4LD9B

Crystal structure of the n-terminally acetylated bah domain of sir3 bound to the nucleosome core particle
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
89
structure length
89
Chain Sequence
KGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nuclear protein/transcription/dna
molecule keywords Histone H3.2
publication title The N-terminal acetylation of Sir3 stabilizes its binding to the nucleosome core particle.
pubmed doi rcsb
source organism Xenopus laevis
total genus 27
structure length 89
sequence length 89
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4ld9B00
5CPID 3B0CT 1P3PA 1HQ3A 1JFIA 3AZNB 3AN2B 3MNND 3C1CA 3WAAA 5B1MA 5GSUD 4X23A 5B0ZD 2BYMB 3W98A 1ULYA 3A6ND 5B32C 4Z66B 3UTBD 1M19A 3KSYA 3AZMC 3UTAB 3KXBB 4YM6C 3REKA 1HTAA 5CPKD 3LELC 4H9QB 1KU5A 5DNMD 1P3ID 5B0ZA 5BO0A 4J8WB 4R8PD 3B0CW 1KX4D 1P3OA 5GT0C 3X1TB 3AZLD 5B1LD 3LZ0D 3MGRA 4EO5C 4UUZA 4QLCC 1P34D 1B6WA 1P3KA 5CPKA 3REJB 4H9PB 5DNMA 1P3IA 4E44A 3RELB 3AZFA 2HUEC 4M6BA 3WA9B 1KX4A 3X1VB 1AOID 4J8XD 2L5AA 5AY8C 2JSSA 4KUDD 5B1LA 3VH6A 5AVCD 3KUYA 3AZEB 4ZBJB 5CPJC 2HIOC 4J8VC 1P34A 1TAFA 3TU4C 4J8UD 5B31D 4Z5TD 1P3GD 3AZKA 5B24D 1N1JA 5JRGC 4AWLB 3X1SB 1BH9B 2CWEA 5B2IA 3AV1C 3B6FB 4KUDA 3W99B 5AVCA 4LD9D 1M18B 5AV9D 2IO5C 3VH5T 3AZJC 2AROB 5E5AB 4HGAC 3WTPB 4ZUXC 5B33D 5GXQC 4G91B 5B0YA 4J8UA 5B31A 2YFVB 4Z5TA 5AV6D 5BNXA 1P3GA 1ZLAB 5JA4A 1F66D 3W96B 4YS3C 3C1BC 3X1UD 4LD9A 3AZIA 2CV5A 1ID3D 5AV5D 3MGPB 4NE5A 3AZGD 5B40C 3UT9C 1P3BA 1BFMA 5B33A 3KWQA 2FJ7B 3AYWA 3W97C 1S32D 2YFWB 5CPIB 3AZHB 1U35D 5FUGA 5AVBC 5KDMA 4WU8C 3NQUA 3MNNB 5BT1D 5GSUB 4CAYA 4H9OA 2BYKA 3MVDB 2LY8A 1EQZB 3A6NB 3AZNC 5F99B 3AN2C 3UTBB 3MGSD 3R45A 5AV8D 1U35A 4XUJD 4JJNA 1P3AD 1TZYD 1KX5D 3O62D 4Z66C 3REIA 4R8PB 3B0DB 4WNNB 1P3FD 1H3OB 3UTAC 3B6GD 3KXBC 5CP6A 2F8NK 3AZLB 2NZDD 4J8WC 2PYOB 4XUJA 3LZ0B 5GT3A 3LZ1B 1P3PD 1HQ3D 3X1TC 1KX5A 5B1MD 3AV2B 4X23D 3B0BA 4NFTA 1AOIB 3W98D 4H9SC 4J8XB 3REJC 1M19D 1Q9CA 3RELC 3WA9C 5GT0D 3X1VC 3NQJB 5B32A 3V9RA 3REKD 3AZEC 1M1AB 5B2JC 3AZMA 3VH6W 4CSRB 4ZBJC 5B24B 4YM6A 1P3OD 3LELA 3REHB 5AV9B 3MGQB 5B31G 2RVQC 3MGRD 1P3LB 5GT0A 4AWLC 5AY8D 3X1SC 4WU9B 3B6FC 3W99C 1P3KD 1M18C 2NQBB 3WKJB 5AV6B 2AROC 5E5AC 3AZFD 5CPJD 1F66B 2HIOD 4QLCA 3WTPC 3X1UB 1P3MD 3KUYD 4G91C 1ID3B 5AV5B 3AZGB 1ZLAC 5DNNB 3W96C 5AY8A 4H9RA 5G49B 1F1EA 1S32B 4KHAA 3MGPC 3LJAB 3AZKD 2HIOA 5CPJA 4J8VA 1WWIA 5B2ID 2FJ7C 2F8NA 1P3MA 3TU4A 5B2JB 5CPIC 3AZHC 4KGCB 5JRGA 3AV1A 4H9NB 3MNNC 5GSUC 3MGSB 5AV8B 3AZJA 5B0YD 4XZQB 3MVDC 1P3AB 5B40D 1EQZC 1TZYB 3A6NC 4ZUXA 3W97D 5F99C 5GXQA 1KX3B 3O62B 3AZID 1BH8B 3UTBC 2CV5D 1P3FB 5AVBD 4YS3A 3B6GB 3C1BA 3AFAB 1P3BD 2NZDB 3KWQD 3AYWD 4R8PC 3B0DC 5B40A 1P3PB 3UT9A 1JFIB 3W97A 3AZLC 3C1CB 3WAAB 5B1MB 4X23B 2PYOC 3LZ0C 5C3IB 5AVBA 3LZ1C 3W98B 4WU8A 3AV2C 1M19B 4JJND 4NE3A 1AOIC 3AZNA 4J8XC 3AN2A 3REKB 4J8WD 5B0ZB 5BO0B 3REID 2BYMA 1P3OB 5CP6D 4Z66A 5CHLB 1M1AC 5GT3D 3MGRB 5B24C 3UTAA 4UUZB 3KXBA 3REHC 3REJD 4H9QA 5CPKB 1P3KB 5DNMB 4J8WA 3WTPE 5AV9C 1P3IB 3MGQC 3AZFB 1P3LC 3X1VD 5BNVB 1KX4B 3X1TA 4WU9C 5B1LB 3KUYB 2NQBC 3WKJC 5AV6C 3VH6T 1F66C 4H9SA 3X1UC 1P34B 3REJA 4H9PA 5B32D 1TAFB 3RELA 1ID3C 3AZMD 2RVQD 5AV5C 3AZGC 3WA9A 3AZKB 5DNNC 3X1VA 1A7WA 1N1JB 4YM6D 3X1SD 5B2IB 3B6FD 4KUDB 3LELD 3AZEA 5AVCB 5B2JA 1S32C 2AROD 5E5AD 3LJAC 5BT1C 5B0YB 4J8UB 5B31B 4DRAA 4Z5TB 1P3GB 5BNXB 4KGCC 3W96D 4DRBA 5JA4B 1BH9A 3X1SA 4QLCD 3VH5A 3B6FA 3W99A 4LD9B 3AZIB 5BS7C 1M18A 3MGSC 5AV8C 2CV5B 2AROA 5E5AA 4XZQC 1P3AC 1TZYC 3WTPA 1P3BB 2FJ7D 5B33B 3KWQB 1KX3C 3O62C 3AZHD 2YFVA 1P3FC 5FUGB 1ZLAA 4WZSB 3W96A 3B6GC 5KDMB 4J8VD 3NQUB 3AFAC 2NZDC 1R4VA 2F8ND 4CAYB 4H9OB 3TU4D 2BYKB 3MVDD 3MGPA 1EQZD 5JRGD 1P3PC 1HQ3C 5F99D 3AV1D 2FJ7A 3WAAC 3C1CC 5B1MC 2YFWA 4X23C 5CPIA 3R45B 3AZHA 3AZJD 1U35B 5C3IC 4JJNB 3W98C 3MNNA 4ZUXD 5GXQD 5GSUA 4WV4B 3REIB 1M19C 3MVDA 1EQZA 3A6NA 4YS3D 5F99A 3C1BD 5CP6B 4G92B 3REKC 3UTBA 2PYOD 5B0ZC 4XUJB 5GT3B 3LZ1D 1P3OC 3UT9D 1KX5B 3AV2D 4R8PA 4WNNA 1H3OA 5BNVA 3MGRC 4WU8D 3AZLA 1P3KC 5CPKC 5DNMC 1P3IC 2PYOA 3LZ0A 3AZFC 3LZ1A 1KX4C 1HQ3B 3AZND 3AN2D 5B32B 3V9RB 3AV2A 1P3MC 5B1LC 3KUYC 1M1AD 3AZMB 1AOIA 4J8XA 4YM6B 3REHD 1P34C 3LELB 5B32G 4Z66D 3MGQD 1P3LD 3AZKC 3UTAD 5GT0B 3NQJA 3KXBD 4WU9D 4NE6A 5B2IC 4KUDC 1M1AA 5AVCC 4CSRA 2NQBD 3WKJD 4EO5B 5B24A 3X1TD 4QLCB 3REHA 5AV9A 3MGQA 5B0YC 4J8UC 5B31C 2HUEB 4Z5TC 1P3GC 1P3LA 4E45A 5DNND 5AY8B 4H9RB 4WU9A 4LD9C 3VH5W 3AZIC 2NQBA 2CV5C 3RELD 1WWSA 4KHAB 5AV6A 3WKJA 3LJAD 1F66A 3WA9D 5CPJB 2HIOB 4J8VB 3X1UA 1P3BC 5B33C 3KWQC 3AYWC 2F8NB 3AZED 3TU4B 5B2JD 1P3MB 1ID3A 5AV5A 3AZGA 4KGCD 5DNNA 5JRGB 3AV1B 5G49A 1S32A 2F8NH 2F8NG 2IO5B 4XZQD 3AZJB 1B67A 4HGAB 3LJAA 4Z2MG 4Z2MH 4ZUXB 1KX3D 5GXQB 3W99D 1M18D 1U35C 4KGCA 4JJNC 4YS3B 3C1BB 4H9NA 3WTPD 3AFAD 5BS7A 3MGSA 5AV8A 3REIC 4XZQA 1P3AA 1ZLAD 5B40B 1TZYA 3UT9B 3W97B 1KX3A 3WAAD 5CP6C 3O62A 3C1CD 4G92C 1BH8A 1P3FA 4XUJC 3MGPD 5GT3C 5AVBB 3B6GA 4WU8B 3AFAA 2NZDA 1KX5C 3AYWB
chains in the Genus database with same CATH superfamily
1PZRA 5CPID 2XD5A 3B0CT 1P3PA 3H0RC 1HQ3A 1JFIA 3AZNB 3AN2B 3MNND 3C1CA 3WAAA 5B1MA 5GSUD 4X23A 5B0ZD 2BYMB 3W98A 1ULYA 3A6ND 5B32C 4Z66B 3UTBD 1M19A 3KSYA 3AZMC 3UTAB 3KXBB 4YM6C 2J8PA 3REKA 1HTAA 3EPLA 5CPKD 3LELC 2Y2OA 1KU5A 4H9QB 5DNMD 5B0ZA 5BO0A 4J8WB 4R8PD 3B0CW 1P3ID 1Z2CB 1KX4D 1P3OA 5GT0C 3X1TB 3AZLD 5B1LD 2ZY2A 3LZ0D 3MGRA 4EO5C 4UUZA 4QLCC 1P34D 1B6WA 1P3KA 5CPKA 3REJB 4H9PB 5DNMA 1P3IA 4E44A 3RELB 2RIQA 3AZFA 2HUEC 4M6BA 3WA9B 1KX4A 3X1VB 1AOID 4J8XD 2L5AA 5AY8C 2JSSA 4KUDD 5B1LA 3VH6A 5AVCD 3KUYA 3AZEB 4ZBJB 5CPJC 2HIOC 4J8VC 1P34A 1TAFA 3TU4C 2Y2HA 4J8UD 5B31D 4Z5TD 1P3GD 3AZKA 2Y2KA 5B24D 1N1JA 5JRGC 4AWLB 1BH9B 2CWEA 5B2IA 3X1SB 3AV1C 3B6FB 4KUDA 3W99B 5AVCA 4LD9D 1M18B 5AV9D 2IO5C 3VH5T 3AZJC 2AROB 5E5AB 4HGAC 3WTPB 4ZUXC 5B33D 5GXQC 4G91B 5B0YA 4J8UA 5B31A 2YFVB 4Z5TA 5AV6D 5BNXA 1P3GA 1ZLAB 5JA4A 1F66D 2W8SA 3W96B 4YS3C 3C1BC 3X1UD 4LD9A 3AZIA 1T3UA 2CV5A 1ID3D 5AV5D 3MGPB 4NE5A 3AZGD 5B40C 3UT9C 1P3BA 1BFMA 3IP4C 5B33A 3KWQA 3AYWA 2FJ7B 3W97C 1S32D 2YFWB 5CPIB 3AZHB 1U35D 5FUGA 5AVBC 5KDMA 4WU8C 3NQUA 3MNNB 5BT1D 5GSUB 4CAYA 4H9OA 2BYKA 3MVDB 2LY8A 1EQZB 3EPHA 3A6NB 3AZNC 5F99B 3AN2C 3UTBB 3MGSD 3R45A 5AV8D 1U35A 4XUJD 4JJNA 1P3AD 1TZYD 4DQYB 2Y2PA 3EPJA 1KX5D 3O62D 4Z66C 3REIA 4R8PB 3B0DB 4WNNB 1P3FD 1H3OB 3UTAC 3B6GD 3KXBC 5CP6A 2F8NK 3AZLB 2NZDD 4J8WC 2PYOB 4XUJA 3LZ0B 5GT3A 3LZ1B 1P3PD 1HQ3D 3X1TC 1KX5A 5B1MD 3AV2B 4X23D 3B0BA 4NFTA 1AOIB 3W98D 4H9SC 4J8XB 2Y2GA 3REJC 1M19D 1Q9CA 3RELC 2XD1A 3WA9C 5GT0D 3X1VC 3NQJB 5B32A 3V9RA 3REKD 2G5IC 3AZEC 1M1AB 2Y2JA 5B2JC 3VH6W 3AZMA 4CSRB 4ZBJC 5B24B 4YM6A 3H0MC 1P3OD 2ZY3A 3LELA 3REHB 4WJ3C 5AV9B 2DF4C 3MGQB 5B31G 2RVQC 3MGRD 1P3LB 5GT0A 4AWLC 5AY8D 3X1SC 4WU9B 3B6FC 3W99C 1P3KD 1M18C 2NQBB 3WKJB 5AV6B 2AROC 5E5AC 3AZFD 5CPJD 1F66B 2HIOD 4QLCA 3WTPC 2Y2LA 3X1UB 1P3MD 3KUYD 4G91C 1ID3B 5AV5B 3AZGB 1W2EA 1ZLAC 5DNNB 3W96C 5AY8A 4H9RA 2Y2QA 5G49B 1F1EA 1S32B 4KHAA 2ZY5A 3MGPC 3LJAB 2UWXA 2HIOA 3AZKD 5CPJA 4J8VA 3KFUG 1WWIA 5B2ID 2FJ7C 2F8NA 1P3MA 3TU4A 5B2JB 5CPIC 3AZHC 4KGCB 5JRGA 3AV1A 4H9NB 3MNNC 5GSUC 3MGSB 5AV8B 3AZJA 5B0YD 4XZQB 3MVDC 1P3AB 5B40D 1EQZC 1TZYB 3P5JB 3A6NC 4ZUXA 3W97D 5F99C 5GXQA 1KX3B 3O62B 3AZID 1BH8B 3UTBC 2CV5D 1P3FB 3EG5B 5AVBD 4YS3A 3B6GB 3C1BA 3AFAB 1P3BD 2NZDB 3KWQD 3AYWD 4R8PC 3B0DC 5B40A 1P3PB 3UT9A 1JFIB 3W97A 3AZLC 3C1CB 3WAAB 5B1MB 4X23B 2PYOC 2F2AC 3LZ0C 5C3IB 5AVBA 3LZ1C 3W98B 4WU8A 3AV2C 1M19B 4JJND 4NE3A 1AOIC 3AZNA 4J8XC 3AN2A 3REKB 4J8WD 5B0ZB 5BO0B 3REID 2BYMA 1P3OB 5CP6D 4Z66A 3A1IA 5CHLB 1M1AC 5GT3D 3MGRB 5B24C 3UTAA 4UUZB 3KXBA 3REHC 2VQRA 4H9QA 3REJD 5CPKB 1P3KB 5DNMB 4J8WA 3WTPE 5AV9C 1P3IB 3MGQC 3AZFB 1P3LC 3X1VD 5BNVB 1KX4B 3X1TA 4WU9C 5B1LB 3KUYB 2NQBC 3WKJC 5AV6C 3VH6T 1F66C 4H9SA 2Y2IA 3X1UC 1P34B 3REJA 4H9PA 5B32D 1TAFB 3RELA 1ID3C 3AZMD 2RVQD 5AV5C 3AZGC 3WA9A 3AZKB 5DNNC 3X1VA 1A7WA 1N1JB 4YM6D 3X1SD 5B2IB 3B6FD 4KUDB 3LELD 3AZEA 5AVCB 5B2JA 1S32C 2AROD 5E5AD 4UPKA 3LJAC 5BT1C 5B0YB 2G5HC 4J8UB 5B31B 4DRAA 4Z5TB 1P3GB 5BNXB 4KGCC 3W96D 4DRBA 5JA4B 1BH9A 3X1SA 4QLCD 3VH5A 3B6FA 3W99A 4LD9B 3AZIB 5BS7C 1M18A 3MGSC 5AV8C 2CV5B 2AROA 5E5AA 4XZQC 1P3AC 1TZYC 3WTPA 1P3BB 2FJ7D 5B33B 3KWQB 1KX3C 3O62C 3H0LC 2YFVA 3AZHD 1P3FC 5FUGB 1ZLAA 4WZSB 3W96A 2DQNC 3B6GC 5KDMB 4J8VD 3NQUB 3AFAC 2NZDC 1R4VA 2F8ND 4CAYB 4H9OB 3TU4D 2BYKB 3MVDD 3MGPA 3EPKA 3AL0C 1EQZD 5JRGD 1P3PC 1HQ3C 5F99D 3AV1D 2FJ7A 3WAAC 3C1CC 5B1MC 2YFWA 4X23C 5CPIA 3R45B 3AZHA 2ZY4A 3AZJD 1U35B 5C3IC 4JJNB 3W98C 3MNNA 4ZUXD 5GXQD 5GSUA 4WV4B 3A1KA 3REIB 1M19C 3MVDA 1EQZA 3A6NA 4YS3D 5F99A 3C1BD 5CP6B 4G92B 3REKC 3UTBA 2PYOD 5B0ZC 2Y2NA 4XUJB 5GT3B 3LZ1D 1P3OC 3UT9D 1KX5B 3AV2D 4R8PA 2BG1A 4WNNA 1H3OA 5BNVA 3MGRC 4WU8D 3AZLA 1P3KC 5CPKC 5DNMC 1P3IC 2PYOA 3LZ0A 3AZFC 3LZ1A 2JE5A 1KX4C 1HQ3B 3AZND 3AN2D 5B32B 3V9RB 3AV2A 1P3MC 5B1LC 3KUYC 1M1AD 3AZMB 1AOIA 4J8XA 4YM6B 3REHD 1P34C 3LELB 5B32G 4Z66D 3MGQD 1P3LD 3AZKC 3UTAD 5GT0B 3NQJA 3KXBD 4WU9D 4NE6A 5B2IC 4KUDC 1M1AA 5AVCC 4CSRA 2NQBD 3WKJD 4EO5B 5B24A 3X1TD 4QLCB 3REHA 5AV9A 3MGQA 5B0YC 4J8UC 5B31C 2HUEB 4Z5TC 1P3GC 1P3LA 4E45A 5DNND 5AY8B 4H9RB 4WU9A 4LD9C 3VH5W 3AZIC 2NQBA 2CV5C 3RELD 1WWSA 4KHAB 5AV6A 3WKJA 3FDDA 3LJAD 1F66A 3WA9D 5CPJB 2HIOB 4J8VB 3X1UA 1P3BC 5B33C 3KWQC 3AYWC 2F8NB 3AZED 3TU4B 5B2JD 1P3MB 1ID3A 5AV5A 3AZGA 2FFFB 4KGCD 5DNNA 5JRGB 3AV1B 5G49A 1S32A 2F8NH 2F8NG 2IO5B 4XZQD 2JCHA 3AZJB 1B67A 4HGAB 3LJAA 4Z2MG 4ZUXB 4Z2MH 1KX3D 5GXQB 3W99D 1M18D 2ZM5A 1U35C 4KGCA 4JJNC 4YS3B 3C1BB 4H9NA 3WTPD 3AFAD 5BS7A 3MGSA 5AV8A 2Y2MA 4XZQA 3REIC 1P3AA 1ZLAD 5B40B 1TZYA 3UT9B 3W97B 1KX3A 3WAAD 5CP6C 3O62A 3C1CD 4G92C 1BH8A 1P3FA 4XUJC 3MGPD 5GT3C 5AVBB 3B6GA 3F6TA 4WU8B 3AFAA 2NZDA 1KX5C 3AYWB
chains in the Genus database with same CATH topology
1PZRA 5CPID 2XD5A 3B0CT 1P3PA 3H0RC 1HQ3A 1JFIA 3AZNB 3AN2B 3MNND 3C1CA 3WAAA 5B1MA 5GSUD 4X23A 5B0ZD 2BYMB 3W98A 1ULYA 3A6ND 5B32C 4Z66B 3UTBD 1M19A 3KSYA 3AZMC 3UTAB 3KXBB 4YM6C 2J8PA 3REKA 1HTAA 3EPLA 5CPKD 3LELC 2Y2OA 1KU5A 4H9QB 5DNMD 5B0ZA 5BO0A 4J8WB 4R8PD 3B0CW 1P3ID 1Z2CB 1KX4D 1P3OA 5GT0C 3X1TB 3AZLD 5B1LD 2ZY2A 3LZ0D 3MGRA 4EO5C 4UUZA 4QLCC 1P34D 1B6WA 1P3KA 5CPKA 3REJB 4H9PB 5DNMA 1P3IA 4E44A 3RELB 2RIQA 3AZFA 2HUEC 4M6BA 3WA9B 1KX4A 3X1VB 1AOID 4J8XD 2L5AA 5AY8C 2JSSA 4KUDD 5B1LA 3VH6A 5AVCD 3KUYA 3AZEB 4ZBJB 5CPJC 2HIOC 4J8VC 1P34A 1TAFA 3TU4C 2Y2HA 4J8UD 5B31D 4Z5TD 1P3GD 3AZKA 2Y2KA 5B24D 1N1JA 5JRGC 4AWLB 1BH9B 2CWEA 5B2IA 3X1SB 3AV1C 3B6FB 4KUDA 3W99B 5AVCA 4LD9D 1M18B 5AV9D 2IO5C 3VH5T 3AZJC 2AROB 5E5AB 4HGAC 3WTPB 4ZUXC 5B33D 5GXQC 4G91B 5B0YA 4J8UA 5B31A 2YFVB 4Z5TA 5AV6D 5BNXA 1P3GA 1ZLAB 5JA4A 1F66D 2W8SA 3W96B 4YS3C 3C1BC 3X1UD 4LD9A 3AZIA 1T3UA 2CV5A 1ID3D 5AV5D 3MGPB 4NE5A 3AZGD 5B40C 3UT9C 1P3BA 1BFMA 3IP4C 5B33A 3KWQA 3AYWA 2FJ7B 3W97C 1S32D 2YFWB 5CPIB 3AZHB 1U35D 5FUGA 5AVBC 5KDMA 4WU8C 3NQUA 3MNNB 5BT1D 5GSUB 4CAYA 4H9OA 2BYKA 3MVDB 2LY8A 1EQZB 3EPHA 3A6NB 3AZNC 5F99B 3AN2C 3UTBB 3MGSD 3R45A 5AV8D 1U35A 4XUJD 4JJNA 1P3AD 1TZYD 4DQYB 2Y2PA 3EPJA 1KX5D 3O62D 4Z66C 3REIA 4R8PB 3B0DB 4WNNB 1P3FD 1H3OB 3UTAC 3B6GD 3KXBC 5CP6A 2F8NK 3AZLB 2NZDD 4J8WC 2PYOB 4XUJA 3LZ0B 5GT3A 3LZ1B 1P3PD 1HQ3D 3X1TC 1KX5A 5B1MD 3AV2B 4X23D 3B0BA 4NFTA 1AOIB 3W98D 4H9SC 4J8XB 2Y2GA 3REJC 1M19D 1Q9CA 3RELC 2XD1A 3WA9C 5GT0D 3X1VC 3NQJB 5B32A 3V9RA 3REKD 2G5IC 3AZEC 1M1AB 2Y2JA 5B2JC 3VH6W 3AZMA 4CSRB 4ZBJC 5B24B 4YM6A 3H0MC 1P3OD 2ZY3A 3LELA 3REHB 4WJ3C 5AV9B 2DF4C 3MGQB 5B31G 2RVQC 3MGRD 1P3LB 5GT0A 4AWLC 5AY8D 3X1SC 4WU9B 3B6FC 3W99C 1P3KD 1M18C 2NQBB 3WKJB 5AV6B 2AROC 5E5AC 3AZFD 5CPJD 1F66B 2HIOD 4QLCA 3WTPC 2Y2LA 3X1UB 1P3MD 3KUYD 4G91C 1ID3B 5AV5B 3AZGB 1W2EA 1ZLAC 5DNNB 3W96C 5AY8A 4H9RA 2Y2QA 5G49B 1F1EA 1S32B 4KHAA 2ZY5A 3MGPC 3LJAB 2UWXA 2HIOA 3AZKD 5CPJA 4J8VA 3KFUG 1WWIA 5B2ID 2FJ7C 2F8NA 1P3MA 3TU4A 5B2JB 5CPIC 3AZHC 4KGCB 5JRGA 3AV1A 4H9NB 3MNNC 5GSUC 3MGSB 5AV8B 3AZJA 5B0YD 4XZQB 3MVDC 1P3AB 5B40D 1EQZC 1TZYB 3P5JB 3A6NC 4ZUXA 3W97D 5F99C 5GXQA 1KX3B 3O62B 3AZID 1BH8B 3UTBC 2CV5D 1P3FB 3EG5B 5AVBD 4YS3A 3B6GB 3C1BA 3AFAB 1P3BD 2NZDB 3KWQD 3AYWD 4R8PC 3B0DC 5B40A 1P3PB 3UT9A 1JFIB 3W97A 3AZLC 3C1CB 3WAAB 5B1MB 4X23B 2PYOC 2F2AC 3LZ0C 5C3IB 5AVBA 3LZ1C 3W98B 4WU8A 3AV2C 1M19B 4JJND 4NE3A 1AOIC 3AZNA 4J8XC 3AN2A 3REKB 4J8WD 5B0ZB 5BO0B 3REID 2BYMA 1P3OB 5CP6D 4Z66A 3A1IA 5CHLB 1M1AC 5GT3D 3MGRB 5B24C 3UTAA 4UUZB 3KXBA 3REHC 2VQRA 4H9QA 3REJD 5CPKB 1P3KB 5DNMB 4J8WA 3WTPE 5AV9C 1P3IB 3MGQC 3AZFB 1P3LC 3X1VD 5BNVB 1KX4B 3X1TA 4WU9C 5B1LB 3KUYB 2NQBC 3WKJC 5AV6C 3VH6T 1F66C 4H9SA 2Y2IA 3X1UC 1P34B 3REJA 4H9PA 5B32D 1TAFB 3RELA 1ID3C 3AZMD 2RVQD 5AV5C 3AZGC 3WA9A 3AZKB 5DNNC 3X1VA 1A7WA 1N1JB 4YM6D 3X1SD 5B2IB 3B6FD 4KUDB 3LELD 3AZEA 5AVCB 5B2JA 1S32C 2AROD 5E5AD 4UPKA 3LJAC 5BT1C 5B0YB 2G5HC 4J8UB 5B31B 4DRAA 4Z5TB 1P3GB 5BNXB 4KGCC 3W96D 4DRBA 5JA4B 1BH9A 3X1SA 4QLCD 3VH5A 3B6FA 3W99A 4LD9B 3AZIB 5BS7C 1M18A 3MGSC 5AV8C 2CV5B 2AROA 5E5AA 4XZQC 1P3AC 1TZYC 3WTPA 1P3BB 2FJ7D 5B33B 3KWQB 1KX3C 3O62C 3H0LC 2YFVA 3AZHD 1P3FC 5FUGB 1ZLAA 4WZSB 3W96A 2DQNC 3B6GC 5KDMB 4J8VD 3NQUB 3AFAC 2NZDC 1R4VA 2F8ND 4CAYB 4H9OB 3TU4D 2BYKB 3MVDD 3MGPA 3EPKA 3AL0C 1EQZD 5JRGD 1P3PC 1HQ3C 5F99D 3AV1D 2FJ7A 3WAAC 3C1CC 5B1MC 2YFWA 4X23C 5CPIA 3R45B 3AZHA 2ZY4A 3AZJD 1U35B 5C3IC 4JJNB 3W98C 3MNNA 4ZUXD 5GXQD 5GSUA 4WV4B 3A1KA 3REIB 1M19C 3MVDA 1EQZA 3A6NA 4YS3D 5F99A 3C1BD 5CP6B 4G92B 3REKC 3UTBA 2PYOD 5B0ZC 2Y2NA 4XUJB 5GT3B 3LZ1D 1P3OC 3UT9D 1KX5B 3AV2D 4R8PA 2BG1A 4WNNA 1H3OA 5BNVA 3MGRC 4WU8D 3AZLA 1P3KC 5CPKC 5DNMC 1P3IC 2PYOA 3LZ0A 3AZFC 3LZ1A 2JE5A 1KX4C 1HQ3B 3AZND 3AN2D 5B32B 3V9RB 3AV2A 1P3MC 5B1LC 3KUYC 1M1AD 3AZMB 1AOIA 4J8XA 4YM6B 3REHD 1P34C 3LELB 5B32G 4Z66D 3MGQD 1P3LD 3AZKC 3UTAD 5GT0B 3NQJA 3KXBD 4WU9D 4NE6A 5B2IC 4KUDC 1M1AA 5AVCC 4CSRA 2NQBD 3WKJD 4EO5B 5B24A 3X1TD 4QLCB 3REHA 5AV9A 3MGQA 5B0YC 4J8UC 5B31C 2HUEB 4Z5TC 1P3GC 1P3LA 4E45A 5DNND 5AY8B 4H9RB 4WU9A 4LD9C 3VH5W 3AZIC 2NQBA 2CV5C 3RELD 1WWSA 4KHAB 5AV6A 3WKJA 3FDDA 3LJAD 1F66A 3WA9D 5CPJB 2HIOB 4J8VB 3X1UA 1P3BC 5B33C 3KWQC 3AYWC 2F8NB 3AZED 3TU4B 5B2JD 1P3MB 1ID3A 5AV5A 3AZGA 2FFFB 4KGCD 5DNNA 5JRGB 3AV1B 5G49A 1S32A 2F8NH 2F8NG 2IO5B 4XZQD 2JCHA 3AZJB 1B67A 4HGAB 3LJAA 4Z2MG 4ZUXB 4Z2MH 1KX3D 5GXQB 3W99D 1M18D 2ZM5A 1U35C 4KGCA 4JJNC 4YS3B 3C1BB 4H9NA 3WTPD 3AFAD 5BS7A 3MGSA 5AV8A 2Y2MA 4XZQA 3REIC 1P3AA 1ZLAD 5B40B 1TZYA 3UT9B 3W97B 1KX3A 3WAAD 5CP6C 3O62A 3C1CD 4G92C 1BH8A 1P3FA 4XUJC 3MGPD 5GT3C 5AVBB 3B6GA 3F6TA 4WU8B 3AFAA 2NZDA 1KX5C 3AYWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CPI D;  3B0C T;  1P3P A;  1HQ3 A;  1JFI A;  3AZN B;  3AN2 B;  3MNN D;  3C1C A;  3WAA A;  5B1M A;  5GSU D;  4X23 A;  5B0Z D;  2BYM B;  3W98 A;  1ULY A;  3A6N D;  5B32 C;  4Z66 B;  3UTB D;  1M19 A;  3KSY A;  3AZM C;  3UTA B;  3KXB B;  4YM6 C;  3REK A;  1HTA A;  5CPK D;  3LEL C;  4H9Q B;  1KU5 A;  5DNM D;  1P3I D;  5B0Z A;  5BO0 A;  4J8W B;  4R8P D;  3B0C W;  1KX4 D;  1P3O A;  5GT0 C;  3X1T B;  3AZL D;  5B1L D;  3LZ0 D;  3MGR A;  4EO5 C;  4UUZ A;  4QLC C;  1P34 D;  1B6W A;  1P3K A;  5CPK A;  3REJ B;  4H9P B;  5DNM A;  1P3I A;  4E44 A;  3REL B;  3AZF A;  2HUE C;  4M6B A;  3WA9 B;  1KX4 A;  3X1V B;  1AOI D;  4J8X D;  2L5A A;  5AY8 C;  2JSS A;  4KUD D;  5B1L A;  3VH6 A;  5AVC D;  3KUY A;  3AZE B;  4ZBJ B;  5CPJ C;  2HIO C;  4J8V C;  1P34 A;  1TAF A;  3TU4 C;  4J8U D;  5B31 D;  4Z5T D;  1P3G D;  3AZK A;  5B24 D;  1N1J A;  5JRG C;  4AWL B;  3X1S B;  1BH9 B;  2CWE A;  5B2I A;  3AV1 C;  3B6F B;  4KUD A;  3W99 B;  5AVC A;  4LD9 D;  1M18 B;  5AV9 D;  2IO5 C;  3VH5 T;  3AZJ C;  2ARO B;  5E5A B;  4HGA C;  3WTP B;  4ZUX C;  5B33 D;  5GXQ C;  4G91 B;  5B0Y A;  4J8U A;  5B31 A;  2YFV B;  4Z5T A;  5AV6 D;  5BNX A;  1P3G A;  1ZLA B;  5JA4 A;  1F66 D;  3W96 B;  4YS3 C;  3C1B C;  3X1U D;  4LD9 A;  3AZI A;  2CV5 A;  1ID3 D;  5AV5 D;  3MGP B;  4NE5 A;  3AZG D;  5B40 C;  3UT9 C;  1P3B A;  1BFM A;  5B33 A;  3KWQ A;  2FJ7 B;  3AYW A;  3W97 C;  1S32 D;  2YFW B;  5CPI B;  3AZH B;  1U35 D;  5FUG A;  5AVB C;  5KDM A;  4WU8 C;  3NQU A;  3MNN B;  5BT1 D;  5GSU B;  4CAY A;  4H9O A;  2BYK A;  3MVD B;  2LY8 A;  1EQZ B;  3A6N B;  3AZN C;  5F99 B;  3AN2 C;  3UTB B;  3MGS D;  3R45 A;  5AV8 D;  1U35 A;  4XUJ D;  4JJN A;  1P3A D;  1TZY D;  1KX5 D;  3O62 D;  4Z66 C;  3REI A;  4R8P B;  3B0D B;  4WNN B;  1P3F D;  1H3O B;  3UTA C;  3B6G D;  3KXB C;  5CP6 A;  2F8N K;  3AZL B;  2NZD D;  4J8W C;  2PYO B;  4XUJ A;  3LZ0 B;  5GT3 A;  3LZ1 B;  1P3P D;  1HQ3 D;  3X1T C;  1KX5 A;  5B1M D;  3AV2 B;  4X23 D;  3B0B A;  4NFT A;  1AOI B;  3W98 D;  4H9S C;  4J8X B;  3REJ C;  1M19 D;  1Q9C A;  3REL C;  3WA9 C;  5GT0 D;  3X1V C;  3NQJ B;  5B32 A;  3V9R A;  3REK D;  3AZE C;  1M1A B;  5B2J C;  3AZM A;  3VH6 W;  4CSR B;  4ZBJ C;  5B24 B;  4YM6 A;  1P3O D;  3LEL A;  3REH B;  5AV9 B;  3MGQ B;  5B31 G;  2RVQ C;  3MGR D;  1P3L B;  5GT0 A;  4AWL C;  5AY8 D;  3X1S C;  4WU9 B;  3B6F C;  3W99 C;  1P3K D;  1M18 C;  2NQB B;  3WKJ B;  5AV6 B;  2ARO C;  5E5A C;  3AZF D;  5CPJ D;  1F66 B;  2HIO D;  4QLC A;  3WTP C;  3X1U B;  1P3M D;  3KUY D;  4G91 C;  1ID3 B;  5AV5 B;  3AZG B;  1ZLA C;  5DNN B;  3W96 C;  5AY8 A;  4H9R A;  5G49 B;  1F1E A;  1S32 B;  4KHA A;  3MGP C;  3LJA B;  3AZK D;  2HIO A;  5CPJ A;  4J8V A;  1WWI A;  5B2I D;  2FJ7 C;  2F8N A;  1P3M A;  3TU4 A;  5B2J B;  5CPI C;  3AZH C;  4KGC B;  5JRG A;  3AV1 A;  4H9N B;  3MNN C;  5GSU C;  3MGS B;  5AV8 B;  3AZJ A;  5B0Y D;  4XZQ B;  3MVD C;  1P3A B;  5B40 D;  1EQZ C;  1TZY B;  3A6N C;  4ZUX A;  3W97 D;  5F99 C;  5GXQ A;  1KX3 B;  3O62 B;  3AZI D;  1BH8 B;  3UTB C;  2CV5 D;  1P3F B;  5AVB D;  4YS3 A;  3B6G B;  3C1B A;  3AFA B;  1P3B D;  2NZD B;  3KWQ D;  3AYW D;  4R8P C;  3B0D C;  5B40 A;  1P3P B;  3UT9 A;  1JFI B;  3W97 A;  3AZL C;  3C1C B;  3WAA B;  5B1M B;  4X23 B;  2PYO C;  3LZ0 C;  5C3I B;  5AVB A;  3LZ1 C;  3W98 B;  4WU8 A;  3AV2 C;  1M19 B;  4JJN D;  4NE3 A;  1AOI C;  3AZN A;  4J8X C;  3AN2 A;  3REK B;  4J8W D;  5B0Z B;  5BO0 B;  3REI D;  2BYM A;  1P3O B;  5CP6 D;  4Z66 A;  5CHL B;  1M1A C;  5GT3 D;  3MGR B;  5B24 C;  3UTA A;  4UUZ B;  3KXB A;  3REH C;  3REJ D;  4H9Q A;  5CPK B;  1P3K B;  5DNM B;  4J8W A;  3WTP E;  5AV9 C;  1P3I B;  3MGQ C;  3AZF B;  1P3L C;  3X1V D;  5BNV B;  1KX4 B;  3X1T A;  4WU9 C;  5B1L B;  3KUY B;  2NQB C;  3WKJ C;  5AV6 C;  3VH6 T;  1F66 C;  4H9S A;  3X1U C;  1P34 B;  3REJ A;  4H9P A;  5B32 D;  1TAF B;  3REL A;  1ID3 C;  3AZM D;  2RVQ D;  5AV5 C;  3AZG C;  3WA9 A;  3AZK B;  5DNN C;  3X1V A;  1A7W A;  1N1J B;  4YM6 D;  3X1S D;  5B2I B;  3B6F D;  4KUD B;  3LEL D;  3AZE A;  5AVC B;  5B2J A;  1S32 C;  2ARO D;  5E5A D;  3LJA C;  5BT1 C;  5B0Y B;  4J8U B;  5B31 B;  4DRA A;  4Z5T B;  1P3G B;  5BNX B;  4KGC C;  3W96 D;  4DRB A;  5JA4 B;  1BH9 A;  3X1S A;  4QLC D;  3VH5 A;  3B6F A;  3W99 A;  4LD9 B;  3AZI B;  5BS7 C;  1M18 A;  3MGS C;  5AV8 C;  2CV5 B;  2ARO A;  5E5A A;  4XZQ C;  1P3A C;  1TZY C;  3WTP A;  1P3B B;  2FJ7 D;  5B33 B;  3KWQ B;  1KX3 C;  3O62 C;  3AZH D;  2YFV A;  1P3F C;  5FUG B;  1ZLA A;  4WZS B;  3W96 A;  3B6G C;  5KDM B;  4J8V D;  3NQU B;  3AFA C;  2NZD C;  1R4V A;  2F8N D;  4CAY B;  4H9O B;  3TU4 D;  2BYK B;  3MVD D;  3MGP A;  1EQZ D;  5JRG D;  1P3P C;  1HQ3 C;  5F99 D;  3AV1 D;  2FJ7 A;  3WAA C;  3C1C C;  5B1M C;  2YFW A;  4X23 C;  5CPI A;  3R45 B;  3AZH A;  3AZJ D;  1U35 B;  5C3I C;  4JJN B;  3W98 C;  3MNN A;  4ZUX D;  5GXQ D;  5GSU A;  4WV4 B;  3REI B;  1M19 C;  3MVD A;  1EQZ A;  3A6N A;  4YS3 D;  5F99 A;  3C1B D;  5CP6 B;  4G92 B;  3REK C;  3UTB A;  2PYO D;  5B0Z C;  4XUJ B;  5GT3 B;  3LZ1 D;  1P3O C;  3UT9 D;  1KX5 B;  3AV2 D;  4R8P A;  4WNN A;  1H3O A;  5BNV A;  3MGR C;  4WU8 D;  3AZL A;  1P3K C;  5CPK C;  5DNM C;  1P3I C;  2PYO A;  3LZ0 A;  3AZF C;  3LZ1 A;  1KX4 C;  1HQ3 B;  3AZN D;  3AN2 D;  5B32 B;  3V9R B;  3AV2 A;  1P3M C;  5B1L C;  3KUY C;  1M1A D;  3AZM B;  1AOI A;  4J8X A;  4YM6 B;  3REH D;  1P34 C;  3LEL B;  5B32 G;  4Z66 D;  3MGQ D;  1P3L D;  3AZK C;  3UTA D;  5GT0 B;  3NQJ A;  3KXB D;  4WU9 D;  4NE6 A;  5B2I C;  4KUD C;  1M1A A;  5AVC C;  4CSR A;  2NQB D;  3WKJ D;  4EO5 B;  5B24 A;  3X1T D;  4QLC B;  3REH A;  5AV9 A;  3MGQ A;  5B0Y C;  4J8U C;  5B31 C;  2HUE B;  4Z5T C;  1P3G C;  1P3L A;  4E45 A;  5DNN D;  5AY8 B;  4H9R B;  4WU9 A;  4LD9 C;  3VH5 W;  3AZI C;  2NQB A;  2CV5 C;  3REL D;  1WWS A;  4KHA B;  5AV6 A;  3WKJ A;  3LJA D;  1F66 A;  3WA9 D;  5CPJ B;  2HIO B;  4J8V B;  3X1U A;  1P3B C;  5B33 C;  3KWQ C;  3AYW C;  2F8N B;  3AZE D;  3TU4 B;  5B2J D;  1P3M B;  1ID3 A;  5AV5 A;  3AZG A;  4KGC D;  5DNN A;  5JRG B;  3AV1 B;  5G49 A;  1S32 A;  2F8N H;  2F8N G;  2IO5 B;  4XZQ D;  3AZJ B;  1B67 A;  4HGA B;  3LJA A;  4Z2M G;  4Z2M H;  4ZUX B;  1KX3 D;  5GXQ B;  3W99 D;  1M18 D;  1U35 C;  4KGC A;  4JJN C;  4YS3 B;  3C1B B;  4H9N A;  3WTP D;  3AFA D;  5BS7 A;  3MGS A;  5AV8 A;  3REI C;  4XZQ A;  1P3A A;  1ZLA D;  5B40 B;  1TZY A;  3UT9 B;  3W97 B;  1KX3 A;  3WAA D;  5CP6 C;  3O62 A;  3C1C D;  4G92 C;  1BH8 A;  1P3F A;  4XUJ C;  3MGP D;  5GT3 C;  5AVB B;  3B6G A;  4WU8 B;  3AFA A;  2NZD A;  1KX5 C;  3AYW B; 
#chains in the Genus database with same CATH topology
 1PZR A;  5CPI D;  2XD5 A;  3B0C T;  1P3P A;  3H0R C;  1HQ3 A;  1JFI A;  3AZN B;  3AN2 B;  3MNN D;  3C1C A;  3WAA A;  5B1M A;  5GSU D;  4X23 A;  5B0Z D;  2BYM B;  3W98 A;  1ULY A;  3A6N D;  5B32 C;  4Z66 B;  3UTB D;  1M19 A;  3KSY A;  3AZM C;  3UTA B;  3KXB B;  4YM6 C;  2J8P A;  3REK A;  1HTA A;  3EPL A;  5CPK D;  3LEL C;  2Y2O A;  1KU5 A;  4H9Q B;  5DNM D;  5B0Z A;  5BO0 A;  4J8W B;  4R8P D;  3B0C W;  1P3I D;  1Z2C B;  1KX4 D;  1P3O A;  5GT0 C;  3X1T B;  3AZL D;  5B1L D;  2ZY2 A;  3LZ0 D;  3MGR A;  4EO5 C;  4UUZ A;  4QLC C;  1P34 D;  1B6W A;  1P3K A;  5CPK A;  3REJ B;  4H9P B;  5DNM A;  1P3I A;  4E44 A;  3REL B;  2RIQ A;  3AZF A;  2HUE C;  4M6B A;  3WA9 B;  1KX4 A;  3X1V B;  1AOI D;  4J8X D;  2L5A A;  5AY8 C;  2JSS A;  4KUD D;  5B1L A;  3VH6 A;  5AVC D;  3KUY A;  3AZE B;  4ZBJ B;  5CPJ C;  2HIO C;  4J8V C;  1P34 A;  1TAF A;  3TU4 C;  2Y2H A;  4J8U D;  5B31 D;  4Z5T D;  1P3G D;  3AZK A;  2Y2K A;  5B24 D;  1N1J A;  5JRG C;  4AWL B;  1BH9 B;  2CWE A;  5B2I A;  3X1S B;  3AV1 C;  3B6F B;  4KUD A;  3W99 B;  5AVC A;  4LD9 D;  1M18 B;  5AV9 D;  2IO5 C;  3VH5 T;  3AZJ C;  2ARO B;  5E5A B;  4HGA C;  3WTP B;  4ZUX C;  5B33 D;  5GXQ C;  4G91 B;  5B0Y A;  4J8U A;  5B31 A;  2YFV B;  4Z5T A;  5AV6 D;  5BNX A;  1P3G A;  1ZLA B;  5JA4 A;  1F66 D;  2W8S A;  3W96 B;  4YS3 C;  3C1B C;  3X1U D;  4LD9 A;  3AZI A;  1T3U A;  2CV5 A;  1ID3 D;  5AV5 D;  3MGP B;  4NE5 A;  3AZG D;  5B40 C;  3UT9 C;  1P3B A;  1BFM A;  3IP4 C;  5B33 A;  3KWQ A;  3AYW A;  2FJ7 B;  3W97 C;  1S32 D;  2YFW B;  5CPI B;  3AZH B;  1U35 D;  5FUG A;  5AVB C;  5KDM A;  4WU8 C;  3NQU A;  3MNN B;  5BT1 D;  5GSU B;  4CAY A;  4H9O A;  2BYK A;  3MVD B;  2LY8 A;  1EQZ B;  3EPH A;  3A6N B;  3AZN C;  5F99 B;  3AN2 C;  3UTB B;  3MGS D;  3R45 A;  5AV8 D;  1U35 A;  4XUJ D;  4JJN A;  1P3A D;  1TZY D;  4DQY B;  2Y2P A;  3EPJ A;  1KX5 D;  3O62 D;  4Z66 C;  3REI A;  4R8P B;  3B0D B;  4WNN B;  1P3F D;  1H3O B;  3UTA C;  3B6G D;  3KXB C;  5CP6 A;  2F8N K;  3AZL B;  2NZD D;  4J8W C;  2PYO B;  4XUJ A;  3LZ0 B;  5GT3 A;  3LZ1 B;  1P3P D;  1HQ3 D;  3X1T C;  1KX5 A;  5B1M D;  3AV2 B;  4X23 D;  3B0B A;  4NFT A;  1AOI B;  3W98 D;  4H9S C;  4J8X B;  2Y2G A;  3REJ C;  1M19 D;  1Q9C A;  3REL C;  2XD1 A;  3WA9 C;  5GT0 D;  3X1V C;  3NQJ B;  5B32 A;  3V9R A;  3REK D;  2G5I C;  3AZE C;  1M1A B;  2Y2J A;  5B2J C;  3VH6 W;  3AZM A;  4CSR B;  4ZBJ C;  5B24 B;  4YM6 A;  3H0M C;  1P3O D;  2ZY3 A;  3LEL A;  3REH B;  4WJ3 C;  5AV9 B;  2DF4 C;  3MGQ B;  5B31 G;  2RVQ C;  3MGR D;  1P3L B;  5GT0 A;  4AWL C;  5AY8 D;  3X1S C;  4WU9 B;  3B6F C;  3W99 C;  1P3K D;  1M18 C;  2NQB B;  3WKJ B;  5AV6 B;  2ARO C;  5E5A C;  3AZF D;  5CPJ D;  1F66 B;  2HIO D;  4QLC A;  3WTP C;  2Y2L A;  3X1U B;  1P3M D;  3KUY D;  4G91 C;  1ID3 B;  5AV5 B;  3AZG B;  1W2E A;  1ZLA C;  5DNN B;  3W96 C;  5AY8 A;  4H9R A;  2Y2Q A;  5G49 B;  1F1E A;  1S32 B;  4KHA A;  2ZY5 A;  3MGP C;  3LJA B;  2UWX A;  2HIO A;  3AZK D;  5CPJ A;  4J8V A;  3KFU G;  1WWI A;  5B2I D;  2FJ7 C;  2F8N A;  1P3M A;  3TU4 A;  5B2J B;  5CPI C;  3AZH C;  4KGC B;  5JRG A;  3AV1 A;  4H9N B;  3MNN C;  5GSU C;  3MGS B;  5AV8 B;  3AZJ A;  5B0Y D;  4XZQ B;  3MVD C;  1P3A B;  5B40 D;  1EQZ C;  1TZY B;  3P5J B;  3A6N C;  4ZUX A;  3W97 D;  5F99 C;  5GXQ A;  1KX3 B;  3O62 B;  3AZI D;  1BH8 B;  3UTB C;  2CV5 D;  1P3F B;  3EG5 B;  5AVB D;  4YS3 A;  3B6G B;  3C1B A;  3AFA B;  1P3B D;  2NZD B;  3KWQ D;  3AYW D;  4R8P C;  3B0D C;  5B40 A;  1P3P B;  3UT9 A;  1JFI B;  3W97 A;  3AZL C;  3C1C B;  3WAA B;  5B1M B;  4X23 B;  2PYO C;  2F2A C;  3LZ0 C;  5C3I B;  5AVB A;  3LZ1 C;  3W98 B;  4WU8 A;  3AV2 C;  1M19 B;  4JJN D;  4NE3 A;  1AOI C;  3AZN A;  4J8X C;  3AN2 A;  3REK B;  4J8W D;  5B0Z B;  5BO0 B;  3REI D;  2BYM A;  1P3O B;  5CP6 D;  4Z66 A;  3A1I A;  5CHL B;  1M1A C;  5GT3 D;  3MGR B;  5B24 C;  3UTA A;  4UUZ B;  3KXB A;  3REH C;  2VQR A;  4H9Q A;  3REJ D;  5CPK B;  1P3K B;  5DNM B;  4J8W A;  3WTP E;  5AV9 C;  1P3I B;  3MGQ C;  3AZF B;  1P3L C;  3X1V D;  5BNV B;  1KX4 B;  3X1T A;  4WU9 C;  5B1L B;  3KUY B;  2NQB C;  3WKJ C;  5AV6 C;  3VH6 T;  1F66 C;  4H9S A;  2Y2I A;  3X1U C;  1P34 B;  3REJ A;  4H9P A;  5B32 D;  1TAF B;  3REL A;  1ID3 C;  3AZM D;  2RVQ D;  5AV5 C;  3AZG C;  3WA9 A;  3AZK B;  5DNN C;  3X1V A;  1A7W A;  1N1J B;  4YM6 D;  3X1S D;  5B2I B;  3B6F D;  4KUD B;  3LEL D;  3AZE A;  5AVC B;  5B2J A;  1S32 C;  2ARO D;  5E5A D;  4UPK A;  3LJA C;  5BT1 C;  5B0Y B;  2G5H C;  4J8U B;  5B31 B;  4DRA A;  4Z5T B;  1P3G B;  5BNX B;  4KGC C;  3W96 D;  4DRB A;  5JA4 B;  1BH9 A;  3X1S A;  4QLC D;  3VH5 A;  3B6F A;  3W99 A;  4LD9 B;  3AZI B;  5BS7 C;  1M18 A;  3MGS C;  5AV8 C;  2CV5 B;  2ARO A;  5E5A A;  4XZQ C;  1P3A C;  1TZY C;  3WTP A;  1P3B B;  2FJ7 D;  5B33 B;  3KWQ B;  1KX3 C;  3O62 C;  3H0L C;  2YFV A;  3AZH D;  1P3F C;  5FUG B;  1ZLA A;  4WZS B;  3W96 A;  2DQN C;  3B6G C;  5KDM B;  4J8V D;  3NQU B;  3AFA C;  2NZD C;  1R4V A;  2F8N D;  4CAY B;  4H9O B;  3TU4 D;  2BYK B;  3MVD D;  3MGP A;  3EPK A;  3AL0 C;  1EQZ D;  5JRG D;  1P3P C;  1HQ3 C;  5F99 D;  3AV1 D;  2FJ7 A;  3WAA C;  3C1C C;  5B1M C;  2YFW A;  4X23 C;  5CPI A;  3R45 B;  3AZH A;  2ZY4 A;  3AZJ D;  1U35 B;  5C3I C;  4JJN B;  3W98 C;  3MNN A;  4ZUX D;  5GXQ D;  5GSU A;  4WV4 B;  3A1K A;  3REI B;  1M19 C;  3MVD A;  1EQZ A;  3A6N A;  4YS3 D;  5F99 A;  3C1B D;  5CP6 B;  4G92 B;  3REK C;  3UTB A;  2PYO D;  5B0Z C;  2Y2N A;  4XUJ B;  5GT3 B;  3LZ1 D;  1P3O C;  3UT9 D;  1KX5 B;  3AV2 D;  4R8P A;  2BG1 A;  4WNN A;  1H3O A;  5BNV A;  3MGR C;  4WU8 D;  3AZL A;  1P3K C;  5CPK C;  5DNM C;  1P3I C;  2PYO A;  3LZ0 A;  3AZF C;  3LZ1 A;  2JE5 A;  1KX4 C;  1HQ3 B;  3AZN D;  3AN2 D;  5B32 B;  3V9R B;  3AV2 A;  1P3M C;  5B1L C;  3KUY C;  1M1A D;  3AZM B;  1AOI A;  4J8X A;  4YM6 B;  3REH D;  1P34 C;  3LEL B;  5B32 G;  4Z66 D;  3MGQ D;  1P3L D;  3AZK C;  3UTA D;  5GT0 B;  3NQJ A;  3KXB D;  4WU9 D;  4NE6 A;  5B2I C;  4KUD C;  1M1A A;  5AVC C;  4CSR A;  2NQB D;  3WKJ D;  4EO5 B;  5B24 A;  3X1T D;  4QLC B;  3REH A;  5AV9 A;  3MGQ A;  5B0Y C;  4J8U C;  5B31 C;  2HUE B;  4Z5T C;  1P3G C;  1P3L A;  4E45 A;  5DNN D;  5AY8 B;  4H9R B;  4WU9 A;  4LD9 C;  3VH5 W;  3AZI C;  2NQB A;  2CV5 C;  3REL D;  1WWS A;  4KHA B;  5AV6 A;  3WKJ A;  3FDD A;  3LJA D;  1F66 A;  3WA9 D;  5CPJ B;  2HIO B;  4J8V B;  3X1U A;  1P3B C;  5B33 C;  3KWQ C;  3AYW C;  2F8N B;  3AZE D;  3TU4 B;  5B2J D;  1P3M B;  1ID3 A;  5AV5 A;  3AZG A;  2FFF B;  4KGC D;  5DNN A;  5JRG B;  3AV1 B;  5G49 A;  1S32 A;  2F8N H;  2F8N G;  2IO5 B;  4XZQ D;  2JCH A;  3AZJ B;  1B67 A;  4HGA B;  3LJA A;  4Z2M G;  4ZUX B;  4Z2M H;  1KX3 D;  5GXQ B;  3W99 D;  1M18 D;  2ZM5 A;  1U35 C;  4KGC A;  4JJN C;  4YS3 B;  3C1B B;  4H9N A;  3WTP D;  3AFA D;  5BS7 A;  3MGS A;  5AV8 A;  2Y2M A;  4XZQ A;  3REI C;  1P3A A;  1ZLA D;  5B40 B;  1TZY A;  3UT9 B;  3W97 B;  1KX3 A;  3WAA D;  5CP6 C;  3O62 A;  3C1C D;  4G92 C;  1BH8 A;  1P3F A;  4XUJ C;  3MGP D;  5GT3 C;  5AVB B;  3B6G A;  3F6T A;  4WU8 B;  3AFA A;  2NZD A;  1KX5 C;  3AYW B; 
#chains in the Genus database with same CATH homology
 1PZR A;  5CPI D;  2XD5 A;  3B0C T;  1P3P A;  3H0R C;  1HQ3 A;  1JFI A;  3AZN B;  3AN2 B;  3MNN D;  3C1C A;  3WAA A;  5B1M A;  5GSU D;  4X23 A;  5B0Z D;  2BYM B;  3W98 A;  1ULY A;  3A6N D;  5B32 C;  4Z66 B;  3UTB D;  1M19 A;  3KSY A;  3AZM C;  3UTA B;  3KXB B;  4YM6 C;  2J8P A;  3REK A;  1HTA A;  3EPL A;  5CPK D;  3LEL C;  2Y2O A;  1KU5 A;  4H9Q B;  5DNM D;  5B0Z A;  5BO0 A;  4J8W B;  4R8P D;  3B0C W;  1P3I D;  1Z2C B;  1KX4 D;  1P3O A;  5GT0 C;  3X1T B;  3AZL D;  5B1L D;  2ZY2 A;  3LZ0 D;  3MGR A;  4EO5 C;  4UUZ A;  4QLC C;  1P34 D;  1B6W A;  1P3K A;  5CPK A;  3REJ B;  4H9P B;  5DNM A;  1P3I A;  4E44 A;  3REL B;  2RIQ A;  3AZF A;  2HUE C;  4M6B A;  3WA9 B;  1KX4 A;  3X1V B;  1AOI D;  4J8X D;  2L5A A;  5AY8 C;  2JSS A;  4KUD D;  5B1L A;  3VH6 A;  5AVC D;  3KUY A;  3AZE B;  4ZBJ B;  5CPJ C;  2HIO C;  4J8V C;  1P34 A;  1TAF A;  3TU4 C;  2Y2H A;  4J8U D;  5B31 D;  4Z5T D;  1P3G D;  3AZK A;  2Y2K A;  5B24 D;  1N1J A;  5JRG C;  4AWL B;  1BH9 B;  2CWE A;  5B2I A;  3X1S B;  3AV1 C;  3B6F B;  4KUD A;  3W99 B;  5AVC A;  4LD9 D;  1M18 B;  5AV9 D;  2IO5 C;  3VH5 T;  3AZJ C;  2ARO B;  5E5A B;  4HGA C;  3WTP B;  4ZUX C;  5B33 D;  5GXQ C;  4G91 B;  5B0Y A;  4J8U A;  5B31 A;  2YFV B;  4Z5T A;  5AV6 D;  5BNX A;  1P3G A;  1ZLA B;  5JA4 A;  1F66 D;  2W8S A;  3W96 B;  4YS3 C;  3C1B C;  3X1U D;  4LD9 A;  3AZI A;  1T3U A;  2CV5 A;  1ID3 D;  5AV5 D;  3MGP B;  4NE5 A;  3AZG D;  5B40 C;  3UT9 C;  1P3B A;  1BFM A;  3IP4 C;  5B33 A;  3KWQ A;  3AYW A;  2FJ7 B;  3W97 C;  1S32 D;  2YFW B;  5CPI B;  3AZH B;  1U35 D;  5FUG A;  5AVB C;  5KDM A;  4WU8 C;  3NQU A;  3MNN B;  5BT1 D;  5GSU B;  4CAY A;  4H9O A;  2BYK A;  3MVD B;  2LY8 A;  1EQZ B;  3EPH A;  3A6N B;  3AZN C;  5F99 B;  3AN2 C;  3UTB B;  3MGS D;  3R45 A;  5AV8 D;  1U35 A;  4XUJ D;  4JJN A;  1P3A D;  1TZY D;  4DQY B;  2Y2P A;  3EPJ A;  1KX5 D;  3O62 D;  4Z66 C;  3REI A;  4R8P B;  3B0D B;  4WNN B;  1P3F D;  1H3O B;  3UTA C;  3B6G D;  3KXB C;  5CP6 A;  2F8N K;  3AZL B;  2NZD D;  4J8W C;  2PYO B;  4XUJ A;  3LZ0 B;  5GT3 A;  3LZ1 B;  1P3P D;  1HQ3 D;  3X1T C;  1KX5 A;  5B1M D;  3AV2 B;  4X23 D;  3B0B A;  4NFT A;  1AOI B;  3W98 D;  4H9S C;  4J8X B;  2Y2G A;  3REJ C;  1M19 D;  1Q9C A;  3REL C;  2XD1 A;  3WA9 C;  5GT0 D;  3X1V C;  3NQJ B;  5B32 A;  3V9R A;  3REK D;  2G5I C;  3AZE C;  1M1A B;  2Y2J A;  5B2J C;  3VH6 W;  3AZM A;  4CSR B;  4ZBJ C;  5B24 B;  4YM6 A;  3H0M C;  1P3O D;  2ZY3 A;  3LEL A;  3REH B;  4WJ3 C;  5AV9 B;  2DF4 C;  3MGQ B;  5B31 G;  2RVQ C;  3MGR D;  1P3L B;  5GT0 A;  4AWL C;  5AY8 D;  3X1S C;  4WU9 B;  3B6F C;  3W99 C;  1P3K D;  1M18 C;  2NQB B;  3WKJ B;  5AV6 B;  2ARO C;  5E5A C;  3AZF D;  5CPJ D;  1F66 B;  2HIO D;  4QLC A;  3WTP C;  2Y2L A;  3X1U B;  1P3M D;  3KUY D;  4G91 C;  1ID3 B;  5AV5 B;  3AZG B;  1W2E A;  1ZLA C;  5DNN B;  3W96 C;  5AY8 A;  4H9R A;  2Y2Q A;  5G49 B;  1F1E A;  1S32 B;  4KHA A;  2ZY5 A;  3MGP C;  3LJA B;  2UWX A;  2HIO A;  3AZK D;  5CPJ A;  4J8V A;  3KFU G;  1WWI A;  5B2I D;  2FJ7 C;  2F8N A;  1P3M A;  3TU4 A;  5B2J B;  5CPI C;  3AZH C;  4KGC B;  5JRG A;  3AV1 A;  4H9N B;  3MNN C;  5GSU C;  3MGS B;  5AV8 B;  3AZJ A;  5B0Y D;  4XZQ B;  3MVD C;  1P3A B;  5B40 D;  1EQZ C;  1TZY B;  3P5J B;  3A6N C;  4ZUX A;  3W97 D;  5F99 C;  5GXQ A;  1KX3 B;  3O62 B;  3AZI D;  1BH8 B;  3UTB C;  2CV5 D;  1P3F B;  3EG5 B;  5AVB D;  4YS3 A;  3B6G B;  3C1B A;  3AFA B;  1P3B D;  2NZD B;  3KWQ D;  3AYW D;  4R8P C;  3B0D C;  5B40 A;  1P3P B;  3UT9 A;  1JFI B;  3W97 A;  3AZL C;  3C1C B;  3WAA B;  5B1M B;  4X23 B;  2PYO C;  2F2A C;  3LZ0 C;  5C3I B;  5AVB A;  3LZ1 C;  3W98 B;  4WU8 A;  3AV2 C;  1M19 B;  4JJN D;  4NE3 A;  1AOI C;  3AZN A;  4J8X C;  3AN2 A;  3REK B;  4J8W D;  5B0Z B;  5BO0 B;  3REI D;  2BYM A;  1P3O B;  5CP6 D;  4Z66 A;  3A1I A;  5CHL B;  1M1A C;  5GT3 D;  3MGR B;  5B24 C;  3UTA A;  4UUZ B;  3KXB A;  3REH C;  2VQR A;  4H9Q A;  3REJ D;  5CPK B;  1P3K B;  5DNM B;  4J8W A;  3WTP E;  5AV9 C;  1P3I B;  3MGQ C;  3AZF B;  1P3L C;  3X1V D;  5BNV B;  1KX4 B;  3X1T A;  4WU9 C;  5B1L B;  3KUY B;  2NQB C;  3WKJ C;  5AV6 C;  3VH6 T;  1F66 C;  4H9S A;  2Y2I A;  3X1U C;  1P34 B;  3REJ A;  4H9P A;  5B32 D;  1TAF B;  3REL A;  1ID3 C;  3AZM D;  2RVQ D;  5AV5 C;  3AZG C;  3WA9 A;  3AZK B;  5DNN C;  3X1V A;  1A7W A;  1N1J B;  4YM6 D;  3X1S D;  5B2I B;  3B6F D;  4KUD B;  3LEL D;  3AZE A;  5AVC B;  5B2J A;  1S32 C;  2ARO D;  5E5A D;  4UPK A;  3LJA C;  5BT1 C;  5B0Y B;  2G5H C;  4J8U B;  5B31 B;  4DRA A;  4Z5T B;  1P3G B;  5BNX B;  4KGC C;  3W96 D;  4DRB A;  5JA4 B;  1BH9 A;  3X1S A;  4QLC D;  3VH5 A;  3B6F A;  3W99 A;  4LD9 B;  3AZI B;  5BS7 C;  1M18 A;  3MGS C;  5AV8 C;  2CV5 B;  2ARO A;  5E5A A;  4XZQ C;  1P3A C;  1TZY C;  3WTP A;  1P3B B;  2FJ7 D;  5B33 B;  3KWQ B;  1KX3 C;  3O62 C;  3H0L C;  2YFV A;  3AZH D;  1P3F C;  5FUG B;  1ZLA A;  4WZS B;  3W96 A;  2DQN C;  3B6G C;  5KDM B;  4J8V D;  3NQU B;  3AFA C;  2NZD C;  1R4V A;  2F8N D;  4CAY B;  4H9O B;  3TU4 D;  2BYK B;  3MVD D;  3MGP A;  3EPK A;  3AL0 C;  1EQZ D;  5JRG D;  1P3P C;  1HQ3 C;  5F99 D;  3AV1 D;  2FJ7 A;  3WAA C;  3C1C C;  5B1M C;  2YFW A;  4X23 C;  5CPI A;  3R45 B;  3AZH A;  2ZY4 A;  3AZJ D;  1U35 B;  5C3I C;  4JJN B;  3W98 C;  3MNN A;  4ZUX D;  5GXQ D;  5GSU A;  4WV4 B;  3A1K A;  3REI B;  1M19 C;  3MVD A;  1EQZ A;  3A6N A;  4YS3 D;  5F99 A;  3C1B D;  5CP6 B;  4G92 B;  3REK C;  3UTB A;  2PYO D;  5B0Z C;  2Y2N A;  4XUJ B;  5GT3 B;  3LZ1 D;  1P3O C;  3UT9 D;  1KX5 B;  3AV2 D;  4R8P A;  2BG1 A;  4WNN A;  1H3O A;  5BNV A;  3MGR C;  4WU8 D;  3AZL A;  1P3K C;  5CPK C;  5DNM C;  1P3I C;  2PYO A;  3LZ0 A;  3AZF C;  3LZ1 A;  2JE5 A;  1KX4 C;  1HQ3 B;  3AZN D;  3AN2 D;  5B32 B;  3V9R B;  3AV2 A;  1P3M C;  5B1L C;  3KUY C;  1M1A D;  3AZM B;  1AOI A;  4J8X A;  4YM6 B;  3REH D;  1P34 C;  3LEL B;  5B32 G;  4Z66 D;  3MGQ D;  1P3L D;  3AZK C;  3UTA D;  5GT0 B;  3NQJ A;  3KXB D;  4WU9 D;  4NE6 A;  5B2I C;  4KUD C;  1M1A A;  5AVC C;  4CSR A;  2NQB D;  3WKJ D;  4EO5 B;  5B24 A;  3X1T D;  4QLC B;  3REH A;  5AV9 A;  3MGQ A;  5B0Y C;  4J8U C;  5B31 C;  2HUE B;  4Z5T C;  1P3G C;  1P3L A;  4E45 A;  5DNN D;  5AY8 B;  4H9R B;  4WU9 A;  4LD9 C;  3VH5 W;  3AZI C;  2NQB A;  2CV5 C;  3REL D;  1WWS A;  4KHA B;  5AV6 A;  3WKJ A;  3FDD A;  3LJA D;  1F66 A;  3WA9 D;  5CPJ B;  2HIO B;  4J8V B;  3X1U A;  1P3B C;  5B33 C;  3KWQ C;  3AYW C;  2F8N B;  3AZE D;  3TU4 B;  5B2J D;  1P3M B;  1ID3 A;  5AV5 A;  3AZG A;  2FFF B;  4KGC D;  5DNN A;  5JRG B;  3AV1 B;  5G49 A;  1S32 A;  2F8N H;  2F8N G;  2IO5 B;  4XZQ D;  2JCH A;  3AZJ B;  1B67 A;  4HGA B;  3LJA A;  4Z2M G;  4ZUX B;  4Z2M H;  1KX3 D;  5GXQ B;  3W99 D;  1M18 D;  2ZM5 A;  1U35 C;  4KGC A;  4JJN C;  4YS3 B;  3C1B B;  4H9N A;  3WTP D;  3AFA D;  5BS7 A;  3MGS A;  5AV8 A;  2Y2M A;  4XZQ A;  3REI C;  1P3A A;  1ZLA D;  5B40 B;  1TZY A;  3UT9 B;  3W97 B;  1KX3 A;  3WAA D;  5CP6 C;  3O62 A;  3C1C D;  4G92 C;  1BH8 A;  1P3F A;  4XUJ C;  3MGP D;  5GT3 C;  5AVB B;  3B6G A;  3F6T A;  4WU8 B;  3AFA A;  2NZD A;  1KX5 C;  3AYW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...