2CV5D

Crystal structure of human nucleosome core particle
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
96
structure length
96
Chain Sequence
b'KRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (146-MER)
publication title Alteration of the nucleosomal DNA path in the crystal structure of a human nucleosome core particle
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 35
structure length 96
sequence length 96
chains with identical sequence H
ec nomenclature
pdb deposition date 2005-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2cv5D00
5B33A 3O62C 3AV2D 4JJNA 5AV9B 3UT9D 3REJD 3WKJC 1KX4B 5JA4A 2F8ND 3AYWA 4DRBA 2CV5C 3AZMB 2HIOB 3X1VC 5CPID 4KGCD 4AWLB 4NE5A 5GSUB 3AZHB 2IO5B 3NQJB 3O62B 1M1AB 3WA9D 4KUDC 5AVBD 1P3MD 3AZJA 3MVDD 5DNNB 4J8VB 3AV2C 4YS3A 3MNNB 3X1VB 4H9NA 5B32C 5BNVB 3UTBD 3UT9C 4LD9B 3REJC 1P3LA 1P3KC 5B2ID 4H9PB 3WTPC 3KXBD 4XUJA 3AZGA 5CPKA 4EO5B 4H9QB 5CPIC 4KGCC 3LELD 3REHC 3X1SA 3UTAA 5B40A 5B2JC 5B31D 3WAAC 3A6NC 4Z5TB 5AV5A 1P3MC 3B6GA 3MGRD 1M18D 1HQ3A 1U35A 3MGQA 3MVDC 2F8NB 5FUGB 1WWSA 5E5AB 1N1JA 5CPIB 3AFAD 3VH6A 3WA9B 3RELB 3AZNB 5B2IC 5AVBB 3AZLA 4E44A 5CPJD 3KXBC 5JRGA 4J8UC 1KX3D 3WKJA 5B1MA 2BYKA 1TAFB 5B31C 5AV8D 3W96D 3B6FD 4NE3A 3TU4A 3UTBB 3C1CD 4CAYA 1F66D 1A7WA 2AROD 3MGRC 1M18C 4KUDA 5AV6C 1M19A 3AV1B 4J8WA 3LELB 3MGPD 3AFAC 1P34C 3X1UD 5B32A 5AVCD 4WU9D 3AZED 5CPJC 4QLCD 2NQBD 1P3KA 1KX5D 1AOID 3MGRB 1BH9A 3REKD 3WTPA 3X1TD 2YFWA 3W96C 5KDMB 3REHA 1P3PA 3W99A 5B2JA 3C1CC 3AFAB 3WAAA 2AROC 3A6NA 3AZKA 4H9RB 1KX3B 4J8XA 3REID 4UUZB 2BYMA 5AV8B 3X1UC 5GT3A 3B6FB 2PYOC 5AVCC 5GXQA 3LJAA 3AZEC 3AZIA 4WU9C 4H9SC 3C1CB 2LY8A 1F66B 4WZSB 2AROB 5G49A 4G91B 4M6BA 2NZDD 4J8UA 2HIOD 4ZUXA 1P3GD 1P3BC 3KSYA 4WU8A 3MGPB 3R45B 1P3AD 5GSUD 3AZHD 1M1AD 1TZYB 2HUEB 3AN2A 4QLCB 2NQBB 1KX5B 1P3IB 1AOIB 5AV6A 4YM6D 3REIC 3REKB 3X1TB 5DNND 5AY8A 2JSSA 5DNMA 2F8NH 5CP6A 4LD9D 3KWQD 1P34A 1KX4C 5JA4B 5F99A 2NZDC 3C1BD 3W98D 2HIOC 4ZBJC 1P3GC 4CSRB 5GSUC 5BO0A 2IO5C 3AZHC 1P3OA 1M1AC 1WWIA 4Z5TD 4H9OA 5BT1D 1ID3D 5DNNC 2NZDB 4J8VC 4YS3B 5E5AD 4ZBJB 3MNNC 4G92C 1P3GB 4WNNA 4H9NB 5GT0A 1S32D 1BFMA 4LD9C 3KWQC 1P3AB 5B0ZA 1P3LB 3RELD 2PYOA 1EQZD 3AZND 2FJ7D 3AZGB 4EO5C 5B0YA 4YM6B 3LZ0A 5B40B 4R8PD 2YFVA 3VH5W 4Z5TC 4G92B 5AV5B 5C3IC 1P3BA 3MGSA 3KWQB 3AZFA 1HQ3B 5BT1C 1HTAA 3C1BB 5E5AC 3AV1D 3W98B 3LZ1D 1S32C 3WA9C 3RELC 1EQZC 3AZNC 5AV9A 5AVBC 3AZLB 5B1LA 5C3IB 4Z2MH 5JRGB 1KX4A 5B1MB 4WV4B 3W97D 5BNXB 1ID3B 3AZMA 3V9RB 5GXQD 5B24A 3TU4B 3AZID 1S32B 3UTBC 3B0DB 3NQJA 3O62A 1EQZB 2FJ7B 4NE6A 4X23D 3AV1C 4J8WB 3LELC 4R8PB 4J8VA 2CV5A 3MNNA 3X1VA 3NQUB 4DRAA 1BH9B 4H9PA 2YFWB 4H9QA 1P3FD 3LZ1B 1P3PB 4HGAB 3AV2A 1TZYD 3KUYD 3AZKB 4XZQD 3UT9A 1ZLAD 4Z66D 3REJA 1KX3C 1P3ID 3W97B 2F8NA 5FUGA 5B33D 5AV8C 3B6FC 5GT3B 5CPIA 4KGCA 4JJND 5GXQB 3LJAB 2RVQD 3AZIB 1F66C 3WA9A 5G49B 4G91C 5AVBA 3AYWD 5BS7C 4X23B 1JFIB 1P3MA 5B32G 4ZUXB 1P3FC 5GT0D 3MGPC 4WU8B 3MVDA 1TZYC 2HUEC 4XZQC 3UTBA 4QLCC 2NQBC 1KX5C 1P3IC 1AOIC 5B2IA 3LZ0D 3AZJD 3REKC 3X1TC 3KXBA 4YS3D 5DNMB 1P3FB 3LELA 4JJNC 5CP6B 5B31A 1P3LD 1H3OB 3KUYB 5F99B 4XZQB 4XUJD 3AZGD 4Z66B 5CPKD 1ZLAB 3MGRA 1M18A 3X1SD 3UTAD 5B40D 5B33B 1ULYA 5BO0B 5KDMA 4KHAA 4JJNB 5AV5D 3AFAA 3B6GD 5B31G 1HQ3D 1U35D 3MGQD 3AYWB 5CPJA 1Q9CA 4YS3C 5GT0B 3VH5T 1P3AC 3W96A 3B6FA 1P3LC 3AZLD 5CHLB 4XUJC 3C1CA 5JRGD 3AZGC 5CPKC 2AROA 1F66A 3WKJD 5B1MD 5B0YB 4YM6C 3LZ0B 3AZJB 5B40C 2YFVB 3VH5A 5AV5C 1BH8A 3MGPA 3TU4D 3MGSB 3X1UA 3AZFB 4KUDD 1HQ3C 5AVCA 3AZEA 4WU9A 1U35C 1M19D 4H9SA 4QLCA 4XUJB 3C1BC 5CPKB 2NQBA 1KX5A 1AOIA 4J8WD 3W98C 3REKA 3X1SB 3UTAB 3X1TA 1R4VA 3AZLC 5B32D 5B1LB 1B6WA 5JRGC 5B1MC 1P3KD 3B6GB 1U35B 3WTPD 3MGQB 1ID3C 1N1JB 3REHD 1P3PD 3REIA 4CSRA 5B24B 3TU4C 3W99D 5B2JD 2L5AA 3B0DC 3WAAD 3A6ND 2FJ7C 3B0CW 3AZKD 1M19C 3WKJB 4J8WC 4J8XD 2BYKB 4R8PC 2NZDA 2CV5B 2HIOA 5GT3D 1P3GA 1KU5A 4E45A 3LJAD 1P3AA 5GSUA 3AZHA 4CAYB 1M1AA 3WTPE 4KUDB 1M19B 4J8UD 4ZUXD 3LZ1C 1P3PC 4YM6A 3W99C 4WU8D 4HGAC 5DNNA 2CWEA 3AV2B 1F1EA 3VH6T 5BNVA 5B32B 3AZKC 3AN2D 3UT9B 4LD9A 3KWQA 3REJB 4J8XC 1P3KB 3W97C 5AV6D 3WTPB 3C1BA 3W98A 5AY8D 5GT3C 5DNMD 4KGCB 3REHB 5GXQC 5CP6D 3LJAC 3AZIC 3W99B 5B2JB 1P34D 3WAAB 3A6NB 4Z5TA 5F99D 2F8NK 4X23C 1P3MB 4ZUXC 4J8XB 4NFTA 4WU8C 5BNXA 1P3IA 1ID3A 3MVDB 1P3OD 5E5AA 2BYMB 3V9RA 1B67A 1S32A 3AN2C 3VH6W 3RELA 1EQZA 3AZNA 2FJ7A 5B2IB 3KXBB 3B0BA 5AY8C 4J8UB 5DNMC 5CP6C 4R8PA 1TAFA 5B31B 5B0ZD 2F8NG 2PYOD 3KUYC 5F99C 1ZLAC 3AN2B 4Z66C 3NQUA 1M18B 5B0YD 5AV6B 5B33C 1P3OC 3AV1A 5AY8B 3LZ1A 4KHAB 1P3BD 2RVQC 3MGSD 1P34B 3AZFD 3AYWC 5CPJB 3W97A 5GT0C 1P3OB 5B0ZC 3W96B 5AV9D 5B1LD 4H9OB 1KX4D 5B0YC 3LZ0C 3AZJC 4X23A 1JFIA 4H9RA 3AZMD 1KX3A 4WNNB 1BH8B 5B24D 4UUZA 3MGSC 5AV8A 3O62D 3X1UB 5B0ZB 3AZFC 2PYOB 5AVCB 3AZEB 4WU9B 3X1SC 3UTAC 5BS7A 4J8VD 2CV5D 3MNND 1P3FA 3X1VD 5AV9C 5B1LC 1P3BB 3R45A 1TZYA 3B0CT 1H3OA 3B6GC 3KUYA 4Z2MG 3MGQC 4XZQA 1ZLAA 4Z66A 3AZMC 4AWLC 3REIB 5B24C
chains in the Genus database with same CATH superfamily
5B33A 3O62C 3AV2D 4JJNA 5AV9B 3UT9D 3REJD 3WKJC 1KX4B 5JA4A 4UPKA 2F8ND 3AYWA 4DRBA 2CV5C 3AZMB 2G5HC 2HIOB 3X1VC 5CPID 4KGCD 4AWLB 4NE5A 5GSUB 3AZHB 2IO5B 3NQJB 3O62B 1M1AB 3WA9D 4KUDC 5AVBD 1P3MD 3AZJA 3MVDD 5DNNB 4J8VB 3AV2C 4YS3A 3MNNB 3X1VB 3A1KA 4H9NA 5B32C 5BNVB 3UTBD 3UT9C 4LD9B 3REJC 1P3LA 1P3KC 5B2ID 4H9PB 3WTPC 3KXBD 4XUJA 3AZGA 5CPKA 4EO5B 4H9QB 5CPIC 4KGCC 3LELD 3REHC 3X1SA 3UTAA 5B40A 5B2JC 5B31D 3WAAC 3A6NC 4Z5TB 2Y2LA 5AV5A 1P3MC 3B6GA 3MGRD 1M18D 1HQ3A 1U35A 3MGQA 3MVDC 2F8NB 5FUGB 1WWSA 5E5AB 1N1JA 5CPIB 2DF4C 3AFAD 3VH6A 3WA9B 3RELB 3AZNB 5B2IC 5AVBB 3AZLA 4E44A 5CPJD 3KXBC 3FDDA 5JRGA 4J8UC 1KX3D 3WKJA 5B1MA 2BYKA 2FFFB 1TAFB 5B31C 5AV8D 3W96D 3B6FD 4NE3A 3TU4A 3UTBB 3C1CD 4CAYA 1F66D 1A7WA 2AROD 3A1IA 3MGRC 1M18C 4KUDA 5AV6C 3EPHA 2Y2IA 1M19A 3AV1B 4J8WA 3LELB 3MGPD 3AFAC 2RIQA 1P34C 3X1UD 2Y2HA 5B32A 5AVCD 4WU9D 3AZED 5CPJC 4QLCD 2NQBD 1P3KA 1KX5D 1AOID 3MGRB 1BH9A 3REKD 3X1TD 3WTPA 2YFWA 2Y2JA 2JCHA 3W96C 5KDMB 3REHA 1P3PA 3W99A 5B2JA 3C1CC 3AFAB 3WAAA 2AROC 3A6NA 3AZKA 4H9RB 1KX3B 4J8XA 3REID 4UUZB 4DQYB 2BYMA 5AV8B 3X1UC 5GT3A 3B6FB 2PYOC 5AVCC 5GXQA 3LJAA 3AZEC 3AZIA 4WU9C 4H9SC 3C1CB 2LY8A 1F66B 4WZSB 2AROB 5G49A 4G91B 4M6BA 2NZDD 4J8UA 2HIOD 4ZUXA 1P3GD 1P3BC 3KSYA 4WU8A 3MGPB 3R45B 1P3AD 5GSUD 3AZHD 1M1AD 1TZYB 2HUEB 3AN2A 4QLCB 2NQBB 3EPKA 1KX5B 1P3IB 1AOIB 5AV6A 4YM6D 3REIC 3REKB 3X1TB 5DNND 5AY8A 2JSSA 5DNMA 2F8NH 5CP6A 4LD9D 3KWQD 3EPJA 1P34A 1KX4C 5JA4B 5F99A 2NZDC 3C1BD 3W98D 2HIOC 4ZBJC 1P3GC 4CSRB 5GSUC 5BO0A 2IO5C 3AZHC 1P3OA 1M1AC 1WWIA 4Z5TD 4H9OA 5BT1D 1ID3D 5DNNC 2NZDB 4J8VC 4YS3B 5E5AD 4ZBJB 3MNNC 4G92C 1P3GB 4WNNA 4H9NB 5GT0A 1S32D 1BFMA 4LD9C 3KWQC 1P3AB 5B0ZA 2ZY4A 1P3LB 3RELD 2PYOA 1EQZD 3AZND 2FJ7D 2UWXA 3AZGB 4EO5C 5B0YA 4YM6B 3LZ0A 5B40B 4R8PD 2YFVA 3VH5W 4Z5TC 4G92B 5AV5B 5C3IC 1P3BA 3MGSA 3KWQB 3AZFA 1Z2CB 3EG5B 1HQ3B 5BT1C 1HTAA 3C1BB 5E5AC 3AV1D 3W98B 3LZ1D 1S32C 3WA9C 3RELC 1EQZC 3AZNC 2VQRA 5AV9A 5AVBC 3AZLB 5B1LA 5C3IB 4Z2MH 5JRGB 1KX4A 5B1MB 4WV4B 3W97D 5BNXB 1ID3B 3AZMA 2DQNC 3V9RB 5GXQD 5B24A 3TU4B 3AZID 1S32B 3UTBC 3B0DB 3NQJA 3O62A 1EQZB 2FJ7B 4NE6A 4X23D 3AV1C 3H0LC 4J8WB 3LELC 4R8PB 1PZRA 4J8VA 2CV5A 3MNNA 3X1VA 3NQUB 4DRAA 1BH9B 4H9PA 2YFWB 4H9QA 1P3FD 3LZ1B 1P3PB 4HGAB 3AV2A 1TZYD 3KUYD 3F6TA 3AZKB 4XZQD 3UT9A 1ZLAD 4Z66D 3REJA 1KX3C 1P3ID 3W97B 2F8NA 5FUGA 5B33D 5AV8C 3B6FC 5GT3B 5CPIA 4KGCA 3P5JB 4JJND 5GXQB 3LJAB 2RVQD 3AZIB 1F66C 3WA9A 5G49B 4G91C 5AVBA 3AYWD 5BS7C 4X23B 1JFIB 1P3MA 5B32G 4ZUXB 1P3FC 5GT0D 3MGPC 4WU8B 3MVDA 1TZYC 2HUEC 4XZQC 3UTBA 4QLCC 2NQBC 1KX5C 1P3IC 1AOIC 5B2IA 3LZ0D 3AZJD 3REKC 3X1TC 3KXBA 4YS3D 5DNMB 1P3FB 3LELA 4JJNC 5CP6B 5B31A 2G5IC 1P3LD 1W2EA 1H3OB 3KUYB 3H0RC 5F99B 4XZQB 4XUJD 3AZGD 4Z66B 5CPKD 1ZLAB 3MGRA 1M18A 3X1SD 3UTAD 5B40D 5B33B 1ULYA 5BO0B 5KDMA 4KHAA 4JJNB 2XD1A 2ZY3A 5AV5D 3AFAA 4WJ3C 3B6GD 5B31G 1HQ3D 1U35D 3MGQD 3AYWB 5CPJA 1Q9CA 4YS3C 5GT0B 3VH5T 1P3AC 3W96A 3B6FA 1P3LC 3AZLD 2F2AC 5CHLB 4XUJC 3C1CA 5JRGD 3AZGC 5CPKC 2AROA 1F66A 3WKJD 5B1MD 2W8SA 5B0YB 4YM6C 3LZ0B 5B40C 3AZJB 3EPLA 2YFVB 3VH5A 5AV5C 1BH8A 3MGPA 3TU4D 3MGSB 2Y2PA 3X1UA 3AZFB 2ZM5A 4KUDD 1HQ3C 5AVCA 3AZEA 4WU9A 1U35C 1M19D 4H9SA 4QLCA 4XUJB 3C1BC 5CPKB 2NQBA 1KX5A 1AOIA 4J8WD 3W98C 3REKA 3X1SB 3UTAB 3X1TA 1R4VA 3AZLC 5B32D 5B1LB 1B6WA 5JRGC 5B1MC 1P3KD 3B6GB 1U35B 3WTPD 3MGQB 2XD5A 1ID3C 3KFUG 1N1JB 3REHD 1P3PD 3REIA 4CSRA 5B24B 3TU4C 3W99D 5B2JD 2L5AA 3B0DC 3WAAD 3A6ND 2FJ7C 3B0CW 3AZKD 1M19C 3WKJB 4J8WC 4J8XD 2BYKB 4R8PC 2NZDA 2CV5B 2HIOA 5GT3D 1P3GA 1KU5A 4E45A 3LJAD 1P3AA 5GSUA 3AZHA 4CAYB 1M1AA 2JE5A 3WTPE 4KUDB 1M19B 4J8UD 4ZUXD 3LZ1C 1P3PC 4YM6A 2J8PA 3W99C 4WU8D 4HGAC 5DNNA 2CWEA 3AV2B 1F1EA 3VH6T 5BNVA 5B32B 3AZKC 3AN2D 3UT9B 4LD9A 2ZY5A 3KWQA 3REJB 4J8XC 1P3KB 3W97C 5AV6D 3WTPB 3C1BA 3W98A 5AY8D 5GT3C 5DNMD 4KGCB 3REHB 2Y2KA 5GXQC 5CP6D 3LJAC 3AZIC 5B2JB 3W99B 1P34D 3WAAB 3A6NB 4Z5TA 5F99D 2F8NK 4X23C 1P3MB 4ZUXC 4J8XB 4NFTA 4WU8C 5BNXA 1T3UA 1P3IA 3MVDB 1ID3A 1P3OD 3H0MC 2BYMB 3V9RA 5E5AA 1B67A 1S32A 3AN2C 3VH6W 3RELA 1EQZA 3AZNA 2FJ7A 5B2IB 3KXBB 3B0BA 5AY8C 4J8UB 5DNMC 5CP6C 4R8PA 1TAFA 5B31B 2ZY2A 5B0ZD 2F8NG 2PYOD 3KUYC 5F99C 1ZLAC 3AN2B 4Z66C 3NQUA 1M18B 5B0YD 5AV6B 2BG1A 5B33C 1P3OC 3AV1A 5AY8B 3LZ1A 4KHAB 1P3BD 2RVQC 3MGSD 1P34B 3AZFD 3AYWC 5CPJB 3W97A 5GT0C 1P3OB 5B0ZC 3W96B 5AV9D 5B1LD 4H9OB 2Y2NA 1KX4D 5B0YC 3LZ0C 3AZJC 4X23A 1JFIA 4H9RA 3AZMD 1KX3A 4WNNB 1BH8B 5B24D 4UUZA 3MGSC 5AV8A 3O62D 3X1UB 5B0ZB 3AZFC 2PYOB 5AVCB 3AZEB 4WU9B 3IP4C 3X1SC 3UTAC 5BS7A 4J8VD 2CV5D 3MNND 1P3FA 3X1VD 2Y2MA 5AV9C 2Y2GA 3AL0C 5B1LC 1P3BB 2Y2OA 3R45A 1TZYA 3B0CT 1H3OA 3B6GC 3KUYA 4Z2MG 3MGQC 4XZQA 1ZLAA 4Z66A 3AZMC 4AWLC 3REIB 2Y2QA 5B24C
chains in the Genus database with same CATH topology
5B33A 3O62C 3AV2D 4JJNA 5AV9B 3UT9D 3REJD 3WKJC 1KX4B 5JA4A 4UPKA 2F8ND 3AYWA 4DRBA 2CV5C 3AZMB 2G5HC 2HIOB 3X1VC 5CPID 4KGCD 4AWLB 4NE5A 5GSUB 3AZHB 2IO5B 3NQJB 3O62B 1M1AB 3WA9D 4KUDC 5AVBD 1P3MD 3AZJA 3MVDD 5DNNB 4J8VB 3AV2C 4YS3A 3MNNB 3X1VB 3A1KA 4H9NA 5B32C 5BNVB 3UTBD 3UT9C 4LD9B 3REJC 1P3LA 1P3KC 5B2ID 4H9PB 3WTPC 3KXBD 4XUJA 3AZGA 5CPKA 4EO5B 4H9QB 5CPIC 4KGCC 3LELD 3REHC 3X1SA 3UTAA 5B40A 5B2JC 5B31D 3WAAC 3A6NC 4Z5TB 2Y2LA 5AV5A 1P3MC 3B6GA 3MGRD 1M18D 1HQ3A 1U35A 3MGQA 3MVDC 2F8NB 5FUGB 1WWSA 5E5AB 1N1JA 5CPIB 2DF4C 3AFAD 3VH6A 3WA9B 3RELB 3AZNB 5B2IC 5AVBB 3AZLA 4E44A 5CPJD 3KXBC 3FDDA 5JRGA 4J8UC 1KX3D 3WKJA 5B1MA 2BYKA 2FFFB 1TAFB 5B31C 5AV8D 3W96D 3B6FD 4NE3A 3TU4A 3UTBB 3C1CD 4CAYA 1F66D 1A7WA 2AROD 3A1IA 3MGRC 1M18C 4KUDA 5AV6C 3EPHA 2Y2IA 1M19A 3AV1B 4J8WA 3LELB 3MGPD 3AFAC 2RIQA 1P34C 3X1UD 2Y2HA 5B32A 5AVCD 4WU9D 3AZED 5CPJC 4QLCD 2NQBD 1P3KA 1KX5D 1AOID 3MGRB 1BH9A 3REKD 3X1TD 3WTPA 2YFWA 2Y2JA 2JCHA 3W96C 5KDMB 3REHA 1P3PA 3W99A 5B2JA 3C1CC 3AFAB 3WAAA 2AROC 3A6NA 3AZKA 4H9RB 1KX3B 4J8XA 3REID 4UUZB 4DQYB 2BYMA 5AV8B 3X1UC 5GT3A 3B6FB 2PYOC 5AVCC 5GXQA 3LJAA 3AZEC 3AZIA 4WU9C 4H9SC 3C1CB 2LY8A 1F66B 4WZSB 2AROB 5G49A 4G91B 4M6BA 2NZDD 4J8UA 2HIOD 4ZUXA 1P3GD 1P3BC 3KSYA 4WU8A 3MGPB 3R45B 1P3AD 5GSUD 3AZHD 1M1AD 1TZYB 2HUEB 3AN2A 4QLCB 2NQBB 3EPKA 1KX5B 1P3IB 1AOIB 5AV6A 4YM6D 3REIC 3REKB 3X1TB 5DNND 5AY8A 2JSSA 5DNMA 2F8NH 5CP6A 4LD9D 3KWQD 3EPJA 1P34A 1KX4C 5JA4B 5F99A 2NZDC 3C1BD 3W98D 2HIOC 4ZBJC 1P3GC 4CSRB 5GSUC 5BO0A 2IO5C 3AZHC 1P3OA 1M1AC 1WWIA 4Z5TD 4H9OA 5BT1D 1ID3D 5DNNC 2NZDB 4J8VC 4YS3B 5E5AD 4ZBJB 3MNNC 4G92C 1P3GB 4WNNA 4H9NB 5GT0A 1S32D 1BFMA 4LD9C 3KWQC 1P3AB 5B0ZA 2ZY4A 1P3LB 3RELD 2PYOA 1EQZD 3AZND 2FJ7D 2UWXA 3AZGB 4EO5C 5B0YA 4YM6B 3LZ0A 5B40B 4R8PD 2YFVA 3VH5W 4Z5TC 4G92B 5AV5B 5C3IC 1P3BA 3MGSA 3KWQB 3AZFA 1Z2CB 3EG5B 1HQ3B 5BT1C 1HTAA 3C1BB 5E5AC 3AV1D 3W98B 3LZ1D 1S32C 3WA9C 3RELC 1EQZC 3AZNC 2VQRA 5AV9A 5AVBC 3AZLB 5B1LA 5C3IB 4Z2MH 5JRGB 1KX4A 5B1MB 4WV4B 3W97D 5BNXB 1ID3B 3AZMA 2DQNC 3V9RB 5GXQD 5B24A 3TU4B 3AZID 1S32B 3UTBC 3B0DB 3NQJA 3O62A 1EQZB 2FJ7B 4NE6A 4X23D 3AV1C 3H0LC 4J8WB 3LELC 4R8PB 1PZRA 4J8VA 2CV5A 3MNNA 3X1VA 3NQUB 4DRAA 1BH9B 4H9PA 2YFWB 4H9QA 1P3FD 3LZ1B 1P3PB 4HGAB 3AV2A 1TZYD 3KUYD 3F6TA 3AZKB 4XZQD 3UT9A 1ZLAD 4Z66D 3REJA 1KX3C 1P3ID 3W97B 2F8NA 5FUGA 5B33D 5AV8C 3B6FC 5GT3B 5CPIA 4KGCA 3P5JB 4JJND 5GXQB 3LJAB 2RVQD 3AZIB 1F66C 3WA9A 5G49B 4G91C 5AVBA 3AYWD 5BS7C 4X23B 1JFIB 1P3MA 5B32G 4ZUXB 1P3FC 5GT0D 3MGPC 4WU8B 3MVDA 1TZYC 2HUEC 4XZQC 3UTBA 4QLCC 2NQBC 1KX5C 1P3IC 1AOIC 5B2IA 3LZ0D 3AZJD 3REKC 3X1TC 3KXBA 4YS3D 5DNMB 1P3FB 3LELA 4JJNC 5CP6B 5B31A 2G5IC 1P3LD 1W2EA 1H3OB 3KUYB 3H0RC 5F99B 4XZQB 4XUJD 3AZGD 4Z66B 5CPKD 1ZLAB 3MGRA 1M18A 3X1SD 3UTAD 5B40D 5B33B 1ULYA 5BO0B 5KDMA 4KHAA 4JJNB 2XD1A 2ZY3A 5AV5D 3AFAA 4WJ3C 3B6GD 5B31G 1HQ3D 1U35D 3MGQD 3AYWB 5CPJA 1Q9CA 4YS3C 5GT0B 3VH5T 1P3AC 3W96A 3B6FA 1P3LC 3AZLD 2F2AC 5CHLB 4XUJC 3C1CA 5JRGD 3AZGC 5CPKC 2AROA 1F66A 3WKJD 5B1MD 2W8SA 5B0YB 4YM6C 3LZ0B 5B40C 3AZJB 3EPLA 2YFVB 3VH5A 5AV5C 1BH8A 3MGPA 3TU4D 3MGSB 2Y2PA 3X1UA 3AZFB 2ZM5A 4KUDD 1HQ3C 5AVCA 3AZEA 4WU9A 1U35C 1M19D 4H9SA 4QLCA 4XUJB 3C1BC 5CPKB 2NQBA 1KX5A 1AOIA 4J8WD 3W98C 3REKA 3X1SB 3UTAB 3X1TA 1R4VA 3AZLC 5B32D 5B1LB 1B6WA 5JRGC 5B1MC 1P3KD 3B6GB 1U35B 3WTPD 3MGQB 2XD5A 1ID3C 3KFUG 1N1JB 3REHD 1P3PD 3REIA 4CSRA 5B24B 3TU4C 3W99D 5B2JD 2L5AA 3B0DC 3WAAD 3A6ND 2FJ7C 3B0CW 3AZKD 1M19C 3WKJB 4J8WC 4J8XD 2BYKB 4R8PC 2NZDA 2CV5B 2HIOA 5GT3D 1P3GA 1KU5A 4E45A 3LJAD 1P3AA 5GSUA 3AZHA 4CAYB 1M1AA 2JE5A 3WTPE 4KUDB 1M19B 4J8UD 4ZUXD 3LZ1C 1P3PC 4YM6A 2J8PA 3W99C 4WU8D 4HGAC 5DNNA 2CWEA 3AV2B 1F1EA 3VH6T 5BNVA 5B32B 3AZKC 3AN2D 3UT9B 4LD9A 2ZY5A 3KWQA 3REJB 4J8XC 1P3KB 3W97C 5AV6D 3WTPB 3C1BA 3W98A 5AY8D 5GT3C 5DNMD 4KGCB 3REHB 2Y2KA 5GXQC 5CP6D 3LJAC 3AZIC 5B2JB 3W99B 1P34D 3WAAB 3A6NB 4Z5TA 5F99D 2F8NK 4X23C 1P3MB 4ZUXC 4J8XB 4NFTA 4WU8C 5BNXA 1T3UA 1P3IA 3MVDB 1ID3A 1P3OD 3H0MC 2BYMB 3V9RA 5E5AA 1B67A 1S32A 3AN2C 3VH6W 3RELA 1EQZA 3AZNA 2FJ7A 5B2IB 3KXBB 3B0BA 5AY8C 4J8UB 5DNMC 5CP6C 4R8PA 1TAFA 5B31B 2ZY2A 5B0ZD 2F8NG 2PYOD 3KUYC 5F99C 1ZLAC 3AN2B 4Z66C 3NQUA 1M18B 5B0YD 5AV6B 2BG1A 5B33C 1P3OC 3AV1A 5AY8B 3LZ1A 4KHAB 1P3BD 2RVQC 3MGSD 1P34B 3AZFD 3AYWC 5CPJB 3W97A 5GT0C 1P3OB 5B0ZC 3W96B 5AV9D 5B1LD 4H9OB 2Y2NA 1KX4D 5B0YC 3LZ0C 3AZJC 4X23A 1JFIA 4H9RA 3AZMD 1KX3A 4WNNB 1BH8B 5B24D 4UUZA 3MGSC 5AV8A 3O62D 3X1UB 5B0ZB 3AZFC 2PYOB 5AVCB 3AZEB 4WU9B 3IP4C 3X1SC 3UTAC 5BS7A 4J8VD 2CV5D 3MNND 1P3FA 3X1VD 2Y2MA 5AV9C 2Y2GA 3AL0C 5B1LC 1P3BB 2Y2OA 3R45A 1TZYA 3B0CT 1H3OA 3B6GC 3KUYA 4Z2MG 3MGQC 4XZQA 1ZLAA 4Z66A 3AZMC 4AWLC 3REIB 2Y2QA 5B24C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B33 A;  3O62 C;  3AV2 D;  4JJN A;  5AV9 B;  3UT9 D;  3REJ D;  3WKJ C;  1KX4 B;  5JA4 A;  2F8N D;  3AYW A;  4DRB A;  2CV5 C;  3AZM B;  2HIO B;  3X1V C;  5CPI D;  4KGC D;  4AWL B;  4NE5 A;  5GSU B;  3AZH B;  2IO5 B;  3NQJ B;  3O62 B;  1M1A B;  3WA9 D;  4KUD C;  5AVB D;  1P3M D;  3AZJ A;  3MVD D;  5DNN B;  4J8V B;  3AV2 C;  4YS3 A;  3MNN B;  3X1V B;  4H9N A;  5B32 C;  5BNV B;  3UTB D;  3UT9 C;  4LD9 B;  3REJ C;  1P3L A;  1P3K C;  5B2I D;  4H9P B;  3WTP C;  3KXB D;  4XUJ A;  3AZG A;  5CPK A;  4EO5 B;  4H9Q B;  5CPI C;  4KGC C;  3LEL D;  3REH C;  3X1S A;  3UTA A;  5B40 A;  5B2J C;  5B31 D;  3WAA C;  3A6N C;  4Z5T B;  5AV5 A;  1P3M C;  3B6G A;  3MGR D;  1M18 D;  1HQ3 A;  1U35 A;  3MGQ A;  3MVD C;  2F8N B;  5FUG B;  1WWS A;  5E5A B;  1N1J A;  5CPI B;  3AFA D;  3VH6 A;  3WA9 B;  3REL B;  3AZN B;  5B2I C;  5AVB B;  3AZL A;  4E44 A;  5CPJ D;  3KXB C;  5JRG A;  4J8U C;  1KX3 D;  3WKJ A;  5B1M A;  2BYK A;  1TAF B;  5B31 C;  5AV8 D;  3W96 D;  3B6F D;  4NE3 A;  3TU4 A;  3UTB B;  3C1C D;  4CAY A;  1F66 D;  1A7W A;  2ARO D;  3MGR C;  1M18 C;  4KUD A;  5AV6 C;  1M19 A;  3AV1 B;  4J8W A;  3LEL B;  3MGP D;  3AFA C;  1P34 C;  3X1U D;  5B32 A;  5AVC D;  4WU9 D;  3AZE D;  5CPJ C;  4QLC D;  2NQB D;  1P3K A;  1KX5 D;  1AOI D;  3MGR B;  1BH9 A;  3REK D;  3WTP A;  3X1T D;  2YFW A;  3W96 C;  5KDM B;  3REH A;  1P3P A;  3W99 A;  5B2J A;  3C1C C;  3AFA B;  3WAA A;  2ARO C;  3A6N A;  3AZK A;  4H9R B;  1KX3 B;  4J8X A;  3REI D;  4UUZ B;  2BYM A;  5AV8 B;  3X1U C;  5GT3 A;  3B6F B;  2PYO C;  5AVC C;  5GXQ A;  3LJA A;  3AZE C;  3AZI A;  4WU9 C;  4H9S C;  3C1C B;  2LY8 A;  1F66 B;  4WZS B;  2ARO B;  5G49 A;  4G91 B;  4M6B A;  2NZD D;  4J8U A;  2HIO D;  4ZUX A;  1P3G D;  1P3B C;  3KSY A;  4WU8 A;  3MGP B;  3R45 B;  1P3A D;  5GSU D;  3AZH D;  1M1A D;  1TZY B;  2HUE B;  3AN2 A;  4QLC B;  2NQB B;  1KX5 B;  1P3I B;  1AOI B;  5AV6 A;  4YM6 D;  3REI C;  3REK B;  3X1T B;  5DNN D;  5AY8 A;  2JSS A;  5DNM A;  2F8N H;  5CP6 A;  4LD9 D;  3KWQ D;  1P34 A;  1KX4 C;  5JA4 B;  5F99 A;  2NZD C;  3C1B D;  3W98 D;  2HIO C;  4ZBJ C;  1P3G C;  4CSR B;  5GSU C;  5BO0 A;  2IO5 C;  3AZH C;  1P3O A;  1M1A C;  1WWI A;  4Z5T D;  4H9O A;  5BT1 D;  1ID3 D;  5DNN C;  2NZD B;  4J8V C;  4YS3 B;  5E5A D;  4ZBJ B;  3MNN C;  4G92 C;  1P3G B;  4WNN A;  4H9N B;  5GT0 A;  1S32 D;  1BFM A;  4LD9 C;  3KWQ C;  1P3A B;  5B0Z A;  1P3L B;  3REL D;  2PYO A;  1EQZ D;  3AZN D;  2FJ7 D;  3AZG B;  4EO5 C;  5B0Y A;  4YM6 B;  3LZ0 A;  5B40 B;  4R8P D;  2YFV A;  3VH5 W;  4Z5T C;  4G92 B;  5AV5 B;  5C3I C;  1P3B A;  3MGS A;  3KWQ B;  3AZF A;  1HQ3 B;  5BT1 C;  1HTA A;  3C1B B;  5E5A C;  3AV1 D;  3W98 B;  3LZ1 D;  1S32 C;  3WA9 C;  3REL C;  1EQZ C;  3AZN C;  5AV9 A;  5AVB C;  3AZL B;  5B1L A;  5C3I B;  4Z2M H;  5JRG B;  1KX4 A;  5B1M B;  4WV4 B;  3W97 D;  5BNX B;  1ID3 B;  3AZM A;  3V9R B;  5GXQ D;  5B24 A;  3TU4 B;  3AZI D;  1S32 B;  3UTB C;  3B0D B;  3NQJ A;  3O62 A;  1EQZ B;  2FJ7 B;  4NE6 A;  4X23 D;  3AV1 C;  4J8W B;  3LEL C;  4R8P B;  4J8V A;  2CV5 A;  3MNN A;  3X1V A;  3NQU B;  4DRA A;  1BH9 B;  4H9P A;  2YFW B;  4H9Q A;  1P3F D;  3LZ1 B;  1P3P B;  4HGA B;  3AV2 A;  1TZY D;  3KUY D;  3AZK B;  4XZQ D;  3UT9 A;  1ZLA D;  4Z66 D;  3REJ A;  1KX3 C;  1P3I D;  3W97 B;  2F8N A;  5FUG A;  5B33 D;  5AV8 C;  3B6F C;  5GT3 B;  5CPI A;  4KGC A;  4JJN D;  5GXQ B;  3LJA B;  2RVQ D;  3AZI B;  1F66 C;  3WA9 A;  5G49 B;  4G91 C;  5AVB A;  3AYW D;  5BS7 C;  4X23 B;  1JFI B;  1P3M A;  5B32 G;  4ZUX B;  1P3F C;  5GT0 D;  3MGP C;  4WU8 B;  3MVD A;  1TZY C;  2HUE C;  4XZQ C;  3UTB A;  4QLC C;  2NQB C;  1KX5 C;  1P3I C;  1AOI C;  5B2I A;  3LZ0 D;  3AZJ D;  3REK C;  3X1T C;  3KXB A;  4YS3 D;  5DNM B;  1P3F B;  3LEL A;  4JJN C;  5CP6 B;  5B31 A;  1P3L D;  1H3O B;  3KUY B;  5F99 B;  4XZQ B;  4XUJ D;  3AZG D;  4Z66 B;  5CPK D;  1ZLA B;  3MGR A;  1M18 A;  3X1S D;  3UTA D;  5B40 D;  5B33 B;  1ULY A;  5BO0 B;  5KDM A;  4KHA A;  4JJN B;  5AV5 D;  3AFA A;  3B6G D;  5B31 G;  1HQ3 D;  1U35 D;  3MGQ D;  3AYW B;  5CPJ A;  1Q9C A;  4YS3 C;  5GT0 B;  3VH5 T;  1P3A C;  3W96 A;  3B6F A;  1P3L C;  3AZL D;  5CHL B;  4XUJ C;  3C1C A;  5JRG D;  3AZG C;  5CPK C;  2ARO A;  1F66 A;  3WKJ D;  5B1M D;  5B0Y B;  4YM6 C;  3LZ0 B;  3AZJ B;  5B40 C;  2YFV B;  3VH5 A;  5AV5 C;  1BH8 A;  3MGP A;  3TU4 D;  3MGS B;  3X1U A;  3AZF B;  4KUD D;  1HQ3 C;  5AVC A;  3AZE A;  4WU9 A;  1U35 C;  1M19 D;  4H9S A;  4QLC A;  4XUJ B;  3C1B C;  5CPK B;  2NQB A;  1KX5 A;  1AOI A;  4J8W D;  3W98 C;  3REK A;  3X1S B;  3UTA B;  3X1T A;  1R4V A;  3AZL C;  5B32 D;  5B1L B;  1B6W A;  5JRG C;  5B1M C;  1P3K D;  3B6G B;  1U35 B;  3WTP D;  3MGQ B;  1ID3 C;  1N1J B;  3REH D;  1P3P D;  3REI A;  4CSR A;  5B24 B;  3TU4 C;  3W99 D;  5B2J D;  2L5A A;  3B0D C;  3WAA D;  3A6N D;  2FJ7 C;  3B0C W;  3AZK D;  1M19 C;  3WKJ B;  4J8W C;  4J8X D;  2BYK B;  4R8P C;  2NZD A;  2CV5 B;  2HIO A;  5GT3 D;  1P3G A;  1KU5 A;  4E45 A;  3LJA D;  1P3A A;  5GSU A;  3AZH A;  4CAY B;  1M1A A;  3WTP E;  4KUD B;  1M19 B;  4J8U D;  4ZUX D;  3LZ1 C;  1P3P C;  4YM6 A;  3W99 C;  4WU8 D;  4HGA C;  5DNN A;  2CWE A;  3AV2 B;  1F1E A;  3VH6 T;  5BNV A;  5B32 B;  3AZK C;  3AN2 D;  3UT9 B;  4LD9 A;  3KWQ A;  3REJ B;  4J8X C;  1P3K B;  3W97 C;  5AV6 D;  3WTP B;  3C1B A;  3W98 A;  5AY8 D;  5GT3 C;  5DNM D;  4KGC B;  3REH B;  5GXQ C;  5CP6 D;  3LJA C;  3AZI C;  3W99 B;  5B2J B;  1P34 D;  3WAA B;  3A6N B;  4Z5T A;  5F99 D;  2F8N K;  4X23 C;  1P3M B;  4ZUX C;  4J8X B;  4NFT A;  4WU8 C;  5BNX A;  1P3I A;  1ID3 A;  3MVD B;  1P3O D;  5E5A A;  2BYM B;  3V9R A;  1B67 A;  1S32 A;  3AN2 C;  3VH6 W;  3REL A;  1EQZ A;  3AZN A;  2FJ7 A;  5B2I B;  3KXB B;  3B0B A;  5AY8 C;  4J8U B;  5DNM C;  5CP6 C;  4R8P A;  1TAF A;  5B31 B;  5B0Z D;  2F8N G;  2PYO D;  3KUY C;  5F99 C;  1ZLA C;  3AN2 B;  4Z66 C;  3NQU A;  1M18 B;  5B0Y D;  5AV6 B;  5B33 C;  1P3O C;  3AV1 A;  5AY8 B;  3LZ1 A;  4KHA B;  1P3B D;  2RVQ C;  3MGS D;  1P34 B;  3AZF D;  3AYW C;  5CPJ B;  3W97 A;  5GT0 C;  1P3O B;  5B0Z C;  3W96 B;  5AV9 D;  5B1L D;  4H9O B;  1KX4 D;  5B0Y C;  3LZ0 C;  3AZJ C;  4X23 A;  1JFI A;  4H9R A;  3AZM D;  1KX3 A;  4WNN B;  1BH8 B;  5B24 D;  4UUZ A;  3MGS C;  5AV8 A;  3O62 D;  3X1U B;  5B0Z B;  3AZF C;  2PYO B;  5AVC B;  3AZE B;  4WU9 B;  3X1S C;  3UTA C;  5BS7 A;  4J8V D;  2CV5 D;  3MNN D;  1P3F A;  3X1V D;  5AV9 C;  5B1L C;  1P3B B;  3R45 A;  1TZY A;  3B0C T;  1H3O A;  3B6G C;  3KUY A;  4Z2M G;  3MGQ C;  4XZQ A;  1ZLA A;  4Z66 A;  3AZM C;  4AWL C;  3REI B;  5B24 C; 
#chains in the Genus database with same CATH topology
 5B33 A;  3O62 C;  3AV2 D;  4JJN A;  5AV9 B;  3UT9 D;  3REJ D;  3WKJ C;  1KX4 B;  5JA4 A;  4UPK A;  2F8N D;  3AYW A;  4DRB A;  2CV5 C;  3AZM B;  2G5H C;  2HIO B;  3X1V C;  5CPI D;  4KGC D;  4AWL B;  4NE5 A;  5GSU B;  3AZH B;  2IO5 B;  3NQJ B;  3O62 B;  1M1A B;  3WA9 D;  4KUD C;  5AVB D;  1P3M D;  3AZJ A;  3MVD D;  5DNN B;  4J8V B;  3AV2 C;  4YS3 A;  3MNN B;  3X1V B;  3A1K A;  4H9N A;  5B32 C;  5BNV B;  3UTB D;  3UT9 C;  4LD9 B;  3REJ C;  1P3L A;  1P3K C;  5B2I D;  4H9P B;  3WTP C;  3KXB D;  4XUJ A;  3AZG A;  5CPK A;  4EO5 B;  4H9Q B;  5CPI C;  4KGC C;  3LEL D;  3REH C;  3X1S A;  3UTA A;  5B40 A;  5B2J C;  5B31 D;  3WAA C;  3A6N C;  4Z5T B;  2Y2L A;  5AV5 A;  1P3M C;  3B6G A;  3MGR D;  1M18 D;  1HQ3 A;  1U35 A;  3MGQ A;  3MVD C;  2F8N B;  5FUG B;  1WWS A;  5E5A B;  1N1J A;  5CPI B;  2DF4 C;  3AFA D;  3VH6 A;  3WA9 B;  3REL B;  3AZN B;  5B2I C;  5AVB B;  3AZL A;  4E44 A;  5CPJ D;  3KXB C;  3FDD A;  5JRG A;  4J8U C;  1KX3 D;  3WKJ A;  5B1M A;  2BYK A;  2FFF B;  1TAF B;  5B31 C;  5AV8 D;  3W96 D;  3B6F D;  4NE3 A;  3TU4 A;  3UTB B;  3C1C D;  4CAY A;  1F66 D;  1A7W A;  2ARO D;  3A1I A;  3MGR C;  1M18 C;  4KUD A;  5AV6 C;  3EPH A;  2Y2I A;  1M19 A;  3AV1 B;  4J8W A;  3LEL B;  3MGP D;  3AFA C;  2RIQ A;  1P34 C;  3X1U D;  2Y2H A;  5B32 A;  5AVC D;  4WU9 D;  3AZE D;  5CPJ C;  4QLC D;  2NQB D;  1P3K A;  1KX5 D;  1AOI D;  3MGR B;  1BH9 A;  3REK D;  3X1T D;  3WTP A;  2YFW A;  2Y2J A;  2JCH A;  3W96 C;  5KDM B;  3REH A;  1P3P A;  3W99 A;  5B2J A;  3C1C C;  3AFA B;  3WAA A;  2ARO C;  3A6N A;  3AZK A;  4H9R B;  1KX3 B;  4J8X A;  3REI D;  4UUZ B;  4DQY B;  2BYM A;  5AV8 B;  3X1U C;  5GT3 A;  3B6F B;  2PYO C;  5AVC C;  5GXQ A;  3LJA A;  3AZE C;  3AZI A;  4WU9 C;  4H9S C;  3C1C B;  2LY8 A;  1F66 B;  4WZS B;  2ARO B;  5G49 A;  4G91 B;  4M6B A;  2NZD D;  4J8U A;  2HIO D;  4ZUX A;  1P3G D;  1P3B C;  3KSY A;  4WU8 A;  3MGP B;  3R45 B;  1P3A D;  5GSU D;  3AZH D;  1M1A D;  1TZY B;  2HUE B;  3AN2 A;  4QLC B;  2NQB B;  3EPK A;  1KX5 B;  1P3I B;  1AOI B;  5AV6 A;  4YM6 D;  3REI C;  3REK B;  3X1T B;  5DNN D;  5AY8 A;  2JSS A;  5DNM A;  2F8N H;  5CP6 A;  4LD9 D;  3KWQ D;  3EPJ A;  1P34 A;  1KX4 C;  5JA4 B;  5F99 A;  2NZD C;  3C1B D;  3W98 D;  2HIO C;  4ZBJ C;  1P3G C;  4CSR B;  5GSU C;  5BO0 A;  2IO5 C;  3AZH C;  1P3O A;  1M1A C;  1WWI A;  4Z5T D;  4H9O A;  5BT1 D;  1ID3 D;  5DNN C;  2NZD B;  4J8V C;  4YS3 B;  5E5A D;  4ZBJ B;  3MNN C;  4G92 C;  1P3G B;  4WNN A;  4H9N B;  5GT0 A;  1S32 D;  1BFM A;  4LD9 C;  3KWQ C;  1P3A B;  5B0Z A;  2ZY4 A;  1P3L B;  3REL D;  2PYO A;  1EQZ D;  3AZN D;  2FJ7 D;  2UWX A;  3AZG B;  4EO5 C;  5B0Y A;  4YM6 B;  3LZ0 A;  5B40 B;  4R8P D;  2YFV A;  3VH5 W;  4Z5T C;  4G92 B;  5AV5 B;  5C3I C;  1P3B A;  3MGS A;  3KWQ B;  3AZF A;  1Z2C B;  3EG5 B;  1HQ3 B;  5BT1 C;  1HTA A;  3C1B B;  5E5A C;  3AV1 D;  3W98 B;  3LZ1 D;  1S32 C;  3WA9 C;  3REL C;  1EQZ C;  3AZN C;  2VQR A;  5AV9 A;  5AVB C;  3AZL B;  5B1L A;  5C3I B;  4Z2M H;  5JRG B;  1KX4 A;  5B1M B;  4WV4 B;  3W97 D;  5BNX B;  1ID3 B;  3AZM A;  2DQN C;  3V9R B;  5GXQ D;  5B24 A;  3TU4 B;  3AZI D;  1S32 B;  3UTB C;  3B0D B;  3NQJ A;  3O62 A;  1EQZ B;  2FJ7 B;  4NE6 A;  4X23 D;  3AV1 C;  3H0L C;  4J8W B;  3LEL C;  4R8P B;  1PZR A;  4J8V A;  2CV5 A;  3MNN A;  3X1V A;  3NQU B;  4DRA A;  1BH9 B;  4H9P A;  2YFW B;  4H9Q A;  1P3F D;  3LZ1 B;  1P3P B;  4HGA B;  3AV2 A;  1TZY D;  3KUY D;  3F6T A;  3AZK B;  4XZQ D;  3UT9 A;  1ZLA D;  4Z66 D;  3REJ A;  1KX3 C;  1P3I D;  3W97 B;  2F8N A;  5FUG A;  5B33 D;  5AV8 C;  3B6F C;  5GT3 B;  5CPI A;  4KGC A;  3P5J B;  4JJN D;  5GXQ B;  3LJA B;  2RVQ D;  3AZI B;  1F66 C;  3WA9 A;  5G49 B;  4G91 C;  5AVB A;  3AYW D;  5BS7 C;  4X23 B;  1JFI B;  1P3M A;  5B32 G;  4ZUX B;  1P3F C;  5GT0 D;  3MGP C;  4WU8 B;  3MVD A;  1TZY C;  2HUE C;  4XZQ C;  3UTB A;  4QLC C;  2NQB C;  1KX5 C;  1P3I C;  1AOI C;  5B2I A;  3LZ0 D;  3AZJ D;  3REK C;  3X1T C;  3KXB A;  4YS3 D;  5DNM B;  1P3F B;  3LEL A;  4JJN C;  5CP6 B;  5B31 A;  2G5I C;  1P3L D;  1W2E A;  1H3O B;  3KUY B;  3H0R C;  5F99 B;  4XZQ B;  4XUJ D;  3AZG D;  4Z66 B;  5CPK D;  1ZLA B;  3MGR A;  1M18 A;  3X1S D;  3UTA D;  5B40 D;  5B33 B;  1ULY A;  5BO0 B;  5KDM A;  4KHA A;  4JJN B;  2XD1 A;  2ZY3 A;  5AV5 D;  3AFA A;  4WJ3 C;  3B6G D;  5B31 G;  1HQ3 D;  1U35 D;  3MGQ D;  3AYW B;  5CPJ A;  1Q9C A;  4YS3 C;  5GT0 B;  3VH5 T;  1P3A C;  3W96 A;  3B6F A;  1P3L C;  3AZL D;  2F2A C;  5CHL B;  4XUJ C;  3C1C A;  5JRG D;  3AZG C;  5CPK C;  2ARO A;  1F66 A;  3WKJ D;  5B1M D;  2W8S A;  5B0Y B;  4YM6 C;  3LZ0 B;  5B40 C;  3AZJ B;  3EPL A;  2YFV B;  3VH5 A;  5AV5 C;  1BH8 A;  3MGP A;  3TU4 D;  3MGS B;  2Y2P A;  3X1U A;  3AZF B;  2ZM5 A;  4KUD D;  1HQ3 C;  5AVC A;  3AZE A;  4WU9 A;  1U35 C;  1M19 D;  4H9S A;  4QLC A;  4XUJ B;  3C1B C;  5CPK B;  2NQB A;  1KX5 A;  1AOI A;  4J8W D;  3W98 C;  3REK A;  3X1S B;  3UTA B;  3X1T A;  1R4V A;  3AZL C;  5B32 D;  5B1L B;  1B6W A;  5JRG C;  5B1M C;  1P3K D;  3B6G B;  1U35 B;  3WTP D;  3MGQ B;  2XD5 A;  1ID3 C;  3KFU G;  1N1J B;  3REH D;  1P3P D;  3REI A;  4CSR A;  5B24 B;  3TU4 C;  3W99 D;  5B2J D;  2L5A A;  3B0D C;  3WAA D;  3A6N D;  2FJ7 C;  3B0C W;  3AZK D;  1M19 C;  3WKJ B;  4J8W C;  4J8X D;  2BYK B;  4R8P C;  2NZD A;  2CV5 B;  2HIO A;  5GT3 D;  1P3G A;  1KU5 A;  4E45 A;  3LJA D;  1P3A A;  5GSU A;  3AZH A;  4CAY B;  1M1A A;  2JE5 A;  3WTP E;  4KUD B;  1M19 B;  4J8U D;  4ZUX D;  3LZ1 C;  1P3P C;  4YM6 A;  2J8P A;  3W99 C;  4WU8 D;  4HGA C;  5DNN A;  2CWE A;  3AV2 B;  1F1E A;  3VH6 T;  5BNV A;  5B32 B;  3AZK C;  3AN2 D;  3UT9 B;  4LD9 A;  2ZY5 A;  3KWQ A;  3REJ B;  4J8X C;  1P3K B;  3W97 C;  5AV6 D;  3WTP B;  3C1B A;  3W98 A;  5AY8 D;  5GT3 C;  5DNM D;  4KGC B;  3REH B;  2Y2K A;  5GXQ C;  5CP6 D;  3LJA C;  3AZI C;  5B2J B;  3W99 B;  1P34 D;  3WAA B;  3A6N B;  4Z5T A;  5F99 D;  2F8N K;  4X23 C;  1P3M B;  4ZUX C;  4J8X B;  4NFT A;  4WU8 C;  5BNX A;  1T3U A;  1P3I A;  3MVD B;  1ID3 A;  1P3O D;  3H0M C;  2BYM B;  3V9R A;  5E5A A;  1B67 A;  1S32 A;  3AN2 C;  3VH6 W;  3REL A;  1EQZ A;  3AZN A;  2FJ7 A;  5B2I B;  3KXB B;  3B0B A;  5AY8 C;  4J8U B;  5DNM C;  5CP6 C;  4R8P A;  1TAF A;  5B31 B;  2ZY2 A;  5B0Z D;  2F8N G;  2PYO D;  3KUY C;  5F99 C;  1ZLA C;  3AN2 B;  4Z66 C;  3NQU A;  1M18 B;  5B0Y D;  5AV6 B;  2BG1 A;  5B33 C;  1P3O C;  3AV1 A;  5AY8 B;  3LZ1 A;  4KHA B;  1P3B D;  2RVQ C;  3MGS D;  1P34 B;  3AZF D;  3AYW C;  5CPJ B;  3W97 A;  5GT0 C;  1P3O B;  5B0Z C;  3W96 B;  5AV9 D;  5B1L D;  4H9O B;  2Y2N A;  1KX4 D;  5B0Y C;  3LZ0 C;  3AZJ C;  4X23 A;  1JFI A;  4H9R A;  3AZM D;  1KX3 A;  4WNN B;  1BH8 B;  5B24 D;  4UUZ A;  3MGS C;  5AV8 A;  3O62 D;  3X1U B;  5B0Z B;  3AZF C;  2PYO B;  5AVC B;  3AZE B;  4WU9 B;  3IP4 C;  3X1S C;  3UTA C;  5BS7 A;  4J8V D;  2CV5 D;  3MNN D;  1P3F A;  3X1V D;  2Y2M A;  5AV9 C;  2Y2G A;  3AL0 C;  5B1L C;  1P3B B;  2Y2O A;  3R45 A;  1TZY A;  3B0C T;  1H3O A;  3B6G C;  3KUY A;  4Z2M G;  3MGQ C;  4XZQ A;  1ZLA A;  4Z66 A;  3AZM C;  4AWL C;  3REI B;  2Y2Q A;  5B24 C; 
#chains in the Genus database with same CATH homology
 5B33 A;  3O62 C;  3AV2 D;  4JJN A;  5AV9 B;  3UT9 D;  3REJ D;  3WKJ C;  1KX4 B;  5JA4 A;  4UPK A;  2F8N D;  3AYW A;  4DRB A;  2CV5 C;  3AZM B;  2G5H C;  2HIO B;  3X1V C;  5CPI D;  4KGC D;  4AWL B;  4NE5 A;  5GSU B;  3AZH B;  2IO5 B;  3NQJ B;  3O62 B;  1M1A B;  3WA9 D;  4KUD C;  5AVB D;  1P3M D;  3AZJ A;  3MVD D;  5DNN B;  4J8V B;  3AV2 C;  4YS3 A;  3MNN B;  3X1V B;  3A1K A;  4H9N A;  5B32 C;  5BNV B;  3UTB D;  3UT9 C;  4LD9 B;  3REJ C;  1P3L A;  1P3K C;  5B2I D;  4H9P B;  3WTP C;  3KXB D;  4XUJ A;  3AZG A;  5CPK A;  4EO5 B;  4H9Q B;  5CPI C;  4KGC C;  3LEL D;  3REH C;  3X1S A;  3UTA A;  5B40 A;  5B2J C;  5B31 D;  3WAA C;  3A6N C;  4Z5T B;  2Y2L A;  5AV5 A;  1P3M C;  3B6G A;  3MGR D;  1M18 D;  1HQ3 A;  1U35 A;  3MGQ A;  3MVD C;  2F8N B;  5FUG B;  1WWS A;  5E5A B;  1N1J A;  5CPI B;  2DF4 C;  3AFA D;  3VH6 A;  3WA9 B;  3REL B;  3AZN B;  5B2I C;  5AVB B;  3AZL A;  4E44 A;  5CPJ D;  3KXB C;  3FDD A;  5JRG A;  4J8U C;  1KX3 D;  3WKJ A;  5B1M A;  2BYK A;  2FFF B;  1TAF B;  5B31 C;  5AV8 D;  3W96 D;  3B6F D;  4NE3 A;  3TU4 A;  3UTB B;  3C1C D;  4CAY A;  1F66 D;  1A7W A;  2ARO D;  3A1I A;  3MGR C;  1M18 C;  4KUD A;  5AV6 C;  3EPH A;  2Y2I A;  1M19 A;  3AV1 B;  4J8W A;  3LEL B;  3MGP D;  3AFA C;  2RIQ A;  1P34 C;  3X1U D;  2Y2H A;  5B32 A;  5AVC D;  4WU9 D;  3AZE D;  5CPJ C;  4QLC D;  2NQB D;  1P3K A;  1KX5 D;  1AOI D;  3MGR B;  1BH9 A;  3REK D;  3X1T D;  3WTP A;  2YFW A;  2Y2J A;  2JCH A;  3W96 C;  5KDM B;  3REH A;  1P3P A;  3W99 A;  5B2J A;  3C1C C;  3AFA B;  3WAA A;  2ARO C;  3A6N A;  3AZK A;  4H9R B;  1KX3 B;  4J8X A;  3REI D;  4UUZ B;  4DQY B;  2BYM A;  5AV8 B;  3X1U C;  5GT3 A;  3B6F B;  2PYO C;  5AVC C;  5GXQ A;  3LJA A;  3AZE C;  3AZI A;  4WU9 C;  4H9S C;  3C1C B;  2LY8 A;  1F66 B;  4WZS B;  2ARO B;  5G49 A;  4G91 B;  4M6B A;  2NZD D;  4J8U A;  2HIO D;  4ZUX A;  1P3G D;  1P3B C;  3KSY A;  4WU8 A;  3MGP B;  3R45 B;  1P3A D;  5GSU D;  3AZH D;  1M1A D;  1TZY B;  2HUE B;  3AN2 A;  4QLC B;  2NQB B;  3EPK A;  1KX5 B;  1P3I B;  1AOI B;  5AV6 A;  4YM6 D;  3REI C;  3REK B;  3X1T B;  5DNN D;  5AY8 A;  2JSS A;  5DNM A;  2F8N H;  5CP6 A;  4LD9 D;  3KWQ D;  3EPJ A;  1P34 A;  1KX4 C;  5JA4 B;  5F99 A;  2NZD C;  3C1B D;  3W98 D;  2HIO C;  4ZBJ C;  1P3G C;  4CSR B;  5GSU C;  5BO0 A;  2IO5 C;  3AZH C;  1P3O A;  1M1A C;  1WWI A;  4Z5T D;  4H9O A;  5BT1 D;  1ID3 D;  5DNN C;  2NZD B;  4J8V C;  4YS3 B;  5E5A D;  4ZBJ B;  3MNN C;  4G92 C;  1P3G B;  4WNN A;  4H9N B;  5GT0 A;  1S32 D;  1BFM A;  4LD9 C;  3KWQ C;  1P3A B;  5B0Z A;  2ZY4 A;  1P3L B;  3REL D;  2PYO A;  1EQZ D;  3AZN D;  2FJ7 D;  2UWX A;  3AZG B;  4EO5 C;  5B0Y A;  4YM6 B;  3LZ0 A;  5B40 B;  4R8P D;  2YFV A;  3VH5 W;  4Z5T C;  4G92 B;  5AV5 B;  5C3I C;  1P3B A;  3MGS A;  3KWQ B;  3AZF A;  1Z2C B;  3EG5 B;  1HQ3 B;  5BT1 C;  1HTA A;  3C1B B;  5E5A C;  3AV1 D;  3W98 B;  3LZ1 D;  1S32 C;  3WA9 C;  3REL C;  1EQZ C;  3AZN C;  2VQR A;  5AV9 A;  5AVB C;  3AZL B;  5B1L A;  5C3I B;  4Z2M H;  5JRG B;  1KX4 A;  5B1M B;  4WV4 B;  3W97 D;  5BNX B;  1ID3 B;  3AZM A;  2DQN C;  3V9R B;  5GXQ D;  5B24 A;  3TU4 B;  3AZI D;  1S32 B;  3UTB C;  3B0D B;  3NQJ A;  3O62 A;  1EQZ B;  2FJ7 B;  4NE6 A;  4X23 D;  3AV1 C;  3H0L C;  4J8W B;  3LEL C;  4R8P B;  1PZR A;  4J8V A;  2CV5 A;  3MNN A;  3X1V A;  3NQU B;  4DRA A;  1BH9 B;  4H9P A;  2YFW B;  4H9Q A;  1P3F D;  3LZ1 B;  1P3P B;  4HGA B;  3AV2 A;  1TZY D;  3KUY D;  3F6T A;  3AZK B;  4XZQ D;  3UT9 A;  1ZLA D;  4Z66 D;  3REJ A;  1KX3 C;  1P3I D;  3W97 B;  2F8N A;  5FUG A;  5B33 D;  5AV8 C;  3B6F C;  5GT3 B;  5CPI A;  4KGC A;  3P5J B;  4JJN D;  5GXQ B;  3LJA B;  2RVQ D;  3AZI B;  1F66 C;  3WA9 A;  5G49 B;  4G91 C;  5AVB A;  3AYW D;  5BS7 C;  4X23 B;  1JFI B;  1P3M A;  5B32 G;  4ZUX B;  1P3F C;  5GT0 D;  3MGP C;  4WU8 B;  3MVD A;  1TZY C;  2HUE C;  4XZQ C;  3UTB A;  4QLC C;  2NQB C;  1KX5 C;  1P3I C;  1AOI C;  5B2I A;  3LZ0 D;  3AZJ D;  3REK C;  3X1T C;  3KXB A;  4YS3 D;  5DNM B;  1P3F B;  3LEL A;  4JJN C;  5CP6 B;  5B31 A;  2G5I C;  1P3L D;  1W2E A;  1H3O B;  3KUY B;  3H0R C;  5F99 B;  4XZQ B;  4XUJ D;  3AZG D;  4Z66 B;  5CPK D;  1ZLA B;  3MGR A;  1M18 A;  3X1S D;  3UTA D;  5B40 D;  5B33 B;  1ULY A;  5BO0 B;  5KDM A;  4KHA A;  4JJN B;  2XD1 A;  2ZY3 A;  5AV5 D;  3AFA A;  4WJ3 C;  3B6G D;  5B31 G;  1HQ3 D;  1U35 D;  3MGQ D;  3AYW B;  5CPJ A;  1Q9C A;  4YS3 C;  5GT0 B;  3VH5 T;  1P3A C;  3W96 A;  3B6F A;  1P3L C;  3AZL D;  2F2A C;  5CHL B;  4XUJ C;  3C1C A;  5JRG D;  3AZG C;  5CPK C;  2ARO A;  1F66 A;  3WKJ D;  5B1M D;  2W8S A;  5B0Y B;  4YM6 C;  3LZ0 B;  5B40 C;  3AZJ B;  3EPL A;  2YFV B;  3VH5 A;  5AV5 C;  1BH8 A;  3MGP A;  3TU4 D;  3MGS B;  2Y2P A;  3X1U A;  3AZF B;  2ZM5 A;  4KUD D;  1HQ3 C;  5AVC A;  3AZE A;  4WU9 A;  1U35 C;  1M19 D;  4H9S A;  4QLC A;  4XUJ B;  3C1B C;  5CPK B;  2NQB A;  1KX5 A;  1AOI A;  4J8W D;  3W98 C;  3REK A;  3X1S B;  3UTA B;  3X1T A;  1R4V A;  3AZL C;  5B32 D;  5B1L B;  1B6W A;  5JRG C;  5B1M C;  1P3K D;  3B6G B;  1U35 B;  3WTP D;  3MGQ B;  2XD5 A;  1ID3 C;  3KFU G;  1N1J B;  3REH D;  1P3P D;  3REI A;  4CSR A;  5B24 B;  3TU4 C;  3W99 D;  5B2J D;  2L5A A;  3B0D C;  3WAA D;  3A6N D;  2FJ7 C;  3B0C W;  3AZK D;  1M19 C;  3WKJ B;  4J8W C;  4J8X D;  2BYK B;  4R8P C;  2NZD A;  2CV5 B;  2HIO A;  5GT3 D;  1P3G A;  1KU5 A;  4E45 A;  3LJA D;  1P3A A;  5GSU A;  3AZH A;  4CAY B;  1M1A A;  2JE5 A;  3WTP E;  4KUD B;  1M19 B;  4J8U D;  4ZUX D;  3LZ1 C;  1P3P C;  4YM6 A;  2J8P A;  3W99 C;  4WU8 D;  4HGA C;  5DNN A;  2CWE A;  3AV2 B;  1F1E A;  3VH6 T;  5BNV A;  5B32 B;  3AZK C;  3AN2 D;  3UT9 B;  4LD9 A;  2ZY5 A;  3KWQ A;  3REJ B;  4J8X C;  1P3K B;  3W97 C;  5AV6 D;  3WTP B;  3C1B A;  3W98 A;  5AY8 D;  5GT3 C;  5DNM D;  4KGC B;  3REH B;  2Y2K A;  5GXQ C;  5CP6 D;  3LJA C;  3AZI C;  5B2J B;  3W99 B;  1P34 D;  3WAA B;  3A6N B;  4Z5T A;  5F99 D;  2F8N K;  4X23 C;  1P3M B;  4ZUX C;  4J8X B;  4NFT A;  4WU8 C;  5BNX A;  1T3U A;  1P3I A;  3MVD B;  1ID3 A;  1P3O D;  3H0M C;  2BYM B;  3V9R A;  5E5A A;  1B67 A;  1S32 A;  3AN2 C;  3VH6 W;  3REL A;  1EQZ A;  3AZN A;  2FJ7 A;  5B2I B;  3KXB B;  3B0B A;  5AY8 C;  4J8U B;  5DNM C;  5CP6 C;  4R8P A;  1TAF A;  5B31 B;  2ZY2 A;  5B0Z D;  2F8N G;  2PYO D;  3KUY C;  5F99 C;  1ZLA C;  3AN2 B;  4Z66 C;  3NQU A;  1M18 B;  5B0Y D;  5AV6 B;  2BG1 A;  5B33 C;  1P3O C;  3AV1 A;  5AY8 B;  3LZ1 A;  4KHA B;  1P3B D;  2RVQ C;  3MGS D;  1P34 B;  3AZF D;  3AYW C;  5CPJ B;  3W97 A;  5GT0 C;  1P3O B;  5B0Z C;  3W96 B;  5AV9 D;  5B1L D;  4H9O B;  2Y2N A;  1KX4 D;  5B0Y C;  3LZ0 C;  3AZJ C;  4X23 A;  1JFI A;  4H9R A;  3AZM D;  1KX3 A;  4WNN B;  1BH8 B;  5B24 D;  4UUZ A;  3MGS C;  5AV8 A;  3O62 D;  3X1U B;  5B0Z B;  3AZF C;  2PYO B;  5AVC B;  3AZE B;  4WU9 B;  3IP4 C;  3X1S C;  3UTA C;  5BS7 A;  4J8V D;  2CV5 D;  3MNN D;  1P3F A;  3X1V D;  2Y2M A;  5AV9 C;  2Y2G A;  3AL0 C;  5B1L C;  1P3B B;  2Y2O A;  3R45 A;  1TZY A;  3B0C T;  1H3O A;  3B6G C;  3KUY A;  4Z2M G;  3MGQ C;  4XZQ A;  1ZLA A;  4Z66 A;  3AZM C;  4AWL C;  3REI B;  2Y2Q A;  5B24 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...