1P3K A;  3B6F C;  5AV8 B;  4M6B A;  5BNV B;  1HQ3 C;  3LZ0 C;  5GXQ D;  5AV8 C;  1P3M D;  5F99 D;  3WKJ A;  4J8U B;  3AYW B;  2PYO B;  5CP6 A;  5B1L B;  3MGR D;  5GT3 B;  3REH A;  3WTP B;  5B24 A;  3KXB A;  4J8U C;  3AYW C;  4WU8 D;  5BS7 C;  2PYO C;  5AV9 B;  5GT3 C;  4AWL C;  3WTP C;  5G49 B;  4NFT A;  5AV9 C;  4R8P A;  3AZJ C;  1M18 D;  4X23 A;  1EQZ D;  3C1C A;  3AZG D;  2YFW A;  2IO5 B;  2RVQ C;  2IO5 C;  1P3L D;  3REH B;  5E5A D;  1KX3 B;  2YFV A;  4NE6 A;  4ZUX B;  4J8W D;  3B0C W;  3O62 D;  4J8X D;  3REH C;  1KX3 C;  1ID3 A;  3AZL B;  4ZUX C;  4J8V C;  3W97 D;  4H9Q B;  3KUY A;  3AZL C;  4E45 A;  1WWS A;  5AV5 A;  4X23 B;  5CPJ B;  3AV1 A;  2YFW B;  4LD9 D;  4X23 C;  5CPJ C;  1U35 B;  1P3K D;  2ARO A;  2CWE A;  3B0B A;  1U35 C;  5AVB D;  3R45 A;  4Z66 D;  4CSR B;  1ID3 B;  5CP6 D;  1R4V A;  3LJA A;  2NQB A;  5B24 D;  3KUY B;  1ID3 C;  3REL D;  5AV5 B;  4XUJ A;  3KUY C;  1P3A D;  1ZLA D; 
#chains in the Genus database with same CATH topology
 3MVD B;  2F2A C;  2ARO B;  1PZR A;  3MVD C;  2ARO C;  3AV2 A;  2CV5 B;  1B6W A;  3X1U A;  1P3B D;  3LZ1 A;  2CV5 C;  1ULY A;  5JRG D;  3LJA B;  1Z2C B;  3AZK D;  2NQB B;  3KSY A;  3W99 A;  3LJA C;  1M19 A;  2NQB C;  4XUJ B;  3X1T B;  5B2I A;  5B31 B;  1P34 A;  4XUJ C;  3MNN D;  3AZF B;  3X1T C;  5CPK A;  5AY8 B;  3TU4 A;  5B31 C;  3AZF C;  3AV1 D;  1M1A D;  5AY8 C;  1S32 A;  3X1V B;  3AZE B;  3AV2 B;  2Y2K A;  1P3F D;  3WA9 A;  3X1V C;  3LZ1 B;  3AZE C;  4JJN A;  5B33 A;  5B32 A;  3LZ1 C;  4WU9 D;  3REK A;  3LEL D;  1TZY D;  3X1S A;  5B2I B;  4H9P A;  1W2E A;  3AZM A;  1P34 B;  3AZH A;  1BH8 B;  3A6N D;  5B2I C;  5DNM B;  3KFU G;  1P34 C;  3C1B A;  5DNM C;  2RIQ A;  2XD1 A;  4E44 A;  5AVC A;  4KUD D;  1TAF A;  5GSU D;  4JJN B;  3AN2 D;  4YS3 A;  3B6F A;  5B32 B;  4H9R B;  5B2J C;  1HQ3 A;  2F8N B;  1N1J A;  3WAA C;  3LZ0 A;  3UTB D;  4YM6 D;  4G91 B;  4JJN C;  3REK B;  3W98 A;  3AFA B;  1F66 D;  3X1S B;  4G91 C;  3AZM B;  1P3I B;  5B0Z D;  5GT0 A;  3AFA C;  2FJ7 D;  3X1S C;  4H9N A;  1M19 D;  3AZM C;  1P3I C;  3C1B B;  4KGC A;  5B0Y D;  5GT3 A;  1KX4 D;  4DRA A;  5AVC B;  3C1B C;  2Y2P A;  5AV9 A;  2BG1 A;  3AZJ A;  3UTA B;  3H0R C;  5G49 A;  5AVC C;  4YS3 B;  3B6F B;  1HQ3 B;  1AOI D;  4YS3 C;  3UTA C;  3W98 B;  3W96 B;  1P3M B;  3MGS D;  4G92 B;  3W96 C;  3W98 C;  2HUE B;  5GT0 B;  4KHA B;  1P3M C;  4H9N B;  4Z5T A;  5B40 A;  4G92 C;  3AZN A;  2HUE C;  5GT0 C;  4KGC B;  4WU8 B;  4AWL B;  1KX3 A;  3VH6 A;  4CAY B;  2NZD A;  4ZUX A;  2HIO D;  4J8V A;  4KGC C;  4WU8 C;  2F8N H;  2DF4 C;  3AZJ B;  3AZL A;  1A7W A;  3AZI D;  4H9Q A;  1M18 B;  1P3P A;  1P3O D;  1EQZ B;  1M18 C;  3KWQ A;  5CPJ A;  1EQZ C;  2JCH A;  4Z5T B;  1U35 A;  5AV8 D;  2LY8 A;  5B40 B;  3REI A;  3AZN B;  3H0M C;  4Z5T C;  5B40 C;  3AZN C;  2NZD B;  4J8V B;  3F6T A;  5B1M A;  4J8X C;  4CSR A;  1T3U A;  4J8U D;  3AYW D;  5CPI D;  5B1L D;  2PYO D;  3W97 C;  2NZD C;  3A1I A;  3WTP D;  1P3P B;  3B6G D;  4ZBJ B;  5AV6 D;  5DNN D;  4LD9 B;  1P3P C;  3KWQ B;  4ZBJ C;  5FUG A;  4DRB A;  3REJ A;  1KX5 B;  4LD9 C;  2BYM A;  3KWQ C;  3MVD A;  3REI B;  2J8P A;  1KX5 C;  5CHL B;  2RVQ D;  3REI C;  4Z66 B;  4WJ3 C;  3WKJ D;  2CV5 A;  5B1M B;  4Z66 C;  3REH D;  1KX3 D;  3REL B;  5B1M C;  3MGP B;  3KXB D;  5KDM A;  2VQR A;  3REL C;  2XD5 A;  3X1T A;  3MGP C;  3AZL D;  5FUG B;  5B32 G;  1P3A C;  3REJ B;  5B31 A;  4R8P D;  2BYM B;  3AZF A;  5AY8 A;  3REJ C;  4X23 D;  3C1C D;  2FFF B;  4NE5 A;  1P3B B;  1P3G A;  3X1V A;  3AZE A;  5JRG B;  3AZK B;  1P3B C;  4H9O B;  1H3O B;  5JRG C;  3AZK C;  5KDM B;  3EPH A;  1ID3 D;  3VH5 W;  3KUY D;  5BNX B;  1BH8 A;  1M1A B;  5DNM A;  5AV5 D;  4WV4 B;  2G5H C;  3B0C T;  2G5I C;  1M1A C;  1P3G B;  1P3F B;  5B2J A;  2DQN C;  2ARO D;  1P3G C;  1P3F C;  3WAA A;  4DQY B;  1Q9C A;  4WU9 B;  4H9R A;  2F8N A;  1TZY B;  2L5A A;  4WU9 C;  3LEL C;  3AFA A;  3A6N B;  1TZY C;  3LJA D;  2NQB D;  1P3I A;  2Y2M A;  3A6N C;  4XUJ D;  4XZQ A;  4KUD B;  5B2J B;  4KUD C;  3WAA B;  3UTB B;  3MGQ A;  4QLC B;  3UTA A;  4Z2M H;  3AN2 C;  1HTA A;  3AV2 D;  3UTB C;  3X1U D;  4QLC C;  3W96 A;  5C3I C;  5B0Z B;  3LZ1 D;  1P3M A;  5F99 A;  4HGA B;  4WZS B;  2BYK B;  4WNN B;  3W99 D;  5B0Z C;  4KHA A;  4HGA C;  3B0D B;  4XZQ B;  4NE3 A;  5JA4 B;  5B2I D;  4WU8 A;  3B0D C;  1P34 D;  5CPK D;  4CAY A;  3UT9 B;  4XZQ C;  3TU4 D;  5DNM D;  3MGQ B;  3UT9 C;  1S32 D;  3NQU B;  1M18 A;  3A1K A;  3VH5 T;  3MGS B;  3MGQ C;  1EQZ A;  1AOI C;  5GXQ B;  3AZG A;  3WA9 D;  2Y2I A;  5F99 B;  3MGS C;  4JJN D;  3NQJ B;  5B33 D;  5B32 D;  5GXQ C;  3WTP E;  5F99 C;  3MGR B;  3REK D;  5BO0 B;  3X1S D;  4J8W A;  3MGR C;  1WWI A;  3O62 A;  4J8X A;  3AZM D;  3AZH D;  3W97 A;  5BT1 D;  3C1B D;  2ZM5 A;  5AVC D;  3AZG B;  4LD9 A;  4YS3 D;  3B6F D;  1HQ3 D;  3AZG C;  3LZ0 D;  1KX5 A;  1P3L B;  4Z2M G;  5E5A B;  3W98 D;  3W96 D;  5AVB A;  1P3L C;  4J8W B;  4H9S C;  5B31 G;  3O62 B;  4J8X B;  5E5A C;  4Z66 A;  5GT0 D;  5CPI B;  3W97 B;  4J8W C;  3B6G B;  3O62 C;  4UUZ A;  4KGC D;  5CPI C;  5AV6 B;  5B1L C;  5GT3 D;  5DNN B;  3AL0 C;  3REL A;  3B6G C;  3MGP A;  3V9R B;  1P3A A;  2Y2H A;  2ZY4 A;  5AV6 C;  5AV9 D;  5DNN C;  1JFI B;  1ZLA A;  3AZJ D;  1P3K B;  1BFM A;  1P3K C;  1BH9 A;  5AVB B;  2F8N K;  3WKJ B;  1P3B A;  5AVB C;  5CP6 B;  3WKJ C;  5JRG A;  4Z5T D;  3AZK A;  5B40 D;  4H9O A;  5B24 B;  4UUZ B;  3AZN D;  3KXB B;  1H3O A;  5CP6 C;  3EPK A;  2Y2G A;  5B24 C;  2NZD D;  4ZUX D;  4J8V D;  3KXB C;  1P3A B;  4R8P B;  1ZLA B;  3MNN A;  2F8N G;  1P3P D;  4R8P C;  1ZLA C;  3C1C B;  5BNX A;  1M1A A;  1BH9 B;  3KWQ D;  5CPJ D;  3C1C C;  1KX5 D;  1P3F A;  1U35 D;  3REI D;  2YFV B;  4WU9 A;  3LEL A;  1TZY A;  5B1M D;  3MNN B;  3A6N A;  3MGP D;  3AV1 B;  3MNN C;  1KU5 A;  3H0L C;  5AV5 C;  3AV1 C;  3REJ D;  4KUD A;  5GSU A;  3MVD D;  2Y2Q A;  3AN2 A;  3UTB A;  3R45 B;  4QLC A;  4YM6 A;  3LEL B;  2CV5 D;  1F66 A;  5B0Z A;  2FJ7 A;  3VH6 W;  2BYK A;  4WNN A;  5B0Y A;  3X1T D;  1KX4 A;  5JA4 A;  5B31 D;  3AZF D;  5GSU B;  4EO5 B;  3UT9 A;  5AY8 D;  3AN2 B;  5GSU C;  3X1U B;  4YM6 B;  4EO5 C;  5C3I B;  4UPK A;  1AOI A;  1P3G D;  3X1V D;  3NQU A;  3AZE D;  1F66 B;  3MGS A;  3AV2 C;  3X1U C;  4YM6 C;  5GXQ A;  3W99 B;  3IP4 C;  1F66 C;  2FJ7 B;  3NQJ A;  1M19 B;  3W99 C;  3EPJ A;  2FJ7 C;  5B0Y B;  3MGR A;  1M19 C;  5CPK B;  1KX4 B;  5BO0 A;  2HIO A;  3TU4 B;  5B0Y C;  5CPK C;  1KX4 C;  3AZI A;  1S32 B;  3TU4 C;  3P5J B;  1P3O A;  2JSS A;  1AOI B;  1F1E A;  1S32 C;  3WA9 B;  5B33 B;  5B2J D;  3WAA D;  3WA9 C;  4QLC D;  5B33 C;  5B32 C;  5AV8 A;  5BNV A;  2F8N D;  1P3L A;  4H9P B;  4H9S A;  3REK C;  5E5A A;  3AFA D;  3AZH B;  1B67 A;  2HIO B;  1P3I D;  3AZH C;  4J8U A;  3AYW A;  3AZI B;  5BS7 A;  2HIO C;  5B1L A;  5CPI A;  2PYO A;  3VH5 A;  3WTP A;  3B6G A;  1P3O B;  5BT1 C;  4XZQ D;  3AZI C;  5AV6 A;  3EG5 B;  5DNN A;  1TAF B;  1P3O C;  3UT9 D;  3V9R A;  3VH6 T;  1JFI A;  1N1J B;  3LZ0 B;  3MGQ D;  3UTA D;  1P3K A;  3B6F C;  5AV8 B;  4M6B A;  5BNV B;  1HQ3 C;  3LZ0 C;  2Y2O A;  5GXQ D;  5AV8 C;  1P3M D;  5F99 D;  2Y2J A;  3WKJ A;  4J8U B;  3AYW B;  2PYO B;  5CP6 A;  5B1L B;  3MGR D;  5GT3 B;  3REH A;  3WTP B;  2ZY2 A;  5B24 A;  3KXB A;  4J8U C;  3AYW C;  4WU8 D;  5BS7 C;  2PYO C;  5AV9 B;  5GT3 C;  4AWL C;  3WTP C;  5G49 B;  4NFT A;  5AV9 C;  4R8P A;  3AZJ C;  3EPL A;  1M18 D;  4X23 A;  1EQZ D;  3C1C A;  3AZG D;  2YFW A;  2IO5 B;  2RVQ C;  2IO5 C;  1P3L D;  2JE5 A;  5E5A D;  3REH B;  1KX3 B;  2YFV A;  4NE6 A;  4ZUX B;  2ZY5 A;  4J8W D;  3B0C W;  3O62 D;  4J8X D;  3REH C;  1KX3 C;  1ID3 A;  3AZL B;  4ZUX C;  4J8V C;  3W97 D;  4H9Q B;  3KUY A;  2ZY3 A;  3AZL C;  4E45 A;  1WWS A;  5AV5 A;  4X23 B;  5CPJ B;  3AV1 A;  2Y2L A;  2YFW B;  4LD9 D;  2UWX A;  4X23 C;  5CPJ C;  1U35 B;  1P3K D;  2Y2N A;  2ARO A;  2CWE A;  3B0B A;  1U35 C;  5AVB D;  3R45 A;  2W8S A;  3FDD A;  4Z66 D;  4CSR B;  1ID3 B;  5CP6 D;  1R4V A;  3LJA A;  2NQB A;  5B24 D;  3KUY B;  1ID3 C;  3REL D;  5AV5 B;  4XUJ A;  3KUY C;  1P3A D;  1ZLA D; 
#chains in the Genus database with same CATH homology
 3MVD B;  2F2A C;  2ARO B;  1PZR A;  3MVD C;  2ARO C;  3AV2 A;  2CV5 B;  1B6W A;  3X1U A;  1P3B D;  3LZ1 A;  2CV5 C;  1ULY A;  5JRG D;  3LJA B;  1Z2C B;  3AZK D;  2NQB B;  3KSY A;  3W99 A;  3LJA C;  1M19 A;  2NQB C;  4XUJ B;  3X1T B;  5B2I A;  5B31 B;  1P34 A;  4XUJ C;  3MNN D;  3AZF B;  3X1T C;  5CPK A;  5AY8 B;  3TU4 A;  5B31 C;  3AZF C;  3AV1 D;  1M1A D;  5AY8 C;  1S32 A;  3X1V B;  3AZE B;  3AV2 B;  2Y2K A;  1P3F D;  3WA9 A;  3X1V C;  3LZ1 B;  3AZE C;  4JJN A;  5B33 A;  5B32 A;  3LZ1 C;  4WU9 D;  3REK A;  3LEL D;  1TZY D;  3X1S A;  5B2I B;  4H9P A;  1W2E A;  3AZM A;  1P34 B;  3AZH A;  1BH8 B;  3A6N D;  5B2I C;  5DNM B;  3KFU G;  1P34 C;  3C1B A;  5DNM C;  2RIQ A;  2XD1 A;  4E44 A;  5AVC A;  4KUD D;  1TAF A;  5GSU D;  4JJN B;  3AN2 D;  4YS3 A;  3B6F A;  5B32 B;  4H9R B;  5B2J C;  1HQ3 A;  2F8N B;  1N1J A;  3WAA C;  3LZ0 A;  3UTB D;  4YM6 D;  4G91 B;  4JJN C;  3REK B;  3W98 A;  3AFA B;  1F66 D;  3X1S B;  4G91 C;  3AZM B;  1P3I B;  5B0Z D;  5GT0 A;  3AFA C;  2FJ7 D;  3X1S C;  4H9N A;  1M19 D;  3AZM C;  1P3I C;  3C1B B;  4KGC A;  5B0Y D;  5GT3 A;  1KX4 D;  4DRA A;  5AVC B;  3C1B C;  2Y2P A;  5AV9 A;  2BG1 A;  3AZJ A;  3UTA B;  3H0R C;  5G49 A;  5AVC C;  4YS3 B;  3B6F B;  1HQ3 B;  1AOI D;  4YS3 C;  3UTA C;  3W98 B;  3W96 B;  1P3M B;  3MGS D;  4G92 B;  3W96 C;  3W98 C;  2HUE B;  5GT0 B;  4KHA B;  1P3M C;  4H9N B;  4Z5T A;  5B40 A;  4G92 C;  3AZN A;  2HUE C;  5GT0 C;  4KGC B;  4WU8 B;  4AWL B;  1KX3 A;  3VH6 A;  4CAY B;  2NZD A;  4ZUX A;  2HIO D;  4J8V A;  4KGC C;  4WU8 C;  2F8N H;  2DF4 C;  3AZJ B;  3AZL A;  1A7W A;  3AZI D;  4H9Q A;  1M18 B;  1P3P A;  1P3O D;  1EQZ B;  1M18 C;  3KWQ A;  5CPJ A;  1EQZ C;  2JCH A;  4Z5T B;  1U35 A;  5AV8 D;  2LY8 A;  5B40 B;  3REI A;  3AZN B;  3H0M C;  4Z5T C;  5B40 C;  3AZN C;  2NZD B;  4J8V B;  3F6T A;  5B1M A;  4J8X C;  4CSR A;  1T3U A;  4J8U D;  3AYW D;  5CPI D;  5B1L D;  2PYO D;  3W97 C;  2NZD C;  3A1I A;  3WTP D;  1P3P B;  3B6G D;  4ZBJ B;  5AV6 D;  5DNN D;  4LD9 B;  1P3P C;  3KWQ B;  4ZBJ C;  5FUG A;  4DRB A;  3REJ A;  1KX5 B;  4LD9 C;  2BYM A;  3KWQ C;  3MVD A;  3REI B;  2J8P A;  1KX5 C;  5CHL B;  2RVQ D;  3REI C;  4Z66 B;  4WJ3 C;  3WKJ D;  2CV5 A;  5B1M B;  4Z66 C;  3REH D;  1KX3 D;  3REL B;  5B1M C;  3MGP B;  3KXB D;  5KDM A;  2VQR A;  3REL C;  2XD5 A;  3X1T A;  3MGP C;  3AZL D;  5FUG B;  5B32 G;  1P3A C;  3REJ B;  5B31 A;  4R8P D;  2BYM B;  3AZF A;  5AY8 A;  3REJ C;  4X23 D;  3C1C D;  2FFF B;  4NE5 A;  1P3B B;  1P3G A;  3X1V A;  3AZE A;  5JRG B;  3AZK B;  1P3B C;  4H9O B;  1H3O B;  5JRG C;  3AZK C;  5KDM B;  3EPH A;  1ID3 D;  3VH5 W;  3KUY D;  5BNX B;  1BH8 A;  1M1A B;  5DNM A;  5AV5 D;  4WV4 B;  2G5H C;  3B0C T;  2G5I C;  1M1A C;  1P3G B;  1P3F B;  5B2J A;  2DQN C;  2ARO D;  1P3G C;  1P3F C;  3WAA A;  4DQY B;  1Q9C A;  4WU9 B;  4H9R A;  2F8N A;  1TZY B;  2L5A A;  4WU9 C;  3LEL C;  3AFA A;  3A6N B;  1TZY C;  3LJA D;  2NQB D;  1P3I A;  2Y2M A;  3A6N C;  4XUJ D;  4XZQ A;  4KUD B;  5B2J B;  4KUD C;  3WAA B;  3UTB B;  3MGQ A;  4QLC B;  3UTA A;  4Z2M H;  3AN2 C;  1HTA A;  3AV2 D;  3UTB C;  3X1U D;  4QLC C;  3W96 A;  5C3I C;  5B0Z B;  3LZ1 D;  1P3M A;  5F99 A;  4HGA B;  4WZS B;  2BYK B;  4WNN B;  3W99 D;  5B0Z C;  4KHA A;  4HGA C;  3B0D B;  4XZQ B;  4NE3 A;  5JA4 B;  5B2I D;  4WU8 A;  3B0D C;  1P34 D;  5CPK D;  4CAY A;  3UT9 B;  4XZQ C;  3TU4 D;  5DNM D;  3MGQ B;  3UT9 C;  1S32 D;  3NQU B;  1M18 A;  3A1K A;  3VH5 T;  3MGS B;  3MGQ C;  1EQZ A;  1AOI C;  5GXQ B;  3AZG A;  3WA9 D;  2Y2I A;  5F99 B;  3MGS C;  4JJN D;  3NQJ B;  5B33 D;  5B32 D;  5GXQ C;  3WTP E;  5F99 C;  3MGR B;  3REK D;  5BO0 B;  3X1S D;  4J8W A;  3MGR C;  1WWI A;  3O62 A;  4J8X A;  3AZM D;  3AZH D;  3W97 A;  5BT1 D;  3C1B D;  2ZM5 A;  5AVC D;  3AZG B;  4LD9 A;  4YS3 D;  3B6F D;  1HQ3 D;  3AZG C;  3LZ0 D;  1KX5 A;  1P3L B;  4Z2M G;  5E5A B;  3W98 D;  3W96 D;  5AVB A;  1P3L C;  4J8W B;  4H9S C;  5B31 G;  3O62 B;  4J8X B;  5E5A C;  4Z66 A;  5GT0 D;  5CPI B;  3W97 B;  4J8W C;  3B6G B;  3O62 C;  4UUZ A;  4KGC D;  5CPI C;  5AV6 B;  5B1L C;  5GT3 D;  5DNN B;  3AL0 C;  3REL A;  3B6G C;  3MGP A;  3V9R B;  1P3A A;  2Y2H A;  2ZY4 A;  5AV6 C;  5AV9 D;  5DNN C;  1JFI B;  1ZLA A;  3AZJ D;  1P3K B;  1BFM A;  1P3K C;  1BH9 A;  5AVB B;  2F8N K;  3WKJ B;  1P3B A;  5AVB C;  5CP6 B;  3WKJ C;  5JRG A;  4Z5T D;  3AZK A;  5B40 D;  4H9O A;  5B24 B;  4UUZ B;  3AZN D;  3KXB B;  1H3O A;  5CP6 C;  3EPK A;  2Y2G A;  5B24 C;  2NZD D;  4ZUX D;  4J8V D;  3KXB C;  1P3A B;  4R8P B;  1ZLA B;  3MNN A;  2F8N G;  1P3P D;  4R8P C;  1ZLA C;  3C1C B;  5BNX A;  1M1A A;  1BH9 B;  3KWQ D;  5CPJ D;  3C1C C;  1KX5 D;  1P3F A;  1U35 D;  3REI D;  2YFV B;  4WU9 A;  3LEL A;  1TZY A;  5B1M D;  3MNN B;  3A6N A;  3MGP D;  3AV1 B;  3MNN C;  1KU5 A;  3H0L C;  5AV5 C;  3AV1 C;  3REJ D;  4KUD A;  5GSU A;  3MVD D;  2Y2Q A;  3AN2 A;  3UTB A;  3R45 B;  4QLC A;  4YM6 A;  3LEL B;  2CV5 D;  1F66 A;  5B0Z A;  2FJ7 A;  3VH6 W;  2BYK A;  4WNN A;  5B0Y A;  3X1T D;  1KX4 A;  5JA4 A;  5B31 D;  3AZF D;  5GSU B;  4EO5 B;  3UT9 A;  5AY8 D;  3AN2 B;  5GSU C;  3X1U B;  4YM6 B;  4EO5 C;  5C3I B;  4UPK A;  1AOI A;  1P3G D;  3X1V D;  3NQU A;  3AZE D;  1F66 B;  3MGS A;  3AV2 C;  3X1U C;  4YM6 C;  5GXQ A;  3W99 B;  3IP4 C;  1F66 C;  2FJ7 B;  3NQJ A;  1M19 B;  3W99 C;  3EPJ A;  2FJ7 C;  5B0Y B;  3MGR A;  1M19 C;  5CPK B;  1KX4 B;  5BO0 A;  2HIO A;  3TU4 B;  5B0Y C;  5CPK C;  1KX4 C;  3AZI A;  1S32 B;  3TU4 C;  3P5J B;  1P3O A;  2JSS A;  1AOI B;  1F1E A;  1S32 C;  3WA9 B;  5B33 B;  5B2J D;  3WAA D;  3WA9 C;  4QLC D;  5B33 C;  5B32 C;  5AV8 A;  5BNV A;  2F8N D;  1P3L A;  4H9P B;  4H9S A;  3REK C;  5E5A A;  3AFA D;  3AZH B;  1B67 A;  2HIO B;  1P3I D;  3AZH C;  4J8U A;  3AYW A;  3AZI B;  5BS7 A;  2HIO C;  5B1L A;  5CPI A;  2PYO A;  3VH5 A;  3WTP A;  3B6G A;  1P3O B;  5BT1 C;  4XZQ D;  3AZI C;  5AV6 A;  3EG5 B;  5DNN A;  1TAF B;  1P3O C;  3UT9 D;  3V9R A;  3VH6 T;  1JFI A;  1N1J B;  3LZ0 B;  3MGQ D;  3UTA D;  1P3K A;  3B6F C;  5AV8 B;  4M6B A;  5BNV B;  1HQ3 C;  3LZ0 C;  2Y2O A;  5GXQ D;  5AV8 C;  1P3M D;  5F99 D;  2Y2J A;  3WKJ A;  4J8U B;  3AYW B;  2PYO B;  5CP6 A;  5B1L B;  3MGR D;  5GT3 B;  3REH A;  3WTP B;  2ZY2 A;  5B24 A;  3KXB A;  4J8U C;  3AYW C;  4WU8 D;  5BS7 C;  2PYO C;  5AV9 B;  5GT3 C;  4AWL C;  3WTP C;  5G49 B;  4NFT A;  5AV9 C;  4R8P A;  3AZJ C;  3EPL A;  1M18 D;  4X23 A;  1EQZ D;  3C1C A;  3AZG D;  2YFW A;  2IO5 B;  2RVQ C;  2IO5 C;  1P3L D;  2JE5 A;  5E5A D;  3REH B;  1KX3 B;  2YFV A;  4NE6 A;  4ZUX B;  2ZY5 A;  4J8W D;  3B0C W;  3O62 D;  4J8X D;  3REH C;  1KX3 C;  1ID3 A;  3AZL B;  4ZUX C;  4J8V C;  3W97 D;  4H9Q B;  3KUY A;  2ZY3 A;  3AZL C;  4E45 A;  1WWS A;  5AV5 A;  4X23 B;  5CPJ B;  3AV1 A;  2Y2L A;  2YFW B;  4LD9 D;  2UWX A;  4X23 C;  5CPJ C;  1U35 B;  1P3K D;  2Y2N A;  2ARO A;  2CWE A;  3B0B A;  1U35 C;  5AVB D;  3R45 A;  2W8S A;  3FDD A;  4Z66 D;  4CSR B;  1ID3 B;  5CP6 D;  1R4V A;  3LJA A;  2NQB A;  5B24 D;  3KUY B;  1ID3 C;  3REL D;  5AV5 B;  4XUJ A;  3KUY C;  1P3A D;  1ZLA D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...