3AZGC

Crystal structure of human nucleosome core particle containing h3k115q mutation
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
108
structure length
108
Chain Sequence
RAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 108
sequence length 108
chains with identical sequence G
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3azgC00
3AZLB 5AVCC 3AZLA 3WTPE 3NQJA 1KX3D 1TZYC 5GT3B 3AYWC 5AV9D 5GT3A 4YM6B 1P3FD 4YM6A 1ZLAC 5GT0B 3VH5W 5B32D 1KX5C 5DNMC 3AZMB 2HUEB 1HQ3D 3B0DB 3W99C 5CP6C 5AY8D 5B31B 3C1CD 4J8UD 5B31A 3AZEC 3LZ0C 3W98B 4R8PD 3W98A 5B0ZD 5BO0B 1M19B 5BO0A 1M19A 4J8WD 3UT9B 3UT9A 4DRBA 3LZ1C 3AZFC 2CV5A 4ZUXB 2PYOC 4ZUXA 1P3KD 1F1EA 5AV6B 5AV6A 3MNNB 3MNNA 3WAAA 3B0CT 4WU9B 4WU9A 5KDMB 5KDMA 4WU8C 4NE6A 3WTPB 3WTPA 3REIB 4Z66A 4Z2MH 4JJNC 2NQBA 4CAYB 1S32A 1B6WA 4CAYA 1P3BD 3KXBC 3VH5T 4Z5TD 1EQZA 5GXQA 5BT1D 4QLCC 5F99C 1U35D 3C1BC 3UTAC 1KX3B 1P3FB 3REHD 5AV9B 1P3FA 1KX3A 5AV9A 4G92C 5B32B 5B32A 5B2JC 3TU4C 2CWEA 1HQ3B 1HQ3A 3MGRD 2NZDC 5AY8B 5AY8A 3AFAD 3C1CB 3C1CA 4R8PB 1P3ID 4R8PA 2F8NH 5B0ZA 4H9PA 1M18C 3VH6A 4UUZB 3KUYD 4J8WB 4UUZA 5CPKC 4J8WA 2FJ7B 2FJ7A 3B6FC 1P3KB 2F8NK 1P3KA 3MGSD 3LJAD 4X23B 3AV1D 2AROD 4X23A 3REJC 1P3MC 1WWSA 2BYKB 2BYKA 3O62B 4XZQB 3AZIB 3AZIA 1P3GC 1P3BA 4Z5TB 4Z5TA 5DNNB 1BH9B 3AZKC 1ID3C 1BH9A 1F66B 1F66A 3REHB 3KSYA 3REHA 3B6GC 4EO5C 5CPID 4J8XB 3LELC 1P3OD 4ZBJC 4WV4B 4KGCD 3MGRA 5JRGC 5B1MC 3REKB 2YFVB 1P34C 4E44A 1P3IB 1P3IA 1TAFB 1TAFA 3KUYA 4KUDD 2YFWB 5E5AD 5B2IC 3WA9D 2BYMB 4DRAA 2BYMA 3LJAB 3AV1B 3LJAA 2AROB 3AV1A 2AROA 5CHLB 4J8VD 4HGAB 4H9RA 3AN2B 4YS3C 5AV5B 3X1TD 5AV5A 5GT3C 5GT0C 3KWQD 5B31G 3AZHD 3AZMC 1KX4D 2HUEC 3B0DC 1R4VA 3MVDC 1ULYA 4KHAB 5BNXA 4KHAA 5AVCD 4E45A 1TZYD 3AYWD 3W98C 1ZLAD 5CPIB 3NQJB 5CPIA 5B1LD 1P3AD 5B24C 1M19C 1M1AC 1P3OA 4H9SA 1KX5D 3A6NC 1N1JB 3NQUB 1N1JA 3W99D 3NQUA 3VH6W 5B33A 5B33B 5CP6D 5CPJC 4KGCB 4KGCA 1P3PD 5BNVB 3MNNC 5BNVA 3LZ0D 3AV2C 4KUDB 3REIC 4KUDA 3LZ1D 3AZJC 5E5AB 3AZFD 5E5AA 2PYOD 3WA9B 3WA9A 2CV5B 5B32G 3W97B 3W97A 4J8VB 4J8VA 3WAAB 4WU8D 1P3FC 3AZGC 4JJND 4Z66B 5AV8C 3AZHB 3KXBD 4AWLB 3AZHA 1KX4B 1KX4A 2NQBB 5F99D 4QLCD 1S32B 5AVCB 5AY8C 5AVCA 2JSSA 1EQZB 3C1BD 5GXQB 3UTAD 3VH6T 1TZYA 3AYWA 1ZLAB 1ZLAA 3X1SC 5B1LB 1P3AB 5B1LA 4H9NB 1P3AA 2FJ7C 4H9NA 4J8WC 1KX5A 1WWIA 4NE3A 5CP6A 2NZDD 1P3PB 1P3PA 4X23C 3X1VC 5AVBD 5FUGB 4J8UB 1M18D 5FUGA 4J8UA 5CPKD 3B6FD 5B0ZB 3LZ1B 3LZ1A 3AZFA 4H9PB 3O62C 4XZQC 3AZIC 3REJD 1P3MD 5DNNC 1F66C 4WU8A 4LD9C 5GSUC 4J8XC 5C3IC 4JJNB 4JJNA 3AZNC 3MGQC 1P3GD 3W96D 3KXBB 4H9OB 5B0YD 3KXBA 4H9OA 2IO5C 5F99B 4QLCB 5F99A 4QLCA 3X1UC 1ID3D 1P3BB 3AZKD 1P3LC 3C1BB 3UTAB 3C1BA 3REKC 3UTAA 4H9QB 4H9QA 3B6GD 4G92B 1U35B 1AOIC 2F8ND 1U35A 4XUJC 5BS7C 1BH8B 1BH8A 3MGPC 2HIOC 2NZDB 4WZSB 5JRGD 2NZDA 5B1MD 3LJAC 3WKJC 3MGRB 1P34D 4HGAC 3AN2C 3AFAB 5AVBB 5AV5C 3AFAA 5AVBA 5CPKB 5CPKA 3KUYB 5B2ID 3REJA 1P3MA 4WNNB 4YS3D 3MGSB 4WNNA 3MGSA 3UTBC 5GT3D 5JA4B 4H9RB 3AZLC 3R45B 5JA4A 5GT0D 3R45A 5B40D 3RELD 4YM6C 3W96B 1P3GA 3W96A 5B0YB 3AZMD 5B0YA 5B33C 3MVDD 1ID3B 3V9RA 1ID3A 1B67A 3B6GB 3B6GA 5BNXB 2F8NB 2F8NA 1M19D 5B31C 5B24D 1M1AD 4NFTA 3A6ND 5E5AC 1P3OB 5CPJD 3UT9C 5DNMD 5JRGB 5JRGA 2CV5C 5B1MA 4G91B 4ZUXC 1P34B 3W97C 1P34A 5AV6C 3WAAC 3AZED 3AV2D 4WU9C 3REID 3AZJD 3WTPC 5B2IA 4Z66C 1KX4C 2NQBC 1S32C 4YS3B 4YS3A 1EQZC 4NE5A 5GXQC 2RVQC 5GT0A 3X1TB 3AZGD 5B1LC 3X1TA 1P3AC 5B40B 1KX3C 5AV9C 5B40A 3RELB 3RELA 5AV8D 3KWQB 5B32C 3KWQA 3AZMA 3MVDB 3MVDA 1P3PC 1HQ3C 3X1SD 1TZYB 5B24B 3C1CC 5B24A 4J8UC 3AYWB 1M1AB 4R8PC 1M1AA 2FJ7D 5B0ZC 3A6NB 3A6NA 5B2JD 5CPJB 1KX5B 5DNMB 5CPJA 5DNMA 3TU4D 3W99B 5CP6B 5G49B 4X23D 3W99A 5G49A 1P3KC 3X1VD 3AZEB 1A7WA 3AZEA 3LZ0B 3AV2B 3LZ0A 3AV2A 3REIA 3AZJB 3AZJA 3O62D 4XZQD 3AZID 3AZFB 2PYOB 2LY8A 2PYOA 5DNND 1P3BC 1F66D 4Z5TC 3UTBB 5BT1C 1U35C 4LD9D 5GSUD 4WU8B 4J8XD 3AZGA 3AZGB 3REHC 1H3OB 1H3OA 3AZND 5AV8B 3MGQD 5AV8A 3X1UD 1P3LD 4Z2MG 3REKD 2L5AA 3MGRC 3X1SB 1AOID 3X1SA 4XUJD 3VH5A 3AFAC 5AVBC 1P3IC 3MGPD 2HIOD 3LELD 5B2JB 5B2JA 3KUYC 3B0BA 3TU4B 3TU4A 3WKJD 4M6BA 3AN2D 3X1VB 3MGSC 3X1VA 5AV5D 3AV1C 2AROC 1M18B 3O62A 1M18A 3B6FB 4XZQA 3B6FA 3W96C 2F8NG 5B0YC 1KU5A 5DNNA 1BFMA 3REJB 3UTBD 1P3MB 4LD9B 3AZLD 4LD9A 5GSUB 5C3IB 5GSUA 4J8XA 4YM6D 3AZNB 3MGQB 3AZNA 5CPIC 3MGQA 2IO5B 5B33D 4H9SC 1P3OC 3X1UB 4CSRB 1P3GB 3X1UA 4CSRA 1P3LB 1P3LA 3REKA 4G91C 2YFVA 3V9RB 4KGCC 1AOIB 3AZKB 1AOIA 4XUJB 3AZKA 4XUJA 5B31D 5BS7A 3W98D 3MGPB 1Q9CA 4EO5B 2YFWA 3MGPA 2HIOB 3LELB 2HIOA 3LELA 4KUDC 3UT9D 2CV5D 1HTAA 1JFIB 3WKJB 1JFIA 4ZBJB 4ZUXD 3WA9C 3W97D 3WKJA 5AV6D 5B1MB 3MNND 3AN2A 3WAAD 4WU9D 4J8VC 3X1TC 3WTPD 5B40C 3RELC 4Z66D 3KWQC 5B2IB 3B0CW 2NQBD 1S32D 3AZHC 4AWLC 1EQZD 5GXQD 3UTBA 2RVQD
chains in the Genus database with same CATH superfamily
3AZLB 5AVCC 3AZLA 3WTPE 3NQJA 1KX3D 1TZYC 5GT3B 3AYWC 5AV9D 5GT3A 4YM6B 1P3FD 4YM6A 1ZLAC 5GT0B 2G5HC 3VH5W 5B32D 1KX5C 5DNMC 3AZMB 2HUEB 1HQ3D 3B0DB 3W99C 5CP6C 5AY8D 5B31B 3C1CD 4J8UD 5B31A 2ZY5A 3LZ0C 3AZEC 4R8PD 3W98B 3W98A 5B0ZD 5BO0B 1M19B 5BO0A 1M19A 4J8WD 3UT9B 3UT9A 4DRBA 3LZ1C 3A1KA 3AZFC 2CV5A 3KFUG 4ZUXB 2PYOC 4ZUXA 1P3KD 1F1EA 5AV6B 5AV6A 3MNNB 3MNNA 3WAAA 3B0CT 4WU9B 4WU9A 5KDMB 5KDMA 4WU8C 4NE6A 3WTPB 3WTPA 3REIB 4Z66A 4Z2MH 4JJNC 2Y2LA 2NQBA 4CAYB 1S32A 1B6WA 4CAYA 1P3BD 3FDDA 3VH5T 3KXBC 4Z5TD 1EQZA 5GXQA 5BT1D 4QLCC 5F99C 1U35D 3C1BC 3UTAC 1KX3B 1P3FB 3REHD 5AV9B 1P3FA 1KX3A 5AV9A 4G92C 5B32B 5B32A 5B2JC 3TU4C 2CWEA 1HQ3B 1HQ3A 3MGRD 2NZDC 5AY8B 5AY8A 3AFAD 3C1CB 3C1CA 4R8PB 1P3ID 4R8PA 2F8NH 5B0ZA 4H9PA 1M18C 3VH6A 4UUZB 3KUYD 4J8WB 4UUZA 5CPKC 4J8WA 2FJ7B 2FJ7A 3B6FC 1P3KB 2F8NK 2G5IC 1P3KA 3MGSD 3LJAD 4X23B 3AV1D 2AROD 4X23A 3REJC 1P3MC 1WWSA 2BYKB 2BYKA 3O62B 4XZQB 3AZIB 3AZIA 1P3GC 1P3BA 4Z5TB 4Z5TA 5DNNB 1BH9B 3AZKC 1ID3C 1BH9A 1Z2CB 1F66B 1F66A 3REHB 3KSYA 2ZY2A 3REHA 3B6GC 4EO5C 5CPID 4J8XB 3LELC 1P3OD 4ZBJC 4WV4B 4KGCD 3MGRA 5JRGC 5B1MC 3REKB 2YFVB 1P34C 4E44A 1P3IB 1P3IA 1TAFB 1TAFA 3KUYA 4KUDD 2YFWB 5E5AD 5B2IC 3WA9D 2BYMB 2Y2QA 4DRAA 2BYMA 3LJAB 3AV1B 3LJAA 2AROB 3AV1A 2AROA 5CHLB 4J8VD 4HGAB 4H9RA 3AN2B 4YS3C 5AV5B 3X1TD 5AV5A 5GT3C 5GT0C 3KWQD 5B31G 3AZHD 3AZMC 1KX4D 2HUEC 3B0DC 1R4VA 3MVDC 1ULYA 4KHAB 5BNXA 3EG5B 4KHAA 5AVCD 4E45A 1TZYD 2DF4C 3AYWD 3W98C 1ZLAD 5CPIB 3NQJB 3P5JB 5CPIA 5B1LD 1P3AD 5B24C 1M19C 1M1AC 1P3OA 4H9SA 1KX5D 3A6NC 1N1JB 3NQUB 1N1JA 3W99D 3NQUA 3VH6W 5B33A 5B33B 5CP6D 5CPJC 4KGCB 4KGCA 1P3PD 5BNVB 3MNNC 5BNVA 3LZ0D 2Y2HA 3AV2C 4KUDB 3REIC 4KUDA 3LZ1D 3AZJC 5E5AB 3AZFD 5E5AA 2RIQA 3F6TA 2PYOD 3WA9B 3WA9A 2CV5B 5B32G 3W97B 3W97A 4J8VB 4J8VA 3WAAB 4WU8D 1P3FC 3AZGC 4JJND 4Z66B 5AV8C 2F2AC 3AZHB 3KXBD 4AWLB 3AZHA 1KX4B 3IP4C 1KX4A 2NQBB 5F99D 4QLCD 1S32B 5AVCB 5AY8C 5AVCA 2JSSA 2Y2IA 3C1BD 1EQZB 5GXQB 3UTAD 3VH6T 1TZYA 2Y2GA 3AYWA 1ZLAB 1ZLAA 3X1SC 5B1LB 1P3AB 5B1LA 4H9NB 1P3AA 2FJ7C 4H9NA 4J8WC 1KX5A 1WWIA 2ZY3A 4NE3A 5CP6A 2NZDD 1P3PB 1P3PA 4X23C 3X1VC 5AVBD 5FUGB 4J8UB 1M18D 5FUGA 4J8UA 5CPKD 3B6FD 5B0ZB 3LZ1B 3LZ1A 3AZFA 4H9PB 3O62C 4XZQC 3H0LC 2Y2KA 3AZIC 3REJD 1P3MD 5DNNC 1F66C 4WU8A 4LD9C 5GSUC 4J8XC 5C3IC 4JJNB 4JJNA 3AZNC 3MGQC 1P3GD 3W96D 3KXBB 4H9OB 5B0YD 3KXBA 4H9OA 2IO5C 5F99B 4QLCB 5F99A 4QLCA 3X1UC 1ID3D 1P3BB 3AZKD 1P3LC 3EPJA 3C1BB 3UTAB 3C1BA 3REKC 3UTAA 4H9QB 4H9QA 3B6GD 4G92B 1U35B 1AOIC 2F8ND 1U35A 4XUJC 5BS7C 1BH8B 1BH8A 2Y2OA 3MGPC 2HIOC 2NZDB 4WZSB 5JRGD 2NZDA 5B1MD 3LJAC 3WKJC 3MGRB 1P34D 4HGAC 4UPKA 3AFAB 3AN2C 5AVBB 5AV5C 3AFAA 5AVBA 5CPKB 5CPKA 3H0RC 3KUYB 5B2ID 3REJA 3EPHA 1P3MA 2JE5A 4WNNB 4YS3D 3MGSB 4WNNA 3MGSA 3UTBC 5GT3D 5JA4B 4H9RB 3AZLC 3R45B 5JA4A 5GT0D 3R45A 5B40D 3RELD 4YM6C 3W96B 1P3GA 3W96A 4WJ3C 5B0YB 3AZMD 5B0YA 5B33C 3MVDD 1ID3B 3V9RA 1ID3A 1B67A 3B6GB 2XD5A 5BNXB 2F8NB 3B6GA 2F8NA 1M19D 5B31C 5B24D 1M1AD 4NFTA 2W8SA 3A6ND 5E5AC 1P3OB 5CPJD 3UT9C 5DNMD 5JRGB 5JRGA 2CV5C 5B1MA 4G91B 4ZUXC 1P34B 3W97C 1P34A 5AV6C 2ZM5A 3EPLA 3WAAC 3AZED 3AV2D 4WU9C 3REID 3AL0C 3AZJD 3WTPC 5B2IA 2BG1A 4Z66C 1KX4C 2NQBC 1S32C 4YS3B 4YS3A 1EQZC 4NE5A 5GXQC 2RVQC 5GT0A 3X1TB 2Y2JA 5B1LC 3AZGD 3X1TA 5B40B 1P3AC 5AV9C 5B40A 3RELB 3RELA 1KX3C 5AV8D 3A1IA 3KWQB 5B32C 3KWQA 3AZMA 2FFFB 3MVDB 3MVDA 2Y2MA 1P3PC 1HQ3C 3X1SD 1TZYB 5B24B 3C1CC 5B24A 4J8UC 3AYWB 1M1AB 4R8PC 1M1AA 2FJ7D 5B0ZC 3A6NB 3A6NA 5B2JD 5CPJB 1KX5B 5DNMB 5CPJA 5DNMA 3TU4D 2ZY4A 3W99B 5CP6B 5G49B 4X23D 3W99A 5G49A 1P3KC 3X1VD 3AZEB 1A7WA 3AZEA 3LZ0B 3AV2B 3LZ0A 2DQNC 3AV2A 3REIA 3AZJB 3AZJA 3O62D 4XZQD 3AZID 3AZFB 2PYOB 2LY8A 2PYOA 5DNND 1P3BC 1F66D 4Z5TC 3UTBB 5BT1C 1U35C 4LD9D 2XD1A 5GSUD 4WU8B 4J8XD 3AZGA 3AZGB 3REHC 1H3OB 1H3OA 3AZND 5AV8B 3MGQD 5AV8A 2Y2NA 3X1UD 1P3LD 4Z2MG 3REKD 2L5AA 3MGRC 3X1SB 1AOID 3X1SA 4XUJD 3VH5A 3AFAC 5AVBC 1P3IC 3MGPD 2HIOD 3LELD 5B2JB 5B2JA 3KUYC 3B0BA 3TU4B 3TU4A 3WKJD 4M6BA 3AN2D 3X1VB 3MGSC 3X1VA 5AV5D 3AV1C 2AROC 2JCHA 1M18B 3O62A 1M18A 3B6FB 4XZQA 3B6FA 2UWXA 4DQYB 3W96C 2F8NG 5B0YC 1KU5A 5DNNA 1BFMA 3REJB 3UTBD 1P3MB 4LD9B 3AZLD 4LD9A 5GSUB 5C3IB 5GSUA 4J8XA 4YM6D 3AZNB 3MGQB 3AZNA 5CPIC 3MGQA 2Y2PA 2VQRA 2IO5B 5B33D 4H9SC 1P3OC 3X1UB 4CSRB 1P3GB 3X1UA 4CSRA 1P3LB 1P3LA 3EPKA 3REKA 4G91C 2YFVA 3V9RB 4KGCC 1AOIB 3AZKB 1AOIA 4XUJB 3AZKA 4XUJA 5B31D 5BS7A 3W98D 3MGPB 1Q9CA 4EO5B 2YFWA 3MGPA 2HIOB 3LELB 2HIOA 3LELA 4KUDC 3UT9D 1W2EA 2CV5D 1HTAA 1PZRA 1JFIB 3WKJB 1JFIA 4ZBJB 4ZUXD 3WA9C 1T3UA 3W97D 5AV6D 3WKJA 5B1MB 3MNND 3AN2A 3WAAD 4WU9D 4J8VC 3X1TC 3WTPD 3H0MC 3RELC 5B40C 4Z66D 3KWQC 5B2IB 3B0CW 2NQBD 1S32D 3AZHC 2J8PA 4AWLC 1EQZD 5GXQD 3UTBA 2RVQD
chains in the Genus database with same CATH topology
3AZLB 5AVCC 3AZLA 3WTPE 3NQJA 1KX3D 1TZYC 5GT3B 3AYWC 5AV9D 5GT3A 4YM6B 1P3FD 4YM6A 1ZLAC 5GT0B 2G5HC 3VH5W 5B32D 1KX5C 5DNMC 3AZMB 2HUEB 1HQ3D 3B0DB 3W99C 5CP6C 5AY8D 5B31B 3C1CD 4J8UD 5B31A 2ZY5A 3LZ0C 3AZEC 4R8PD 3W98B 3W98A 5B0ZD 5BO0B 1M19B 5BO0A 1M19A 4J8WD 3UT9B 3UT9A 4DRBA 3LZ1C 3A1KA 3AZFC 2CV5A 3KFUG 4ZUXB 2PYOC 4ZUXA 1P3KD 1F1EA 5AV6B 5AV6A 3MNNB 3MNNA 3WAAA 3B0CT 4WU9B 4WU9A 5KDMB 5KDMA 4WU8C 4NE6A 3WTPB 3WTPA 3REIB 4Z66A 4Z2MH 4JJNC 2Y2LA 2NQBA 4CAYB 1S32A 1B6WA 4CAYA 1P3BD 3FDDA 3VH5T 3KXBC 4Z5TD 1EQZA 5GXQA 5BT1D 4QLCC 5F99C 1U35D 3C1BC 3UTAC 1KX3B 1P3FB 3REHD 5AV9B 1P3FA 1KX3A 5AV9A 4G92C 5B32B 5B32A 5B2JC 3TU4C 2CWEA 1HQ3B 1HQ3A 3MGRD 2NZDC 5AY8B 5AY8A 3AFAD 3C1CB 3C1CA 4R8PB 1P3ID 4R8PA 2F8NH 5B0ZA 4H9PA 1M18C 3VH6A 4UUZB 3KUYD 4J8WB 4UUZA 5CPKC 4J8WA 2FJ7B 2FJ7A 3B6FC 1P3KB 2F8NK 2G5IC 1P3KA 3MGSD 3LJAD 4X23B 3AV1D 2AROD 4X23A 3REJC 1P3MC 1WWSA 2BYKB 2BYKA 3O62B 4XZQB 3AZIB 3AZIA 1P3GC 1P3BA 4Z5TB 4Z5TA 5DNNB 1BH9B 3AZKC 1ID3C 1BH9A 1Z2CB 1F66B 1F66A 3REHB 3KSYA 2ZY2A 3REHA 3B6GC 4EO5C 5CPID 4J8XB 3LELC 1P3OD 4ZBJC 4WV4B 4KGCD 3MGRA 5JRGC 5B1MC 3REKB 2YFVB 1P34C 4E44A 1P3IB 1P3IA 1TAFB 1TAFA 3KUYA 4KUDD 2YFWB 5E5AD 5B2IC 3WA9D 2BYMB 2Y2QA 4DRAA 2BYMA 3LJAB 3AV1B 3LJAA 2AROB 3AV1A 2AROA 5CHLB 4J8VD 4HGAB 4H9RA 3AN2B 4YS3C 5AV5B 3X1TD 5AV5A 5GT3C 5GT0C 3KWQD 5B31G 3AZHD 3AZMC 1KX4D 2HUEC 3B0DC 1R4VA 3MVDC 1ULYA 4KHAB 5BNXA 3EG5B 4KHAA 5AVCD 4E45A 1TZYD 2DF4C 3AYWD 3W98C 1ZLAD 5CPIB 3NQJB 3P5JB 5CPIA 5B1LD 1P3AD 5B24C 1M19C 1M1AC 1P3OA 4H9SA 1KX5D 3A6NC 1N1JB 3NQUB 1N1JA 3W99D 3NQUA 3VH6W 5B33A 5B33B 5CP6D 5CPJC 4KGCB 4KGCA 1P3PD 5BNVB 3MNNC 5BNVA 3LZ0D 2Y2HA 3AV2C 4KUDB 3REIC 4KUDA 3LZ1D 3AZJC 5E5AB 3AZFD 5E5AA 2RIQA 3F6TA 2PYOD 3WA9B 3WA9A 2CV5B 5B32G 3W97B 3W97A 4J8VB 4J8VA 3WAAB 4WU8D 1P3FC 3AZGC 4JJND 4Z66B 5AV8C 2F2AC 3AZHB 3KXBD 4AWLB 3AZHA 1KX4B 3IP4C 1KX4A 2NQBB 5F99D 4QLCD 1S32B 5AVCB 5AY8C 5AVCA 2JSSA 2Y2IA 3C1BD 1EQZB 5GXQB 3UTAD 3VH6T 1TZYA 2Y2GA 3AYWA 1ZLAB 1ZLAA 3X1SC 5B1LB 1P3AB 5B1LA 4H9NB 1P3AA 2FJ7C 4H9NA 4J8WC 1KX5A 1WWIA 2ZY3A 4NE3A 5CP6A 2NZDD 1P3PB 1P3PA 4X23C 3X1VC 5AVBD 5FUGB 4J8UB 1M18D 5FUGA 4J8UA 5CPKD 3B6FD 5B0ZB 3LZ1B 3LZ1A 3AZFA 4H9PB 3O62C 4XZQC 3H0LC 2Y2KA 3AZIC 3REJD 1P3MD 5DNNC 1F66C 4WU8A 4LD9C 5GSUC 4J8XC 5C3IC 4JJNB 4JJNA 3AZNC 3MGQC 1P3GD 3W96D 3KXBB 4H9OB 5B0YD 3KXBA 4H9OA 2IO5C 5F99B 4QLCB 5F99A 4QLCA 3X1UC 1ID3D 1P3BB 3AZKD 1P3LC 3EPJA 3C1BB 3UTAB 3C1BA 3REKC 3UTAA 4H9QB 4H9QA 3B6GD 4G92B 1U35B 1AOIC 2F8ND 1U35A 4XUJC 5BS7C 1BH8B 1BH8A 2Y2OA 3MGPC 2HIOC 2NZDB 4WZSB 5JRGD 2NZDA 5B1MD 3LJAC 3WKJC 3MGRB 1P34D 4HGAC 4UPKA 3AFAB 3AN2C 5AVBB 5AV5C 3AFAA 5AVBA 5CPKB 5CPKA 3H0RC 3KUYB 5B2ID 3REJA 3EPHA 1P3MA 2JE5A 4WNNB 4YS3D 3MGSB 4WNNA 3MGSA 3UTBC 5GT3D 5JA4B 4H9RB 3AZLC 3R45B 5JA4A 5GT0D 3R45A 5B40D 3RELD 4YM6C 3W96B 1P3GA 3W96A 4WJ3C 5B0YB 3AZMD 5B0YA 5B33C 3MVDD 1ID3B 3V9RA 1ID3A 1B67A 3B6GB 2XD5A 5BNXB 2F8NB 3B6GA 2F8NA 1M19D 5B31C 5B24D 1M1AD 4NFTA 2W8SA 3A6ND 5E5AC 1P3OB 5CPJD 3UT9C 5DNMD 5JRGB 5JRGA 2CV5C 5B1MA 4G91B 4ZUXC 1P34B 3W97C 1P34A 5AV6C 2ZM5A 3EPLA 3WAAC 3AZED 3AV2D 4WU9C 3REID 3AL0C 3AZJD 3WTPC 5B2IA 2BG1A 4Z66C 1KX4C 2NQBC 1S32C 4YS3B 4YS3A 1EQZC 4NE5A 5GXQC 2RVQC 5GT0A 3X1TB 2Y2JA 5B1LC 3AZGD 3X1TA 5B40B 1P3AC 5AV9C 5B40A 3RELB 3RELA 1KX3C 5AV8D 3A1IA 3KWQB 5B32C 3KWQA 3AZMA 2FFFB 3MVDB 3MVDA 2Y2MA 1P3PC 1HQ3C 3X1SD 1TZYB 5B24B 3C1CC 5B24A 4J8UC 3AYWB 1M1AB 4R8PC 1M1AA 2FJ7D 5B0ZC 3A6NB 3A6NA 5B2JD 5CPJB 1KX5B 5DNMB 5CPJA 5DNMA 3TU4D 2ZY4A 3W99B 5CP6B 5G49B 4X23D 3W99A 5G49A 1P3KC 3X1VD 3AZEB 1A7WA 3AZEA 3LZ0B 3AV2B 3LZ0A 2DQNC 3AV2A 3REIA 3AZJB 3AZJA 3O62D 4XZQD 3AZID 3AZFB 2PYOB 2LY8A 2PYOA 5DNND 1P3BC 1F66D 4Z5TC 3UTBB 5BT1C 1U35C 4LD9D 2XD1A 5GSUD 4WU8B 4J8XD 3AZGA 3AZGB 3REHC 1H3OB 1H3OA 3AZND 5AV8B 3MGQD 5AV8A 2Y2NA 3X1UD 1P3LD 4Z2MG 3REKD 2L5AA 3MGRC 3X1SB 1AOID 3X1SA 4XUJD 3VH5A 3AFAC 5AVBC 1P3IC 3MGPD 2HIOD 3LELD 5B2JB 5B2JA 3KUYC 3B0BA 3TU4B 3TU4A 3WKJD 4M6BA 3AN2D 3X1VB 3MGSC 3X1VA 5AV5D 3AV1C 2AROC 2JCHA 1M18B 3O62A 1M18A 3B6FB 4XZQA 3B6FA 2UWXA 4DQYB 3W96C 2F8NG 5B0YC 1KU5A 5DNNA 1BFMA 3REJB 3UTBD 1P3MB 4LD9B 3AZLD 4LD9A 5GSUB 5C3IB 5GSUA 4J8XA 4YM6D 3AZNB 3MGQB 3AZNA 5CPIC 3MGQA 2Y2PA 2VQRA 2IO5B 5B33D 4H9SC 1P3OC 3X1UB 4CSRB 1P3GB 3X1UA 4CSRA 1P3LB 1P3LA 3EPKA 3REKA 4G91C 2YFVA 3V9RB 4KGCC 1AOIB 3AZKB 1AOIA 4XUJB 3AZKA 4XUJA 5B31D 5BS7A 3W98D 3MGPB 1Q9CA 4EO5B 2YFWA 3MGPA 2HIOB 3LELB 2HIOA 3LELA 4KUDC 3UT9D 1W2EA 2CV5D 1HTAA 1PZRA 1JFIB 3WKJB 1JFIA 4ZBJB 4ZUXD 3WA9C 1T3UA 3W97D 5AV6D 3WKJA 5B1MB 3MNND 3AN2A 3WAAD 4WU9D 4J8VC 3X1TC 3WTPD 3H0MC 3RELC 5B40C 4Z66D 3KWQC 5B2IB 3B0CW 2NQBD 1S32D 3AZHC 2J8PA 4AWLC 1EQZD 5GXQD 3UTBA 2RVQD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZL B;  5AVC C;  3AZL A;  3WTP E;  3NQJ A;  1KX3 D;  1TZY C;  5GT3 B;  3AYW C;  5AV9 D;  5GT3 A;  4YM6 B;  1P3F D;  4YM6 A;  1ZLA C;  5GT0 B;  3VH5 W;  5B32 D;  1KX5 C;  5DNM C;  3AZM B;  2HUE B;  1HQ3 D;  3B0D B;  3W99 C;  5CP6 C;  5AY8 D;  5B31 B;  3C1C D;  4J8U D;  5B31 A;  3AZE C;  3LZ0 C;  3W98 B;  4R8P D;  3W98 A;  5B0Z D;  5BO0 B;  1M19 B;  5BO0 A;  1M19 A;  4J8W D;  3UT9 B;  3UT9 A;  4DRB A;  3LZ1 C;  3AZF C;  2CV5 A;  4ZUX B;  2PYO C;  4ZUX A;  1P3K D;  1F1E A;  5AV6 B;  5AV6 A;  3MNN B;  3MNN A;  3WAA A;  3B0C T;  4WU9 B;  4WU9 A;  5KDM B;  5KDM A;  4WU8 C;  4NE6 A;  3WTP B;  3WTP A;  3REI B;  4Z66 A;  4Z2M H;  4JJN C;  2NQB A;  4CAY B;  1S32 A;  1B6W A;  4CAY A;  1P3B D;  3KXB C;  3VH5 T;  4Z5T D;  1EQZ A;  5GXQ A;  5BT1 D;  4QLC C;  5F99 C;  1U35 D;  3C1B C;  3UTA C;  1KX3 B;  1P3F B;  3REH D;  5AV9 B;  1P3F A;  1KX3 A;  5AV9 A;  4G92 C;  5B32 B;  5B32 A;  5B2J C;  3TU4 C;  2CWE A;  1HQ3 B;  1HQ3 A;  3MGR D;  2NZD C;  5AY8 B;  5AY8 A;  3AFA D;  3C1C B;  3C1C A;  4R8P B;  1P3I D;  4R8P A;  2F8N H;  5B0Z A;  4H9P A;  1M18 C;  3VH6 A;  4UUZ B;  3KUY D;  4J8W B;  4UUZ A;  5CPK C;  4J8W A;  2FJ7 B;  2FJ7 A;  3B6F C;  1P3K B;  2F8N K;  1P3K A;  3MGS D;  3LJA D;  4X23 B;  3AV1 D;  2ARO D;  4X23 A;  3REJ C;  1P3M C;  1WWS A;  2BYK B;  2BYK A;  3O62 B;  4XZQ B;  3AZI B;  3AZI A;  1P3G C;  1P3B A;  4Z5T B;  4Z5T A;  5DNN B;  1BH9 B;  3AZK C;  1ID3 C;  1BH9 A;  1F66 B;  1F66 A;  3REH B;  3KSY A;  3REH A;  3B6G C;  4EO5 C;  5CPI D;  4J8X B;  3LEL C;  1P3O D;  4ZBJ C;  4WV4 B;  4KGC D;  3MGR A;  5JRG C;  5B1M C;  3REK B;  2YFV B;  1P34 C;  4E44 A;  1P3I B;  1P3I A;  1TAF B;  1TAF A;  3KUY A;  4KUD D;  2YFW B;  5E5A D;  5B2I C;  3WA9 D;  2BYM B;  4DRA A;  2BYM A;  3LJA B;  3AV1 B;  3LJA A;  2ARO B;  3AV1 A;  2ARO A;  5CHL B;  4J8V D;  4HGA B;  4H9R A;  3AN2 B;  4YS3 C;  5AV5 B;  3X1T D;  5AV5 A;  5GT3 C;  5GT0 C;  3KWQ D;  5B31 G;  3AZH D;  3AZM C;  1KX4 D;  2HUE C;  3B0D C;  1R4V A;  3MVD C;  1ULY A;  4KHA B;  5BNX A;  4KHA A;  5AVC D;  4E45 A;  1TZY D;  3AYW D;  3W98 C;  1ZLA D;  5CPI B;  3NQJ B;  5CPI A;  5B1L D;  1P3A D;  5B24 C;  1M19 C;  1M1A C;  1P3O A;  4H9S A;  1KX5 D;  3A6N C;  1N1J B;  3NQU B;  1N1J A;  3W99 D;  3NQU A;  3VH6 W;  5B33 A;  5B33 B;  5CP6 D;  5CPJ C;  4KGC B;  4KGC A;  1P3P D;  5BNV B;  3MNN C;  5BNV A;  3LZ0 D;  3AV2 C;  4KUD B;  3REI C;  4KUD A;  3LZ1 D;  3AZJ C;  5E5A B;  3AZF D;  5E5A A;  2PYO D;  3WA9 B;  3WA9 A;  2CV5 B;  5B32 G;  3W97 B;  3W97 A;  4J8V B;  4J8V A;  3WAA B;  4WU8 D;  1P3F C;  3AZG C;  4JJN D;  4Z66 B;  5AV8 C;  3AZH B;  3KXB D;  4AWL B;  3AZH A;  1KX4 B;  1KX4 A;  2NQB B;  5F99 D;  4QLC D;  1S32 B;  5AVC B;  5AY8 C;  5AVC A;  2JSS A;  1EQZ B;  3C1B D;  5GXQ B;  3UTA D;  3VH6 T;  1TZY A;  3AYW A;  1ZLA B;  1ZLA A;  3X1S C;  5B1L B;  1P3A B;  5B1L A;  4H9N B;  1P3A A;  2FJ7 C;  4H9N A;  4J8W C;  1KX5 A;  1WWI A;  4NE3 A;  5CP6 A;  2NZD D;  1P3P B;  1P3P A;  4X23 C;  3X1V C;  5AVB D;  5FUG B;  4J8U B;  1M18 D;  5FUG A;  4J8U A;  5CPK D;  3B6F D;  5B0Z B;  3LZ1 B;  3LZ1 A;  3AZF A;  4H9P B;  3O62 C;  4XZQ C;  3AZI C;  3REJ D;  1P3M D;  5DNN C;  1F66 C;  4WU8 A;  4LD9 C;  5GSU C;  4J8X C;  5C3I C;  4JJN B;  4JJN A;  3AZN C;  3MGQ C;  1P3G D;  3W96 D;  3KXB B;  4H9O B;  5B0Y D;  3KXB A;  4H9O A;  2IO5 C;  5F99 B;  4QLC B;  5F99 A;  4QLC A;  3X1U C;  1ID3 D;  1P3B B;  3AZK D;  1P3L C;  3C1B B;  3UTA B;  3C1B A;  3REK C;  3UTA A;  4H9Q B;  4H9Q A;  3B6G D;  4G92 B;  1U35 B;  1AOI C;  2F8N D;  1U35 A;  4XUJ C;  5BS7 C;  1BH8 B;  1BH8 A;  3MGP C;  2HIO C;  2NZD B;  4WZS B;  5JRG D;  2NZD A;  5B1M D;  3LJA C;  3WKJ C;  3MGR B;  1P34 D;  4HGA C;  3AN2 C;  3AFA B;  5AVB B;  5AV5 C;  3AFA A;  5AVB A;  5CPK B;  5CPK A;  3KUY B;  5B2I D;  3REJ A;  1P3M A;  4WNN B;  4YS3 D;  3MGS B;  4WNN A;  3MGS A;  3UTB C;  5GT3 D;  5JA4 B;  4H9R B;  3AZL C;  3R45 B;  5JA4 A;  5GT0 D;  3R45 A;  5B40 D;  3REL D;  4YM6 C;  3W96 B;  1P3G A;  3W96 A;  5B0Y B;  3AZM D;  5B0Y A;  5B33 C;  3MVD D;  1ID3 B;  3V9R A;  1ID3 A;  1B67 A;  3B6G B;  3B6G A;  5BNX B;  2F8N B;  2F8N A;  1M19 D;  5B31 C;  5B24 D;  1M1A D;  4NFT A;  3A6N D;  5E5A C;  1P3O B;  5CPJ D;  3UT9 C;  5DNM D;  5JRG B;  5JRG A;  2CV5 C;  5B1M A;  4G91 B;  4ZUX C;  1P34 B;  3W97 C;  1P34 A;  5AV6 C;  3WAA C;  3AZE D;  3AV2 D;  4WU9 C;  3REI D;  3AZJ D;  3WTP C;  5B2I A;  4Z66 C;  1KX4 C;  2NQB C;  1S32 C;  4YS3 B;  4YS3 A;  1EQZ C;  4NE5 A;  5GXQ C;  2RVQ C;  5GT0 A;  3X1T B;  3AZG D;  5B1L C;  3X1T A;  1P3A C;  5B40 B;  1KX3 C;  5AV9 C;  5B40 A;  3REL B;  3REL A;  5AV8 D;  3KWQ B;  5B32 C;  3KWQ A;  3AZM A;  3MVD B;  3MVD A;  1P3P C;  1HQ3 C;  3X1S D;  1TZY B;  5B24 B;  3C1C C;  5B24 A;  4J8U C;  3AYW B;  1M1A B;  4R8P C;  1M1A A;  2FJ7 D;  5B0Z C;  3A6N B;  3A6N A;  5B2J D;  5CPJ B;  1KX5 B;  5DNM B;  5CPJ A;  5DNM A;  3TU4 D;  3W99 B;  5CP6 B;  5G49 B;  4X23 D;  3W99 A;  5G49 A;  1P3K C;  3X1V D;  3AZE B;  1A7W A;  3AZE A;  3LZ0 B;  3AV2 B;  3LZ0 A;  3AV2 A;  3REI A;  3AZJ B;  3AZJ A;  3O62 D;  4XZQ D;  3AZI D;  3AZF B;  2PYO B;  2LY8 A;  2PYO A;  5DNN D;  1P3B C;  1F66 D;  4Z5T C;  3UTB B;  5BT1 C;  1U35 C;  4LD9 D;  5GSU D;  4WU8 B;  4J8X D;  3AZG A;  3AZG B;  3REH C;  1H3O B;  1H3O A;  3AZN D;  5AV8 B;  3MGQ D;  5AV8 A;  3X1U D;  1P3L D;  4Z2M G;  3REK D;  2L5A A;  3MGR C;  3X1S B;  1AOI D;  3X1S A;  4XUJ D;  3VH5 A;  3AFA C;  5AVB C;  1P3I C;  3MGP D;  2HIO D;  3LEL D;  5B2J B;  5B2J A;  3KUY C;  3B0B A;  3TU4 B;  3TU4 A;  3WKJ D;  4M6B A;  3AN2 D;  3X1V B;  3MGS C;  3X1V A;  5AV5 D;  3AV1 C;  2ARO C;  1M18 B;  3O62 A;  1M18 A;  3B6F B;  4XZQ A;  3B6F A;  3W96 C;  2F8N G;  5B0Y C;  1KU5 A;  5DNN A;  1BFM A;  3REJ B;  3UTB D;  1P3M B;  4LD9 B;  3AZL D;  4LD9 A;  5GSU B;  5C3I B;  5GSU A;  4J8X A;  4YM6 D;  3AZN B;  3MGQ B;  3AZN A;  5CPI C;  3MGQ A;  2IO5 B;  5B33 D;  4H9S C;  1P3O C;  3X1U B;  4CSR B;  1P3G B;  3X1U A;  4CSR A;  1P3L B;  1P3L A;  3REK A;  4G91 C;  2YFV A;  3V9R B;  4KGC C;  1AOI B;  3AZK B;  1AOI A;  4XUJ B;  3AZK A;  4XUJ A;  5B31 D;  5BS7 A;  3W98 D;  3MGP B;  1Q9C A;  4EO5 B;  2YFW A;  3MGP A;  2HIO B;  3LEL B;  2HIO A;  3LEL A;  4KUD C;  3UT9 D;  2CV5 D;  1HTA A;  1JFI B;  3WKJ B;  1JFI A;  4ZBJ B;  4ZUX D;  3WA9 C;  3W97 D;  3WKJ A;  5AV6 D;  5B1M B;  3MNN D;  3AN2 A;  3WAA D;  4WU9 D;  4J8V C;  3X1T C;  3WTP D;  5B40 C;  3REL C;  4Z66 D;  3KWQ C;  5B2I B;  3B0C W;  2NQB D;  1S32 D;  3AZH C;  4AWL C;  1EQZ D;  5GXQ D;  3UTB A;  2RVQ D; 
#chains in the Genus database with same CATH topology
 3AZL B;  5AVC C;  3AZL A;  3WTP E;  3NQJ A;  1KX3 D;  1TZY C;  5GT3 B;  3AYW C;  5AV9 D;  5GT3 A;  4YM6 B;  1P3F D;  4YM6 A;  1ZLA C;  5GT0 B;  2G5H C;  3VH5 W;  5B32 D;  1KX5 C;  5DNM C;  3AZM B;  2HUE B;  1HQ3 D;  3B0D B;  3W99 C;  5CP6 C;  5AY8 D;  5B31 B;  3C1C D;  4J8U D;  5B31 A;  2ZY5 A;  3LZ0 C;  3AZE C;  4R8P D;  3W98 B;  3W98 A;  5B0Z D;  5BO0 B;  1M19 B;  5BO0 A;  1M19 A;  4J8W D;  3UT9 B;  3UT9 A;  4DRB A;  3LZ1 C;  3A1K A;  3AZF C;  2CV5 A;  3KFU G;  4ZUX B;  2PYO C;  4ZUX A;  1P3K D;  1F1E A;  5AV6 B;  5AV6 A;  3MNN B;  3MNN A;  3WAA A;  3B0C T;  4WU9 B;  4WU9 A;  5KDM B;  5KDM A;  4WU8 C;  4NE6 A;  3WTP B;  3WTP A;  3REI B;  4Z66 A;  4Z2M H;  4JJN C;  2Y2L A;  2NQB A;  4CAY B;  1S32 A;  1B6W A;  4CAY A;  1P3B D;  3FDD A;  3VH5 T;  3KXB C;  4Z5T D;  1EQZ A;  5GXQ A;  5BT1 D;  4QLC C;  5F99 C;  1U35 D;  3C1B C;  3UTA C;  1KX3 B;  1P3F B;  3REH D;  5AV9 B;  1P3F A;  1KX3 A;  5AV9 A;  4G92 C;  5B32 B;  5B32 A;  5B2J C;  3TU4 C;  2CWE A;  1HQ3 B;  1HQ3 A;  3MGR D;  2NZD C;  5AY8 B;  5AY8 A;  3AFA D;  3C1C B;  3C1C A;  4R8P B;  1P3I D;  4R8P A;  2F8N H;  5B0Z A;  4H9P A;  1M18 C;  3VH6 A;  4UUZ B;  3KUY D;  4J8W B;  4UUZ A;  5CPK C;  4J8W A;  2FJ7 B;  2FJ7 A;  3B6F C;  1P3K B;  2F8N K;  2G5I C;  1P3K A;  3MGS D;  3LJA D;  4X23 B;  3AV1 D;  2ARO D;  4X23 A;  3REJ C;  1P3M C;  1WWS A;  2BYK B;  2BYK A;  3O62 B;  4XZQ B;  3AZI B;  3AZI A;  1P3G C;  1P3B A;  4Z5T B;  4Z5T A;  5DNN B;  1BH9 B;  3AZK C;  1ID3 C;  1BH9 A;  1Z2C B;  1F66 B;  1F66 A;  3REH B;  3KSY A;  2ZY2 A;  3REH A;  3B6G C;  4EO5 C;  5CPI D;  4J8X B;  3LEL C;  1P3O D;  4ZBJ C;  4WV4 B;  4KGC D;  3MGR A;  5JRG C;  5B1M C;  3REK B;  2YFV B;  1P34 C;  4E44 A;  1P3I B;  1P3I A;  1TAF B;  1TAF A;  3KUY A;  4KUD D;  2YFW B;  5E5A D;  5B2I C;  3WA9 D;  2BYM B;  2Y2Q A;  4DRA A;  2BYM A;  3LJA B;  3AV1 B;  3LJA A;  2ARO B;  3AV1 A;  2ARO A;  5CHL B;  4J8V D;  4HGA B;  4H9R A;  3AN2 B;  4YS3 C;  5AV5 B;  3X1T D;  5AV5 A;  5GT3 C;  5GT0 C;  3KWQ D;  5B31 G;  3AZH D;  3AZM C;  1KX4 D;  2HUE C;  3B0D C;  1R4V A;  3MVD C;  1ULY A;  4KHA B;  5BNX A;  3EG5 B;  4KHA A;  5AVC D;  4E45 A;  1TZY D;  2DF4 C;  3AYW D;  3W98 C;  1ZLA D;  5CPI B;  3NQJ B;  3P5J B;  5CPI A;  5B1L D;  1P3A D;  5B24 C;  1M19 C;  1M1A C;  1P3O A;  4H9S A;  1KX5 D;  3A6N C;  1N1J B;  3NQU B;  1N1J A;  3W99 D;  3NQU A;  3VH6 W;  5B33 A;  5B33 B;  5CP6 D;  5CPJ C;  4KGC B;  4KGC A;  1P3P D;  5BNV B;  3MNN C;  5BNV A;  3LZ0 D;  2Y2H A;  3AV2 C;  4KUD B;  3REI C;  4KUD A;  3LZ1 D;  3AZJ C;  5E5A B;  3AZF D;  5E5A A;  2RIQ A;  3F6T A;  2PYO D;  3WA9 B;  3WA9 A;  2CV5 B;  5B32 G;  3W97 B;  3W97 A;  4J8V B;  4J8V A;  3WAA B;  4WU8 D;  1P3F C;  3AZG C;  4JJN D;  4Z66 B;  5AV8 C;  2F2A C;  3AZH B;  3KXB D;  4AWL B;  3AZH A;  1KX4 B;  3IP4 C;  1KX4 A;  2NQB B;  5F99 D;  4QLC D;  1S32 B;  5AVC B;  5AY8 C;  5AVC A;  2JSS A;  2Y2I A;  3C1B D;  1EQZ B;  5GXQ B;  3UTA D;  3VH6 T;  1TZY A;  2Y2G A;  3AYW A;  1ZLA B;  1ZLA A;  3X1S C;  5B1L B;  1P3A B;  5B1L A;  4H9N B;  1P3A A;  2FJ7 C;  4H9N A;  4J8W C;  1KX5 A;  1WWI A;  2ZY3 A;  4NE3 A;  5CP6 A;  2NZD D;  1P3P B;  1P3P A;  4X23 C;  3X1V C;  5AVB D;  5FUG B;  4J8U B;  1M18 D;  5FUG A;  4J8U A;  5CPK D;  3B6F D;  5B0Z B;  3LZ1 B;  3LZ1 A;  3AZF A;  4H9P B;  3O62 C;  4XZQ C;  3H0L C;  2Y2K A;  3AZI C;  3REJ D;  1P3M D;  5DNN C;  1F66 C;  4WU8 A;  4LD9 C;  5GSU C;  4J8X C;  5C3I C;  4JJN B;  4JJN A;  3AZN C;  3MGQ C;  1P3G D;  3W96 D;  3KXB B;  4H9O B;  5B0Y D;  3KXB A;  4H9O A;  2IO5 C;  5F99 B;  4QLC B;  5F99 A;  4QLC A;  3X1U C;  1ID3 D;  1P3B B;  3AZK D;  1P3L C;  3EPJ A;  3C1B B;  3UTA B;  3C1B A;  3REK C;  3UTA A;  4H9Q B;  4H9Q A;  3B6G D;  4G92 B;  1U35 B;  1AOI C;  2F8N D;  1U35 A;  4XUJ C;  5BS7 C;  1BH8 B;  1BH8 A;  2Y2O A;  3MGP C;  2HIO C;  2NZD B;  4WZS B;  5JRG D;  2NZD A;  5B1M D;  3LJA C;  3WKJ C;  3MGR B;  1P34 D;  4HGA C;  4UPK A;  3AFA B;  3AN2 C;  5AVB B;  5AV5 C;  3AFA A;  5AVB A;  5CPK B;  5CPK A;  3H0R C;  3KUY B;  5B2I D;  3REJ A;  3EPH A;  1P3M A;  2JE5 A;  4WNN B;  4YS3 D;  3MGS B;  4WNN A;  3MGS A;  3UTB C;  5GT3 D;  5JA4 B;  4H9R B;  3AZL C;  3R45 B;  5JA4 A;  5GT0 D;  3R45 A;  5B40 D;  3REL D;  4YM6 C;  3W96 B;  1P3G A;  3W96 A;  4WJ3 C;  5B0Y B;  3AZM D;  5B0Y A;  5B33 C;  3MVD D;  1ID3 B;  3V9R A;  1ID3 A;  1B67 A;  3B6G B;  2XD5 A;  5BNX B;  2F8N B;  3B6G A;  2F8N A;  1M19 D;  5B31 C;  5B24 D;  1M1A D;  4NFT A;  2W8S A;  3A6N D;  5E5A C;  1P3O B;  5CPJ D;  3UT9 C;  5DNM D;  5JRG B;  5JRG A;  2CV5 C;  5B1M A;  4G91 B;  4ZUX C;  1P34 B;  3W97 C;  1P34 A;  5AV6 C;  2ZM5 A;  3EPL A;  3WAA C;  3AZE D;  3AV2 D;  4WU9 C;  3REI D;  3AL0 C;  3AZJ D;  3WTP C;  5B2I A;  2BG1 A;  4Z66 C;  1KX4 C;  2NQB C;  1S32 C;  4YS3 B;  4YS3 A;  1EQZ C;  4NE5 A;  5GXQ C;  2RVQ C;  5GT0 A;  3X1T B;  2Y2J A;  5B1L C;  3AZG D;  3X1T A;  5B40 B;  1P3A C;  5AV9 C;  5B40 A;  3REL B;  3REL A;  1KX3 C;  5AV8 D;  3A1I A;  3KWQ B;  5B32 C;  3KWQ A;  3AZM A;  2FFF B;  3MVD B;  3MVD A;  2Y2M A;  1P3P C;  1HQ3 C;  3X1S D;  1TZY B;  5B24 B;  3C1C C;  5B24 A;  4J8U C;  3AYW B;  1M1A B;  4R8P C;  1M1A A;  2FJ7 D;  5B0Z C;  3A6N B;  3A6N A;  5B2J D;  5CPJ B;  1KX5 B;  5DNM B;  5CPJ A;  5DNM A;  3TU4 D;  2ZY4 A;  3W99 B;  5CP6 B;  5G49 B;  4X23 D;  3W99 A;  5G49 A;  1P3K C;  3X1V D;  3AZE B;  1A7W A;  3AZE A;  3LZ0 B;  3AV2 B;  3LZ0 A;  2DQN C;  3AV2 A;  3REI A;  3AZJ B;  3AZJ A;  3O62 D;  4XZQ D;  3AZI D;  3AZF B;  2PYO B;  2LY8 A;  2PYO A;  5DNN D;  1P3B C;  1F66 D;  4Z5T C;  3UTB B;  5BT1 C;  1U35 C;  4LD9 D;  2XD1 A;  5GSU D;  4WU8 B;  4J8X D;  3AZG A;  3AZG B;  3REH C;  1H3O B;  1H3O A;  3AZN D;  5AV8 B;  3MGQ D;  5AV8 A;  2Y2N A;  3X1U D;  1P3L D;  4Z2M G;  3REK D;  2L5A A;  3MGR C;  3X1S B;  1AOI D;  3X1S A;  4XUJ D;  3VH5 A;  3AFA C;  5AVB C;  1P3I C;  3MGP D;  2HIO D;  3LEL D;  5B2J B;  5B2J A;  3KUY C;  3B0B A;  3TU4 B;  3TU4 A;  3WKJ D;  4M6B A;  3AN2 D;  3X1V B;  3MGS C;  3X1V A;  5AV5 D;  3AV1 C;  2ARO C;  2JCH A;  1M18 B;  3O62 A;  1M18 A;  3B6F B;  4XZQ A;  3B6F A;  2UWX A;  4DQY B;  3W96 C;  2F8N G;  5B0Y C;  1KU5 A;  5DNN A;  1BFM A;  3REJ B;  3UTB D;  1P3M B;  4LD9 B;  3AZL D;  4LD9 A;  5GSU B;  5C3I B;  5GSU A;  4J8X A;  4YM6 D;  3AZN B;  3MGQ B;  3AZN A;  5CPI C;  3MGQ A;  2Y2P A;  2VQR A;  2IO5 B;  5B33 D;  4H9S C;  1P3O C;  3X1U B;  4CSR B;  1P3G B;  3X1U A;  4CSR A;  1P3L B;  1P3L A;  3EPK A;  3REK A;  4G91 C;  2YFV A;  3V9R B;  4KGC C;  1AOI B;  3AZK B;  1AOI A;  4XUJ B;  3AZK A;  4XUJ A;  5B31 D;  5BS7 A;  3W98 D;  3MGP B;  1Q9C A;  4EO5 B;  2YFW A;  3MGP A;  2HIO B;  3LEL B;  2HIO A;  3LEL A;  4KUD C;  3UT9 D;  1W2E A;  2CV5 D;  1HTA A;  1PZR A;  1JFI B;  3WKJ B;  1JFI A;  4ZBJ B;  4ZUX D;  3WA9 C;  1T3U A;  3W97 D;  5AV6 D;  3WKJ A;  5B1M B;  3MNN D;  3AN2 A;  3WAA D;  4WU9 D;  4J8V C;  3X1T C;  3WTP D;  3H0M C;  3REL C;  5B40 C;  4Z66 D;  3KWQ C;  5B2I B;  3B0C W;  2NQB D;  1S32 D;  3AZH C;  2J8P A;  4AWL C;  1EQZ D;  5GXQ D;  3UTB A;  2RVQ D; 
#chains in the Genus database with same CATH homology
 3AZL B;  5AVC C;  3AZL A;  3WTP E;  3NQJ A;  1KX3 D;  1TZY C;  5GT3 B;  3AYW C;  5AV9 D;  5GT3 A;  4YM6 B;  1P3F D;  4YM6 A;  1ZLA C;  5GT0 B;  2G5H C;  3VH5 W;  5B32 D;  1KX5 C;  5DNM C;  3AZM B;  2HUE B;  1HQ3 D;  3B0D B;  3W99 C;  5CP6 C;  5AY8 D;  5B31 B;  3C1C D;  4J8U D;  5B31 A;  2ZY5 A;  3LZ0 C;  3AZE C;  4R8P D;  3W98 B;  3W98 A;  5B0Z D;  5BO0 B;  1M19 B;  5BO0 A;  1M19 A;  4J8W D;  3UT9 B;  3UT9 A;  4DRB A;  3LZ1 C;  3A1K A;  3AZF C;  2CV5 A;  3KFU G;  4ZUX B;  2PYO C;  4ZUX A;  1P3K D;  1F1E A;  5AV6 B;  5AV6 A;  3MNN B;  3MNN A;  3WAA A;  3B0C T;  4WU9 B;  4WU9 A;  5KDM B;  5KDM A;  4WU8 C;  4NE6 A;  3WTP B;  3WTP A;  3REI B;  4Z66 A;  4Z2M H;  4JJN C;  2Y2L A;  2NQB A;  4CAY B;  1S32 A;  1B6W A;  4CAY A;  1P3B D;  3FDD A;  3VH5 T;  3KXB C;  4Z5T D;  1EQZ A;  5GXQ A;  5BT1 D;  4QLC C;  5F99 C;  1U35 D;  3C1B C;  3UTA C;  1KX3 B;  1P3F B;  3REH D;  5AV9 B;  1P3F A;  1KX3 A;  5AV9 A;  4G92 C;  5B32 B;  5B32 A;  5B2J C;  3TU4 C;  2CWE A;  1HQ3 B;  1HQ3 A;  3MGR D;  2NZD C;  5AY8 B;  5AY8 A;  3AFA D;  3C1C B;  3C1C A;  4R8P B;  1P3I D;  4R8P A;  2F8N H;  5B0Z A;  4H9P A;  1M18 C;  3VH6 A;  4UUZ B;  3KUY D;  4J8W B;  4UUZ A;  5CPK C;  4J8W A;  2FJ7 B;  2FJ7 A;  3B6F C;  1P3K B;  2F8N K;  2G5I C;  1P3K A;  3MGS D;  3LJA D;  4X23 B;  3AV1 D;  2ARO D;  4X23 A;  3REJ C;  1P3M C;  1WWS A;  2BYK B;  2BYK A;  3O62 B;  4XZQ B;  3AZI B;  3AZI A;  1P3G C;  1P3B A;  4Z5T B;  4Z5T A;  5DNN B;  1BH9 B;  3AZK C;  1ID3 C;  1BH9 A;  1Z2C B;  1F66 B;  1F66 A;  3REH B;  3KSY A;  2ZY2 A;  3REH A;  3B6G C;  4EO5 C;  5CPI D;  4J8X B;  3LEL C;  1P3O D;  4ZBJ C;  4WV4 B;  4KGC D;  3MGR A;  5JRG C;  5B1M C;  3REK B;  2YFV B;  1P34 C;  4E44 A;  1P3I B;  1P3I A;  1TAF B;  1TAF A;  3KUY A;  4KUD D;  2YFW B;  5E5A D;  5B2I C;  3WA9 D;  2BYM B;  2Y2Q A;  4DRA A;  2BYM A;  3LJA B;  3AV1 B;  3LJA A;  2ARO B;  3AV1 A;  2ARO A;  5CHL B;  4J8V D;  4HGA B;  4H9R A;  3AN2 B;  4YS3 C;  5AV5 B;  3X1T D;  5AV5 A;  5GT3 C;  5GT0 C;  3KWQ D;  5B31 G;  3AZH D;  3AZM C;  1KX4 D;  2HUE C;  3B0D C;  1R4V A;  3MVD C;  1ULY A;  4KHA B;  5BNX A;  3EG5 B;  4KHA A;  5AVC D;  4E45 A;  1TZY D;  2DF4 C;  3AYW D;  3W98 C;  1ZLA D;  5CPI B;  3NQJ B;  3P5J B;  5CPI A;  5B1L D;  1P3A D;  5B24 C;  1M19 C;  1M1A C;  1P3O A;  4H9S A;  1KX5 D;  3A6N C;  1N1J B;  3NQU B;  1N1J A;  3W99 D;  3NQU A;  3VH6 W;  5B33 A;  5B33 B;  5CP6 D;  5CPJ C;  4KGC B;  4KGC A;  1P3P D;  5BNV B;  3MNN C;  5BNV A;  3LZ0 D;  2Y2H A;  3AV2 C;  4KUD B;  3REI C;  4KUD A;  3LZ1 D;  3AZJ C;  5E5A B;  3AZF D;  5E5A A;  2RIQ A;  3F6T A;  2PYO D;  3WA9 B;  3WA9 A;  2CV5 B;  5B32 G;  3W97 B;  3W97 A;  4J8V B;  4J8V A;  3WAA B;  4WU8 D;  1P3F C;  3AZG C;  4JJN D;  4Z66 B;  5AV8 C;  2F2A C;  3AZH B;  3KXB D;  4AWL B;  3AZH A;  1KX4 B;  3IP4 C;  1KX4 A;  2NQB B;  5F99 D;  4QLC D;  1S32 B;  5AVC B;  5AY8 C;  5AVC A;  2JSS A;  2Y2I A;  3C1B D;  1EQZ B;  5GXQ B;  3UTA D;  3VH6 T;  1TZY A;  2Y2G A;  3AYW A;  1ZLA B;  1ZLA A;  3X1S C;  5B1L B;  1P3A B;  5B1L A;  4H9N B;  1P3A A;  2FJ7 C;  4H9N A;  4J8W C;  1KX5 A;  1WWI A;  2ZY3 A;  4NE3 A;  5CP6 A;  2NZD D;  1P3P B;  1P3P A;  4X23 C;  3X1V C;  5AVB D;  5FUG B;  4J8U B;  1M18 D;  5FUG A;  4J8U A;  5CPK D;  3B6F D;  5B0Z B;  3LZ1 B;  3LZ1 A;  3AZF A;  4H9P B;  3O62 C;  4XZQ C;  3H0L C;  2Y2K A;  3AZI C;  3REJ D;  1P3M D;  5DNN C;  1F66 C;  4WU8 A;  4LD9 C;  5GSU C;  4J8X C;  5C3I C;  4JJN B;  4JJN A;  3AZN C;  3MGQ C;  1P3G D;  3W96 D;  3KXB B;  4H9O B;  5B0Y D;  3KXB A;  4H9O A;  2IO5 C;  5F99 B;  4QLC B;  5F99 A;  4QLC A;  3X1U C;  1ID3 D;  1P3B B;  3AZK D;  1P3L C;  3EPJ A;  3C1B B;  3UTA B;  3C1B A;  3REK C;  3UTA A;  4H9Q B;  4H9Q A;  3B6G D;  4G92 B;  1U35 B;  1AOI C;  2F8N D;  1U35 A;  4XUJ C;  5BS7 C;  1BH8 B;  1BH8 A;  2Y2O A;  3MGP C;  2HIO C;  2NZD B;  4WZS B;  5JRG D;  2NZD A;  5B1M D;  3LJA C;  3WKJ C;  3MGR B;  1P34 D;  4HGA C;  4UPK A;  3AFA B;  3AN2 C;  5AVB B;  5AV5 C;  3AFA A;  5AVB A;  5CPK B;  5CPK A;  3H0R C;  3KUY B;  5B2I D;  3REJ A;  3EPH A;  1P3M A;  2JE5 A;  4WNN B;  4YS3 D;  3MGS B;  4WNN A;  3MGS A;  3UTB C;  5GT3 D;  5JA4 B;  4H9R B;  3AZL C;  3R45 B;  5JA4 A;  5GT0 D;  3R45 A;  5B40 D;  3REL D;  4YM6 C;  3W96 B;  1P3G A;  3W96 A;  4WJ3 C;  5B0Y B;  3AZM D;  5B0Y A;  5B33 C;  3MVD D;  1ID3 B;  3V9R A;  1ID3 A;  1B67 A;  3B6G B;  2XD5 A;  5BNX B;  2F8N B;  3B6G A;  2F8N A;  1M19 D;  5B31 C;  5B24 D;  1M1A D;  4NFT A;  2W8S A;  3A6N D;  5E5A C;  1P3O B;  5CPJ D;  3UT9 C;  5DNM D;  5JRG B;  5JRG A;  2CV5 C;  5B1M A;  4G91 B;  4ZUX C;  1P34 B;  3W97 C;  1P34 A;  5AV6 C;  2ZM5 A;  3EPL A;  3WAA C;  3AZE D;  3AV2 D;  4WU9 C;  3REI D;  3AL0 C;  3AZJ D;  3WTP C;  5B2I A;  2BG1 A;  4Z66 C;  1KX4 C;  2NQB C;  1S32 C;  4YS3 B;  4YS3 A;  1EQZ C;  4NE5 A;  5GXQ C;  2RVQ C;  5GT0 A;  3X1T B;  2Y2J A;  5B1L C;  3AZG D;  3X1T A;  5B40 B;  1P3A C;  5AV9 C;  5B40 A;  3REL B;  3REL A;  1KX3 C;  5AV8 D;  3A1I A;  3KWQ B;  5B32 C;  3KWQ A;  3AZM A;  2FFF B;  3MVD B;  3MVD A;  2Y2M A;  1P3P C;  1HQ3 C;  3X1S D;  1TZY B;  5B24 B;  3C1C C;  5B24 A;  4J8U C;  3AYW B;  1M1A B;  4R8P C;  1M1A A;  2FJ7 D;  5B0Z C;  3A6N B;  3A6N A;  5B2J D;  5CPJ B;  1KX5 B;  5DNM B;  5CPJ A;  5DNM A;  3TU4 D;  2ZY4 A;  3W99 B;  5CP6 B;  5G49 B;  4X23 D;  3W99 A;  5G49 A;  1P3K C;  3X1V D;  3AZE B;  1A7W A;  3AZE A;  3LZ0 B;  3AV2 B;  3LZ0 A;  2DQN C;  3AV2 A;  3REI A;  3AZJ B;  3AZJ A;  3O62 D;  4XZQ D;  3AZI D;  3AZF B;  2PYO B;  2LY8 A;  2PYO A;  5DNN D;  1P3B C;  1F66 D;  4Z5T C;  3UTB B;  5BT1 C;  1U35 C;  4LD9 D;  2XD1 A;  5GSU D;  4WU8 B;  4J8X D;  3AZG A;  3AZG B;  3REH C;  1H3O B;  1H3O A;  3AZN D;  5AV8 B;  3MGQ D;  5AV8 A;  2Y2N A;  3X1U D;  1P3L D;  4Z2M G;  3REK D;  2L5A A;  3MGR C;  3X1S B;  1AOI D;  3X1S A;  4XUJ D;  3VH5 A;  3AFA C;  5AVB C;  1P3I C;  3MGP D;  2HIO D;  3LEL D;  5B2J B;  5B2J A;  3KUY C;  3B0B A;  3TU4 B;  3TU4 A;  3WKJ D;  4M6B A;  3AN2 D;  3X1V B;  3MGS C;  3X1V A;  5AV5 D;  3AV1 C;  2ARO C;  2JCH A;  1M18 B;  3O62 A;  1M18 A;  3B6F B;  4XZQ A;  3B6F A;  2UWX A;  4DQY B;  3W96 C;  2F8N G;  5B0Y C;  1KU5 A;  5DNN A;  1BFM A;  3REJ B;  3UTB D;  1P3M B;  4LD9 B;  3AZL D;  4LD9 A;  5GSU B;  5C3I B;  5GSU A;  4J8X A;  4YM6 D;  3AZN B;  3MGQ B;  3AZN A;  5CPI C;  3MGQ A;  2Y2P A;  2VQR A;  2IO5 B;  5B33 D;  4H9S C;  1P3O C;  3X1U B;  4CSR B;  1P3G B;  3X1U A;  4CSR A;  1P3L B;  1P3L A;  3EPK A;  3REK A;  4G91 C;  2YFV A;  3V9R B;  4KGC C;  1AOI B;  3AZK B;  1AOI A;  4XUJ B;  3AZK A;  4XUJ A;  5B31 D;  5BS7 A;  3W98 D;  3MGP B;  1Q9C A;  4EO5 B;  2YFW A;  3MGP A;  2HIO B;  3LEL B;  2HIO A;  3LEL A;  4KUD C;  3UT9 D;  1W2E A;  2CV5 D;  1HTA A;  1PZR A;  1JFI B;  3WKJ B;  1JFI A;  4ZBJ B;  4ZUX D;  3WA9 C;  1T3U A;  3W97 D;  5AV6 D;  3WKJ A;  5B1M B;  3MNN D;  3AN2 A;  3WAA D;  4WU9 D;  4J8V C;  3X1T C;  3WTP D;  3H0M C;  3REL C;  5B40 C;  4Z66 D;  3KWQ C;  5B2I B;  3B0C W;  2NQB D;  1S32 D;  3AZH C;  2J8P A;  4AWL C;  1EQZ D;  5GXQ D;  3UTB A;  2RVQ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...