2CV5D

Crystal structure of human nucleosome core particle
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
96
structure length
96
Chain Sequence
KRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords DNA (146-MER)
publication title Alteration of the nucleosomal DNA path in the crystal structure of a human nucleosome core particle
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 96
sequence length 96
chains with identical sequence H
ec nomenclature
pdb deposition date 2005-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2cv5D00
1P34B 4KGCD 2F8NA 3X1VD 2PYOD 2HIOC 4H9PA 1P3BC 3MGQD 4KUDB 5B33D 1U35A 3WTPE 1P3MB 3B6GD 3MGSC 1JFIB 5GSUD 1TZYC 3C1BB 3KXBA 5KDMA 3RELD 3KWQB 5GT0C 1ID3C 2AROC 4H9QA 3AN2A 4DRBA 5AVCB 1P3OA 1P3IC 4WU8D 3AYWC 5JRGD 1M18C 1P3FD 2F8ND 1ZLAB 3B6FC 5G49A 5CPJB 4UUZB 1U35D 2CWEA 5B31A 3LJAC 5B0ZC 4KGCB 3LZ1C 2PYOB 3X1VB 3KXBD 3MGQB 3AZJC 5B33B 3B6GB 3AN2D 4CAYA 3W98A 4CSRA 3AZHC 1BH8A 1P3OD 3VH6W 5GSUB 4G92B 2NQBC 5AV9C 3RELB 2CV5C 3NQUA 3C1CA 5B31D 3W99A 4E45A 5JRGB 1P3FB 2F8NB 1M1AC 4H9PB 5BNXA 4Z5TC 5B0YC 1U35B 3AZIC 1ULYA 3W98D 4E44A 5B2IC 3AFAC 3MVDA 3WAAC 3KXBB 3A6NA 3REJC 5KDMB 5AVBC 1A7WA 4H9QB 5B1LC 3LZ0A 3KUYA 3AN2B 4WU9C 4YM6A 4R8PC 3W99D 5E5AC 1P3OB 4ZBJB 5BNVA 3UT9A 3WTPC 4H9RA 5DNMC 5G49B 5AY8C 5B31B 4H9NA 5B32C 3AZNC 3REHA 3A6ND 3AZFC 4Z2MG 3X1UC 1F66C 3WKJC 4J8VA 3LZ0D 3W98B 4CAYB 3KUYD 4LD9C 1WWSA 4CSRB 1BH8B 1B6WA 2YFVB 3X1SC 3UT9D 3REIC 4AWLB 3UTAC 3NQUB 1EQZC 3C1CB 3W99B 1TZYA 5JA4A 5B24C 1P3KC 3UTBC 5DNNA 1ZLAA 5GT0A 5BT1C 1ID3A 2AROA 3REHD 4J8XC 5BNXB 4J8VD 4HGAC 5B1MC 3AYWA 1H3OA 2HIOD 3B6FA 2LY8A 3A6NB 3MNNA 3LZ0B 5B40C 3KUYB 5BS7A 4YM6B 3LJAA 1TZYD 4YS3C 5BNVB 3UT9B 4WZSB 5GT0D 1ID3D 2AROD 4H9RB 5F99C 4Z2MH 1P3PC 1M19C 3AZHA 3LELC 4WU8A 3O62C 5GT3C 3AYWD 5JRGA 2CV5A 1P3FA 3AV2A 3B6FD 3REHB 4NFTA 5AV8C 4J8VB 3AZMC 4XUJC 3MNND 1KX4C 3LJAD 1Q9CA 3LZ1D 4ZUXC 1M1AA 2HIOB 5C3IC 4Z5TA 3AZIA 5B2IA 2NZDC 3AZHD 3AFAA 1TZYB 5JA4B 2NQBD 3WAAA 3TU4A 3REJA 5AV9D 2CV5D 5AVBA 5DNNB 5GT0B 3AV2D 1ID3B 2AROB 5B1LA 4WU9A 3KWQC 4R8PA 1KX3C 3AV1C 3WTPA 3AYWB 5CP6C 1H3OB 3MGPC 1M1AD 3B6FB 5AY8A 3REKC 4Z5TD 3AZID 5CPJC 5B2ID 3MNNB 3AFAD 3LJAB 5B32A 2YFVA 3B0BA 5CPKC 1BFMA 3WAAD 3TU4D 3X1TC 2YFWB 3REJD 3VH5A 3WKJA 5AVBD 5B1LD 3MGQC 4WU9D 4LD9A 4R8PD 3AZHB 5E5AD 4WU8B 3X1SA 3VH6T 3REIA 3WTPD 3AZLC 4J8WA 2CV5B 3AV2B 3UTAA 2RVQD 5AY8D 5B24A 1P3KA 3UTBA 5B32D 5CPIC 4JJNA 1WWIA 1M1AB 3AZFD 3WKJD 4Z5TB 5B1MA 3AZIB 4LD9D 1U35C 5B2IB 3AFAB 5GXQA 1HTAA 4Z66C 3X1SD 3REID 3TU4B 1P3AC 3REJB 3WAAB 4G91C 4J8WD 5AVBB 3KXBC 3UTAD 5B1LB 4WU9B 3AZGA 4R8PB 5B24D 3AN2C 4YS3A 1S32C 1P3KD 3UTBD 4DRAA 3WA9C 3WTPB 5BT1D 3KSYA 4ZBJC 4JJND 5F99A 1P3PA 1M19A 5AY8B 1AOIC 3W97C 5B1MD 3LELA 5GT3A 3AZEC 5GXQD 5B32B 2HIOA 1P3BA 2FJ7C 3B0CW 1BH9A 1P3LC 3WKJB 3AZKC 4X23C 4XUJA 4LD9B 3MGSA 3AZGD 3W98C 1R4VA 4ZUXA 4YS3D 4QLCC 3X1SB 3B0DB 4EO5C 3REIB 4J8WB 3B0CT 5F99D 1KU5A 2NZDA 3UTAB 3W96C 1HQ3C 5B2JC 1P3PD 4AWLC 1M19D 1P3IA 3LELD 5B24B 5GT3D 3V9RA 2F8NK 1P3KB 3C1CC 3UTBB 1M18A 1P3BD 4JJNB 1F1EA 4H9SC 5BO0A 4J8UC 4HGAB 5B1MB 4XUJD 3AZMD 3AV1A 1KX3A 3R45A 1KX4D 4KHAA 3MGSD 5B0ZA 3VH6A 5CP6A 3LZ1A 5GXQB 5AV6C 4ZUXD 2YFWA 3MGPA 3AZJA 3REKA 3MVDC 5AV5C 2NZDD 1P3ID 3AZGB 2NQBA 5CPKA 3KUYC 4YS3B 3X1TA 1KX5C 2HUEB 4YM6C 5AV9A 2IO5C 1M18D 5F99B 4XZQC 1P3PB 1M19B 1B67A 1KX3D 3LELB 3AV1D 1P3GC 5GT3B 3AZLA 5B0ZD 5CP6D 3MGPD 3MGRC 1P3BB 3AZJD 3REKD 1P34C 5B0YA 1BH9B 5CPJD 4KUDC 4XUJB 1P3MC 3MGSB 4J8VC 5CPIA 5CPKD 4ZUXB 3X1TD 5C3IB 3C1BC 5FUGA 2NZDB 5E5AA 5AVCC 4Z66A 1P3IB 3V9RB 3AZLD 1P3AA 1M18B 5DNMA 2BYKA 5B0YD 5DNNC 4H9OA 5BO0B 1ZLAC 1KX3B 3AV1B 1S32A 3R45B 3WA9A 4KHAB 5B0ZB 5CPID 5CP6B 3LZ1B 3AZNA 3MGPB 3AZFA 3X1UA 1F66A 3AZJB 3W97A 3REKB 3X1VC 1AOIA 2PYOC 4KGCC 5B33C 3AZEA 3B6GC 4WNNA 4Z66D 3MNNC 2NQBB 5CPKB 2FJ7A 5BS7C 3X1TB 1P3AD 5GSUC 5AV9B 4G92C 1P3LA 3AZKA 5DNMD 4X23A 4WV4B 2BYMA 3RELC 1EQZA 1S32D 4QLCA 3WA9D 3AZLB 4WU8C 3AZND 4J8XA 5JRGC 1N1JA 3X1UD 3W96A 1HQ3A 5B2JA 1P3FC 5B0YB 1AOID 1F66D 2F8NG 3AV2C 3W97D 4M6BA 3AZED 5CPIB 3NQJA 2FJ7D 4H9SA 1P3LD 4J8UA 3AZKD 4X23D 1TAFA 5B40A 5FUGB 1EQZD 2L5AA 5E5AB 5AV6A 2JSSA 4Z66B 4QLCD 1P3AB 5AV5A 1P3OC 4G91B 5DNMB 4J8XD 3TU4C 3W96D 1HQ3D 5B2JD 2BYKB 4NE6A 4H9OB 3O62A 1KX5A 1S32B 3C1CD 5B31C 5B31G 3WA9B 3AZNB 5AV8A 4XZQA 3AZFB 3X1UB 1F66B 1AOIB 3W97B 4J8UD 3AZMA 5B40D 4NE3A 1KX4A 1P3GA 2RVQC 3AZEB 5AV6D 4NE5A 4WNNB 3MGRA 2FJ7B 1P34A 3MVDD 5AV5D 5B32G 1P3LB 3AZKB 4KUDA 4X23B 1P3MA 2F8NH 2BYMB 1EQZB 3O62D 1KX5D 4YM6D 1JFIA 4QLCB 3W99C 4EO5B 3C1BA 3B0DC 3KWQA 4J8XB 5AV8D 4XZQD 1N1JB 4J8WC 3VH5W 1HQ3B 5B2JB 3W96B 5AVCA 1P3GD 3MGRD 3NQJB 1P34D 4JJNC 4J8UB 5CPJA 4UUZA 4KUDD 1TAFB 5CHLB 3VH5T 5B40B 3A6NC 1P3MD 3LZ0C 5AV6B 4KGCA 2PYOA 5GXQC 3MVDB 5AV5B 3C1BD 3X1VA 3UT9C 3MGQA 5B33A 3KWQD 3B6GA 5AVCD 3O62B 1KX5B 5GSUA 2IO5B 3AZGC 2HUEC 3RELA 5AV8B 4XZQB 5DNND 1ZLAD 3REHC 3AZMB 1KX4B 1P3GB 4H9NB 3MGRB
chains in the Genus database with same CATH superfamily
1P34B 4KGCD 2F8NA 3X1VD 2PYOD 2HIOC 4H9PA 1P3BC 3MGQD 4KUDB 5B33D 1U35A 3WTPE 1P3MB 3B6GD 2Y2LA 3MGSC 1JFIB 2Y2MA 5GSUD 1TZYC 3C1BB 3KXBA 5KDMA 3RELD 2DF4C 3KWQB 5GT0C 1ID3C 2AROC 4H9QA 3AN2A 4DRBA 5AVCB 1P3OA 1P3IC 4WU8D 3AYWC 5JRGD 1M18C 1P3FD 2F8ND 1ZLAB 3B6FC 5G49A 5CPJB 4UUZB 1U35D 2CWEA 5B31A 3IP4C 5B0ZC 3LJAC 4KGCB 3LZ1C 2PYOB 3X1VB 3KXBD 2ZY5A 3MGQB 3AZJC 5B33B 3B6GB 3AN2D 4CAYA 3W98A 4CSRA 3AZHC 1BH8A 1P3OD 3VH6W 5GSUB 4G92B 2NQBC 5AV9C 3RELB 2CV5C 2W8SA 3NQUA 3C1CA 5B31D 3W99A 4E45A 5JRGB 2XD1A 1P3FB 2F8NB 1M1AC 4H9PB 2DQNC 5BNXA 4Z5TC 5B0YC 3AZIC 3F6TA 1U35B 1ULYA 3W98D 4E44A 5B2IC 3AFAC 3MVDA 3WAAC 3KXBB 3A6NA 3REJC 5KDMB 5AVBC 2JCHA 2VQRA 1A7WA 4H9QB 5B1LC 3LZ0A 3KUYA 3AN2B 4WU9C 4YM6A 2JE5A 4R8PC 3W99D 5E5AC 1P3OB 4ZBJB 5BNVA 3UT9A 3WTPC 4H9RA 5DNMC 5G49B 5AY8C 5B31B 4H9NA 5B32C 3AZNC 3REHA 3A6ND 3AZFC 4Z2MG 3X1UC 1F66C 3WKJC 4J8VA 3LZ0D 3W98B 4CAYB 3KUYD 4LD9C 1WWSA 4CSRB 1BH8B 1B6WA 3P5JB 2YFVB 3X1SC 3UT9D 3REIC 4AWLB 3AL0C 3UTAC 3NQUB 1EQZC 3C1CB 3W99B 1TZYA 5JA4A 5B24C 2G5HC 3UTBC 1P3KC 5DNNA 1ZLAA 5GT0A 5BT1C 1ID3A 2AROA 3REHD 4J8XC 2Y2KA 5BNXB 4J8VD 4HGAC 5B1MC 3AYWA 1H3OA 3EPJA 2HIOD 3B6FA 2LY8A 3A6NB 3MNNA 3LZ0B 5B40C 3KUYB 5BS7A 4YM6B 3LJAA 1TZYD 4YS3C 5BNVB 3UT9B 4WZSB 2XD5A 5GT0D 1ID3D 1Z2CB 2AROD 4H9RB 5F99C 4Z2MH 1P3PC 1M19C 3AZHA 3LELC 4WU8A 3O62C 5GT3C 3AYWD 5JRGA 2CV5A 1P3FA 2BG1A 3AV2A 3B6FD 3REHB 4NFTA 5AV8C 4J8VB 3AZMC 4XUJC 3MNND 1KX4C 3LJAD 1Q9CA 3LZ1D 4ZUXC 1M1AA 2HIOB 5C3IC 4Z5TA 3AZIA 3FDDA 5B2IA 2NZDC 3AZHD 3AFAA 1TZYB 5JA4B 2NQBD 3WAAA 3TU4A 3REJA 3A1KA 5AV9D 3KFUG 2CV5D 5AVBA 5DNNB 5GT0B 3AV2D 1ID3B 2AROB 5B1LA 4WU9A 3KWQC 2UWXA 4R8PA 1KX3C 3AV1C 3WTPA 3AYWB 5CP6C 1H3OB 3MGPC 1M1AD 3B6FB 5AY8A 3REKC 4Z5TD 3AZID 5CPJC 5B2ID 3MNNB 3AFAD 3LJAB 5B32A 2YFVA 3B0BA 5CPKC 1BFMA 3WAAD 3TU4D 3X1TC 2YFWB 3REJD 3VH5A 3WKJA 5AVBD 5B1LD 3MGQC 4WU9D 4LD9A 4R8PD 3AZHB 5E5AD 4WU8B 3X1SA 3VH6T 3REIA 3WTPD 3AZLC 4J8WA 3H0RC 2CV5B 3AV2B 3UTAA 2RVQD 5AY8D 3H0MC 5B24A 1P3KA 3UTBA 2Y2JA 5B32D 5CPIC 4JJNA 1WWIA 1M1AB 3AZFD 3WKJD 4Z5TB 5B1MA 3AZIB 4LD9D 1U35C 5B2IB 3AFAB 5GXQA 1HTAA 4Z66C 3X1SD 3REID 3TU4B 1P3AC 3REJB 3WAAB 4G91C 4J8WD 5AVBB 3KXBC 3UTAD 5B1LB 4WU9B 3AZGA 4R8PB 5B24D 3AN2C 4YS3A 1S32C 1P3KD 3UTBD 4DRAA 3WA9C 3WTPB 5BT1D 3KSYA 4ZBJC 4JJND 5F99A 1P3PA 1M19A 5AY8B 1AOIC 3W97C 5B1MD 3LELA 5GT3A 3AZEC 5GXQD 5B32B 2HIOA 1P3BA 2FJ7C 3B0CW 1BH9A 1P3LC 3WKJB 3AZKC 4X23C 4XUJA 4LD9B 3MGSA 3AZGD 2RIQA 3W98C 1R4VA 4ZUXA 4YS3D 4QLCC 3X1SB 3B0DB 4EO5C 3REIB 4J8WB 3B0CT 5F99D 1KU5A 2NZDA 3UTAB 3W96C 1HQ3C 5B2JC 1P3PD 4AWLC 1M19D 1P3IA 3LELD 5B24B 5GT3D 3V9RA 2F8NK 1P3KB 3C1CC 3UTBB 1M18A 1P3BD 4JJNB 1F1EA 4H9SC 5BO0A 4J8UC 4HGAB 5B1MB 4XUJD 3AZMD 3AV1A 1KX3A 3R45A 1KX4D 4KHAA 3MGSD 5B0ZA 3VH6A 5CP6A 3LZ1A 5GXQB 5AV6C 4ZUXD 2YFWA 3MGPA 3AZJA 3REKA 3MVDC 5AV5C 4WJ3C 2NZDD 1P3ID 3AZGB 2NQBA 5CPKA 3KUYC 4YS3B 3X1TA 1KX5C 2HUEB 4YM6C 5AV9A 2IO5C 1M18D 5F99B 4XZQC 1P3PB 1M19B 1B67A 1KX3D 3LELB 3AV1D 2ZY2A 1P3GC 5GT3B 3AZLA 5B0ZD 5CP6D 3MGPD 3MGRC 1P3BB 3AZJD 3REKD 1P34C 2Y2NA 5B0YA 1BH9B 5CPJD 2Y2IA 4KUDC 1T3UA 4XUJB 1P3MC 3MGSB 4J8VC 5CPIA 5CPKD 2ZY3A 4ZUXB 3X1TD 5C3IB 3C1BC 2G5IC 5FUGA 2NZDB 5E5AA 5AVCC 4Z66A 1P3IB 3V9RB 1W2EA 3AZLD 1P3AA 1M18B 5DNMA 2BYKA 5B0YD 5DNNC 4H9OA 5BO0B 1ZLAC 1KX3B 3AV1B 1S32A 3R45B 3WA9A 4KHAB 5B0ZB 5CPID 5CP6B 3LZ1B 2ZM5A 3AZNA 3MGPB 3AZFA 3X1UA 1F66A 3AZJB 3W97A 3REKB 3X1VC 1AOIA 2PYOC 4KGCC 5B33C 3AZEA 3B6GC 4WNNA 4Z66D 3MNNC 2NQBB 5CPKB 2FJ7A 5BS7C 3X1TB 2Y2QA 1P3AD 5GSUC 5AV9B 4G92C 1P3LA 3AZKA 5DNMD 4X23A 4WV4B 2BYMA 3RELC 1EQZA 1PZRA 1S32D 4QLCA 3WA9D 3AZLB 4WU8C 3AZND 4DQYB 4J8XA 5JRGC 1N1JA 3X1UD 3W96A 1HQ3A 5B2JA 1P3FC 5B0YB 1AOID 1F66D 2F8NG 3AV2C 3W97D 4M6BA 3AZED 5CPIB 3NQJA 2FJ7D 2ZY4A 4H9SA 1P3LD 4J8UA 3AZKD 4X23D 1TAFA 5B40A 3H0LC 5FUGB 1EQZD 2L5AA 5E5AB 5AV6A 2JSSA 4Z66B 4QLCD 3EPKA 1P3AB 5AV5A 1P3OC 4G91B 2J8PA 5DNMB 4J8XD 3TU4C 3W96D 1HQ3D 5B2JD 2BYKB 4NE6A 4H9OB 3O62A 2FFFB 1KX5A 1S32B 3C1CD 5B31C 5B31G 3WA9B 3AZNB 5AV8A 4XZQA 3AZFB 3X1UB 1F66B 1AOIB 3W97B 4J8UD 2Y2PA 3AZMA 5B40D 4NE3A 1KX4A 1P3GA 2RVQC 3AZEB 5AV6D 4NE5A 4WNNB 3MGRA 2FJ7B 1P34A 3MVDD 5AV5D 5B32G 1P3LB 3AZKB 4KUDA 4X23B 1P3MA 2F8NH 2BYMB 1EQZB 3O62D 1KX5D 4YM6D 1JFIA 4QLCB 3W99C 4EO5B 3C1BA 2Y2HA 3B0DC 3KWQA 4J8XB 5AV8D 4XZQD 1N1JB 4J8WC 3VH5W 1HQ3B 5B2JB 3W96B 5AVCA 1P3GD 4UPKA 3MGRD 3NQJB 1P34D 4JJNC 4J8UB 5CPJA 4UUZA 4KUDD 1TAFB 5CHLB 3VH5T 5B40B 3A6NC 1P3MD 3LZ0C 5AV6B 4KGCA 2PYOA 5GXQC 3MVDB 5AV5B 3C1BD 3X1VA 3UT9C 3MGQA 5B33A 3KWQD 3B6GA 5AVCD 3EPLA 3O62B 1KX5B 5GSUA 2IO5B 3AZGC 2F2AC 2HUEC 3RELA 5AV8B 4XZQB 5DNND 1ZLAD 3EPHA 3REHC 3AZMB 2Y2OA 1KX4B 1P3GB 3EG5B 2Y2GA 3A1IA 4H9NB 3MGRB
chains in the Genus database with same CATH topology
1P34B 4KGCD 2F8NA 3X1VD 2PYOD 2HIOC 4H9PA 1P3BC 3MGQD 4KUDB 5B33D 1U35A 3WTPE 1P3MB 3B6GD 2Y2LA 3MGSC 1JFIB 2Y2MA 5GSUD 1TZYC 3C1BB 3KXBA 5KDMA 3RELD 2DF4C 3KWQB 5GT0C 1ID3C 2AROC 4H9QA 3AN2A 4DRBA 5AVCB 1P3OA 1P3IC 4WU8D 3AYWC 5JRGD 1M18C 1P3FD 2F8ND 1ZLAB 3B6FC 5G49A 5CPJB 4UUZB 1U35D 2CWEA 5B31A 3IP4C 5B0ZC 3LJAC 4KGCB 3LZ1C 2PYOB 3X1VB 3KXBD 2ZY5A 3MGQB 3AZJC 5B33B 3B6GB 3AN2D 4CAYA 3W98A 4CSRA 3AZHC 1BH8A 1P3OD 3VH6W 5GSUB 4G92B 2NQBC 5AV9C 3RELB 2CV5C 2W8SA 3NQUA 3C1CA 5B31D 3W99A 4E45A 5JRGB 2XD1A 1P3FB 2F8NB 1M1AC 4H9PB 2DQNC 5BNXA 4Z5TC 5B0YC 3AZIC 3F6TA 1U35B 1ULYA 3W98D 4E44A 5B2IC 3AFAC 3MVDA 3WAAC 3KXBB 3A6NA 3REJC 5KDMB 5AVBC 2JCHA 2VQRA 1A7WA 4H9QB 5B1LC 3LZ0A 3KUYA 3AN2B 4WU9C 4YM6A 2JE5A 4R8PC 3W99D 5E5AC 1P3OB 4ZBJB 5BNVA 3UT9A 3WTPC 4H9RA 5DNMC 5G49B 5AY8C 5B31B 4H9NA 5B32C 3AZNC 3REHA 3A6ND 3AZFC 4Z2MG 3X1UC 1F66C 3WKJC 4J8VA 3LZ0D 3W98B 4CAYB 3KUYD 4LD9C 1WWSA 4CSRB 1BH8B 1B6WA 3P5JB 2YFVB 3X1SC 3UT9D 3REIC 4AWLB 3AL0C 3UTAC 3NQUB 1EQZC 3C1CB 3W99B 1TZYA 5JA4A 5B24C 2G5HC 3UTBC 1P3KC 5DNNA 1ZLAA 5GT0A 5BT1C 1ID3A 2AROA 3REHD 4J8XC 2Y2KA 5BNXB 4J8VD 4HGAC 5B1MC 3AYWA 1H3OA 3EPJA 2HIOD 3B6FA 2LY8A 3A6NB 3MNNA 3LZ0B 5B40C 3KUYB 5BS7A 4YM6B 3LJAA 1TZYD 4YS3C 5BNVB 3UT9B 4WZSB 2XD5A 5GT0D 1ID3D 1Z2CB 2AROD 4H9RB 5F99C 4Z2MH 1P3PC 1M19C 3AZHA 3LELC 4WU8A 3O62C 5GT3C 3AYWD 5JRGA 2CV5A 1P3FA 2BG1A 3AV2A 3B6FD 3REHB 4NFTA 5AV8C 4J8VB 3AZMC 4XUJC 3MNND 1KX4C 3LJAD 1Q9CA 3LZ1D 4ZUXC 1M1AA 2HIOB 5C3IC 4Z5TA 3AZIA 3FDDA 5B2IA 2NZDC 3AZHD 3AFAA 1TZYB 5JA4B 2NQBD 3WAAA 3TU4A 3REJA 3A1KA 5AV9D 3KFUG 2CV5D 5AVBA 5DNNB 5GT0B 3AV2D 1ID3B 2AROB 5B1LA 4WU9A 3KWQC 2UWXA 4R8PA 1KX3C 3AV1C 3WTPA 3AYWB 5CP6C 1H3OB 3MGPC 1M1AD 3B6FB 5AY8A 3REKC 4Z5TD 3AZID 5CPJC 5B2ID 3MNNB 3AFAD 3LJAB 5B32A 2YFVA 3B0BA 5CPKC 1BFMA 3WAAD 3TU4D 3X1TC 2YFWB 3REJD 3VH5A 3WKJA 5AVBD 5B1LD 3MGQC 4WU9D 4LD9A 4R8PD 3AZHB 5E5AD 4WU8B 3X1SA 3VH6T 3REIA 3WTPD 3AZLC 4J8WA 3H0RC 2CV5B 3AV2B 3UTAA 2RVQD 5AY8D 3H0MC 5B24A 1P3KA 3UTBA 2Y2JA 5B32D 5CPIC 4JJNA 1WWIA 1M1AB 3AZFD 3WKJD 4Z5TB 5B1MA 3AZIB 4LD9D 1U35C 5B2IB 3AFAB 5GXQA 1HTAA 4Z66C 3X1SD 3REID 3TU4B 1P3AC 3REJB 3WAAB 4G91C 4J8WD 5AVBB 3KXBC 3UTAD 5B1LB 4WU9B 3AZGA 4R8PB 5B24D 3AN2C 4YS3A 1S32C 1P3KD 3UTBD 4DRAA 3WA9C 3WTPB 5BT1D 3KSYA 4ZBJC 4JJND 5F99A 1P3PA 1M19A 5AY8B 1AOIC 3W97C 5B1MD 3LELA 5GT3A 3AZEC 5GXQD 5B32B 2HIOA 1P3BA 2FJ7C 3B0CW 1BH9A 1P3LC 3WKJB 3AZKC 4X23C 4XUJA 4LD9B 3MGSA 3AZGD 2RIQA 3W98C 1R4VA 4ZUXA 4YS3D 4QLCC 3X1SB 3B0DB 4EO5C 3REIB 4J8WB 3B0CT 5F99D 1KU5A 2NZDA 3UTAB 3W96C 1HQ3C 5B2JC 1P3PD 4AWLC 1M19D 1P3IA 3LELD 5B24B 5GT3D 3V9RA 2F8NK 1P3KB 3C1CC 3UTBB 1M18A 1P3BD 4JJNB 1F1EA 4H9SC 5BO0A 4J8UC 4HGAB 5B1MB 4XUJD 3AZMD 3AV1A 1KX3A 3R45A 1KX4D 4KHAA 3MGSD 5B0ZA 3VH6A 5CP6A 3LZ1A 5GXQB 5AV6C 4ZUXD 2YFWA 3MGPA 3AZJA 3REKA 3MVDC 5AV5C 4WJ3C 2NZDD 1P3ID 3AZGB 2NQBA 5CPKA 3KUYC 4YS3B 3X1TA 1KX5C 2HUEB 4YM6C 5AV9A 2IO5C 1M18D 5F99B 4XZQC 1P3PB 1M19B 1B67A 1KX3D 3LELB 3AV1D 2ZY2A 1P3GC 5GT3B 3AZLA 5B0ZD 5CP6D 3MGPD 3MGRC 1P3BB 3AZJD 3REKD 1P34C 2Y2NA 5B0YA 1BH9B 5CPJD 2Y2IA 4KUDC 1T3UA 4XUJB 1P3MC 3MGSB 4J8VC 5CPIA 5CPKD 2ZY3A 4ZUXB 3X1TD 5C3IB 3C1BC 2G5IC 5FUGA 2NZDB 5E5AA 5AVCC 4Z66A 1P3IB 3V9RB 1W2EA 3AZLD 1P3AA 1M18B 5DNMA 2BYKA 5B0YD 5DNNC 4H9OA 5BO0B 1ZLAC 1KX3B 3AV1B 1S32A 3R45B 3WA9A 4KHAB 5B0ZB 5CPID 5CP6B 3LZ1B 2ZM5A 3AZNA 3MGPB 3AZFA 3X1UA 1F66A 3AZJB 3W97A 3REKB 3X1VC 1AOIA 2PYOC 4KGCC 5B33C 3AZEA 3B6GC 4WNNA 4Z66D 3MNNC 2NQBB 5CPKB 2FJ7A 5BS7C 3X1TB 2Y2QA 1P3AD 5GSUC 5AV9B 4G92C 1P3LA 3AZKA 5DNMD 4X23A 4WV4B 2BYMA 3RELC 1EQZA 1PZRA 1S32D 4QLCA 3WA9D 3AZLB 4WU8C 3AZND 4DQYB 4J8XA 5JRGC 1N1JA 3X1UD 3W96A 1HQ3A 5B2JA 1P3FC 5B0YB 1AOID 1F66D 2F8NG 3AV2C 3W97D 4M6BA 3AZED 5CPIB 3NQJA 2FJ7D 2ZY4A 4H9SA 1P3LD 4J8UA 3AZKD 4X23D 1TAFA 5B40A 3H0LC 5FUGB 1EQZD 2L5AA 5E5AB 5AV6A 2JSSA 4Z66B 4QLCD 3EPKA 1P3AB 5AV5A 1P3OC 4G91B 2J8PA 5DNMB 4J8XD 3TU4C 3W96D 1HQ3D 5B2JD 2BYKB 4NE6A 4H9OB 3O62A 2FFFB 1KX5A 1S32B 3C1CD 5B31C 5B31G 3WA9B 3AZNB 5AV8A 4XZQA 3AZFB 3X1UB 1F66B 1AOIB 3W97B 4J8UD 2Y2PA 3AZMA 5B40D 4NE3A 1KX4A 1P3GA 2RVQC 3AZEB 5AV6D 4NE5A 4WNNB 3MGRA 2FJ7B 1P34A 3MVDD 5AV5D 5B32G 1P3LB 3AZKB 4KUDA 4X23B 1P3MA 2F8NH 2BYMB 1EQZB 3O62D 1KX5D 4YM6D 1JFIA 4QLCB 3W99C 4EO5B 3C1BA 2Y2HA 3B0DC 3KWQA 4J8XB 5AV8D 4XZQD 1N1JB 4J8WC 3VH5W 1HQ3B 5B2JB 3W96B 5AVCA 1P3GD 4UPKA 3MGRD 3NQJB 1P34D 4JJNC 4J8UB 5CPJA 4UUZA 4KUDD 1TAFB 5CHLB 3VH5T 5B40B 3A6NC 1P3MD 3LZ0C 5AV6B 4KGCA 2PYOA 5GXQC 3MVDB 5AV5B 3C1BD 3X1VA 3UT9C 3MGQA 5B33A 3KWQD 3B6GA 5AVCD 3EPLA 3O62B 1KX5B 5GSUA 2IO5B 3AZGC 2F2AC 2HUEC 3RELA 5AV8B 4XZQB 5DNND 1ZLAD 3EPHA 3REHC 3AZMB 2Y2OA 1KX4B 1P3GB 3EG5B 2Y2GA 3A1IA 4H9NB 3MGRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P34 B;  4KGC D;  2F8N A;  3X1V D;  2PYO D;  2HIO C;  4H9P A;  1P3B C;  3MGQ D;  4KUD B;  5B33 D;  1U35 A;  3WTP E;  1P3M B;  3B6G D;  3MGS C;  1JFI B;  5GSU D;  1TZY C;  3C1B B;  3KXB A;  5KDM A;  3REL D;  3KWQ B;  5GT0 C;  1ID3 C;  2ARO C;  4H9Q A;  3AN2 A;  4DRB A;  5AVC B;  1P3O A;  1P3I C;  4WU8 D;  3AYW C;  5JRG D;  1M18 C;  1P3F D;  2F8N D;  1ZLA B;  3B6F C;  5G49 A;  5CPJ B;  4UUZ B;  1U35 D;  2CWE A;  5B31 A;  3LJA C;  5B0Z C;  4KGC B;  3LZ1 C;  2PYO B;  3X1V B;  3KXB D;  3MGQ B;  3AZJ C;  5B33 B;  3B6G B;  3AN2 D;  4CAY A;  3W98 A;  4CSR A;  3AZH C;  1BH8 A;  1P3O D;  3VH6 W;  5GSU B;  4G92 B;  2NQB C;  5AV9 C;  3REL B;  2CV5 C;  3NQU A;  3C1C A;  5B31 D;  3W99 A;  4E45 A;  5JRG B;  1P3F B;  2F8N B;  1M1A C;  4H9P B;  5BNX A;  4Z5T C;  5B0Y C;  1U35 B;  3AZI C;  1ULY A;  3W98 D;  4E44 A;  5B2I C;  3AFA C;  3MVD A;  3WAA C;  3KXB B;  3A6N A;  3REJ C;  5KDM B;  5AVB C;  1A7W A;  4H9Q B;  5B1L C;  3LZ0 A;  3KUY A;  3AN2 B;  4WU9 C;  4YM6 A;  4R8P C;  3W99 D;  5E5A C;  1P3O B;  4ZBJ B;  5BNV A;  3UT9 A;  3WTP C;  4H9R A;  5DNM C;  5G49 B;  5AY8 C;  5B31 B;  4H9N A;  5B32 C;  3AZN C;  3REH A;  3A6N D;  3AZF C;  4Z2M G;  3X1U C;  1F66 C;  3WKJ C;  4J8V A;  3LZ0 D;  3W98 B;  4CAY B;  3KUY D;  4LD9 C;  1WWS A;  4CSR B;  1BH8 B;  1B6W A;  2YFV B;  3X1S C;  3UT9 D;  3REI C;  4AWL B;  3UTA C;  3NQU B;  1EQZ C;  3C1C B;  3W99 B;  1TZY A;  5JA4 A;  5B24 C;  1P3K C;  3UTB C;  5DNN A;  1ZLA A;  5GT0 A;  5BT1 C;  1ID3 A;  2ARO A;  3REH D;  4J8X C;  5BNX B;  4J8V D;  4HGA C;  5B1M C;  3AYW A;  1H3O A;  2HIO D;  3B6F A;  2LY8 A;  3A6N B;  3MNN A;  3LZ0 B;  5B40 C;  3KUY B;  5BS7 A;  4YM6 B;  3LJA A;  1TZY D;  4YS3 C;  5BNV B;  3UT9 B;  4WZS B;  5GT0 D;  1ID3 D;  2ARO D;  4H9R B;  5F99 C;  4Z2M H;  1P3P C;  1M19 C;  3AZH A;  3LEL C;  4WU8 A;  3O62 C;  5GT3 C;  3AYW D;  5JRG A;  2CV5 A;  1P3F A;  3AV2 A;  3B6F D;  3REH B;  4NFT A;  5AV8 C;  4J8V B;  3AZM C;  4XUJ C;  3MNN D;  1KX4 C;  3LJA D;  1Q9C A;  3LZ1 D;  4ZUX C;  1M1A A;  2HIO B;  5C3I C;  4Z5T A;  3AZI A;  5B2I A;  2NZD C;  3AZH D;  3AFA A;  1TZY B;  5JA4 B;  2NQB D;  3WAA A;  3TU4 A;  3REJ A;  5AV9 D;  2CV5 D;  5AVB A;  5DNN B;  5GT0 B;  3AV2 D;  1ID3 B;  2ARO B;  5B1L A;  4WU9 A;  3KWQ C;  4R8P A;  1KX3 C;  3AV1 C;  3WTP A;  3AYW B;  5CP6 C;  1H3O B;  3MGP C;  1M1A D;  3B6F B;  5AY8 A;  3REK C;  4Z5T D;  3AZI D;  5CPJ C;  5B2I D;  3MNN B;  3AFA D;  3LJA B;  5B32 A;  2YFV A;  3B0B A;  5CPK C;  1BFM A;  3WAA D;  3TU4 D;  3X1T C;  2YFW B;  3REJ D;  3VH5 A;  3WKJ A;  5AVB D;  5B1L D;  3MGQ C;  4WU9 D;  4LD9 A;  4R8P D;  3AZH B;  5E5A D;  4WU8 B;  3X1S A;  3VH6 T;  3REI A;  3WTP D;  3AZL C;  4J8W A;  2CV5 B;  3AV2 B;  3UTA A;  2RVQ D;  5AY8 D;  5B24 A;  1P3K A;  3UTB A;  5B32 D;  5CPI C;  4JJN A;  1WWI A;  1M1A B;  3AZF D;  3WKJ D;  4Z5T B;  5B1M A;  3AZI B;  4LD9 D;  1U35 C;  5B2I B;  3AFA B;  5GXQ A;  1HTA A;  4Z66 C;  3X1S D;  3REI D;  3TU4 B;  1P3A C;  3REJ B;  3WAA B;  4G91 C;  4J8W D;  5AVB B;  3KXB C;  3UTA D;  5B1L B;  4WU9 B;  3AZG A;  4R8P B;  5B24 D;  3AN2 C;  4YS3 A;  1S32 C;  1P3K D;  3UTB D;  4DRA A;  3WA9 C;  3WTP B;  5BT1 D;  3KSY A;  4ZBJ C;  4JJN D;  5F99 A;  1P3P A;  1M19 A;  5AY8 B;  1AOI C;  3W97 C;  5B1M D;  3LEL A;  5GT3 A;  3AZE C;  5GXQ D;  5B32 B;  2HIO A;  1P3B A;  2FJ7 C;  3B0C W;  1BH9 A;  1P3L C;  3WKJ B;  3AZK C;  4X23 C;  4XUJ A;  4LD9 B;  3MGS A;  3AZG D;  3W98 C;  1R4V A;  4ZUX A;  4YS3 D;  4QLC C;  3X1S B;  3B0D B;  4EO5 C;  3REI B;  4J8W B;  3B0C T;  5F99 D;  1KU5 A;  2NZD A;  3UTA B;  3W96 C;  1HQ3 C;  5B2J C;  1P3P D;  4AWL C;  1M19 D;  1P3I A;  3LEL D;  5B24 B;  5GT3 D;  3V9R A;  2F8N K;  1P3K B;  3C1C C;  3UTB B;  1M18 A;  1P3B D;  4JJN B;  1F1E A;  4H9S C;  5BO0 A;  4J8U C;  4HGA B;  5B1M B;  4XUJ D;  3AZM D;  3AV1 A;  1KX3 A;  3R45 A;  1KX4 D;  4KHA A;  3MGS D;  5B0Z A;  3VH6 A;  5CP6 A;  3LZ1 A;  5GXQ B;  5AV6 C;  4ZUX D;  2YFW A;  3MGP A;  3AZJ A;  3REK A;  3MVD C;  5AV5 C;  2NZD D;  1P3I D;  3AZG B;  2NQB A;  5CPK A;  3KUY C;  4YS3 B;  3X1T A;  1KX5 C;  2HUE B;  4YM6 C;  5AV9 A;  2IO5 C;  1M18 D;  5F99 B;  4XZQ C;  1P3P B;  1M19 B;  1B67 A;  1KX3 D;  3LEL B;  3AV1 D;  1P3G C;  5GT3 B;  3AZL A;  5B0Z D;  5CP6 D;  3MGP D;  3MGR C;  1P3B B;  3AZJ D;  3REK D;  1P34 C;  5B0Y A;  1BH9 B;  5CPJ D;  4KUD C;  4XUJ B;  1P3M C;  3MGS B;  4J8V C;  5CPI A;  5CPK D;  4ZUX B;  3X1T D;  5C3I B;  3C1B C;  5FUG A;  2NZD B;  5E5A A;  5AVC C;  4Z66 A;  1P3I B;  3V9R B;  3AZL D;  1P3A A;  1M18 B;  5DNM A;  2BYK A;  5B0Y D;  5DNN C;  4H9O A;  5BO0 B;  1ZLA C;  1KX3 B;  3AV1 B;  1S32 A;  3R45 B;  3WA9 A;  4KHA B;  5B0Z B;  5CPI D;  5CP6 B;  3LZ1 B;  3AZN A;  3MGP B;  3AZF A;  3X1U A;  1F66 A;  3AZJ B;  3W97 A;  3REK B;  3X1V C;  1AOI A;  2PYO C;  4KGC C;  5B33 C;  3AZE A;  3B6G C;  4WNN A;  4Z66 D;  3MNN C;  2NQB B;  5CPK B;  2FJ7 A;  5BS7 C;  3X1T B;  1P3A D;  5GSU C;  5AV9 B;  4G92 C;  1P3L A;  3AZK A;  5DNM D;  4X23 A;  4WV4 B;  2BYM A;  3REL C;  1EQZ A;  1S32 D;  4QLC A;  3WA9 D;  3AZL B;  4WU8 C;  3AZN D;  4J8X A;  5JRG C;  1N1J A;  3X1U D;  3W96 A;  1HQ3 A;  5B2J A;  1P3F C;  5B0Y B;  1AOI D;  1F66 D;  2F8N G;  3AV2 C;  3W97 D;  4M6B A;  3AZE D;  5CPI B;  3NQJ A;  2FJ7 D;  4H9S A;  1P3L D;  4J8U A;  3AZK D;  4X23 D;  1TAF A;  5B40 A;  5FUG B;  1EQZ D;  2L5A A;  5E5A B;  5AV6 A;  2JSS A;  4Z66 B;  4QLC D;  1P3A B;  5AV5 A;  1P3O C;  4G91 B;  5DNM B;  4J8X D;  3TU4 C;  3W96 D;  1HQ3 D;  5B2J D;  2BYK B;  4NE6 A;  4H9O B;  3O62 A;  1KX5 A;  1S32 B;  3C1C D;  5B31 C;  5B31 G;  3WA9 B;  3AZN B;  5AV8 A;  4XZQ A;  3AZF B;  3X1U B;  1F66 B;  1AOI B;  3W97 B;  4J8U D;  3AZM A;  5B40 D;  4NE3 A;  1KX4 A;  1P3G A;  2RVQ C;  3AZE B;  5AV6 D;  4NE5 A;  4WNN B;  3MGR A;  2FJ7 B;  1P34 A;  3MVD D;  5AV5 D;  5B32 G;  1P3L B;  3AZK B;  4KUD A;  4X23 B;  1P3M A;  2F8N H;  2BYM B;  1EQZ B;  3O62 D;  1KX5 D;  4YM6 D;  1JFI A;  4QLC B;  3W99 C;  4EO5 B;  3C1B A;  3B0D C;  3KWQ A;  4J8X B;  5AV8 D;  4XZQ D;  1N1J B;  4J8W C;  3VH5 W;  1HQ3 B;  5B2J B;  3W96 B;  5AVC A;  1P3G D;  3MGR D;  3NQJ B;  1P34 D;  4JJN C;  4J8U B;  5CPJ A;  4UUZ A;  4KUD D;  1TAF B;  5CHL B;  3VH5 T;  5B40 B;  3A6N C;  1P3M D;  3LZ0 C;  5AV6 B;  4KGC A;  2PYO A;  5GXQ C;  3MVD B;  5AV5 B;  3C1B D;  3X1V A;  3UT9 C;  3MGQ A;  5B33 A;  3KWQ D;  3B6G A;  5AVC D;  3O62 B;  1KX5 B;  5GSU A;  2IO5 B;  3AZG C;  2HUE C;  3REL A;  5AV8 B;  4XZQ B;  5DNN D;  1ZLA D;  3REH C;  3AZM B;  1KX4 B;  1P3G B;  4H9N B;  3MGR B; 
#chains in the Genus database with same CATH topology
 1P34 B;  4KGC D;  2F8N A;  3X1V D;  2PYO D;  2HIO C;  4H9P A;  1P3B C;  3MGQ D;  4KUD B;  5B33 D;  1U35 A;  3WTP E;  1P3M B;  3B6G D;  2Y2L A;  3MGS C;  1JFI B;  2Y2M A;  5GSU D;  1TZY C;  3C1B B;  3KXB A;  5KDM A;  3REL D;  2DF4 C;  3KWQ B;  5GT0 C;  1ID3 C;  2ARO C;  4H9Q A;  3AN2 A;  4DRB A;  5AVC B;  1P3O A;  1P3I C;  4WU8 D;  3AYW C;  5JRG D;  1M18 C;  1P3F D;  2F8N D;  1ZLA B;  3B6F C;  5G49 A;  5CPJ B;  4UUZ B;  1U35 D;  2CWE A;  5B31 A;  3IP4 C;  5B0Z C;  3LJA C;  4KGC B;  3LZ1 C;  2PYO B;  3X1V B;  3KXB D;  2ZY5 A;  3MGQ B;  3AZJ C;  5B33 B;  3B6G B;  3AN2 D;  4CAY A;  3W98 A;  4CSR A;  3AZH C;  1BH8 A;  1P3O D;  3VH6 W;  5GSU B;  4G92 B;  2NQB C;  5AV9 C;  3REL B;  2CV5 C;  2W8S A;  3NQU A;  3C1C A;  5B31 D;  3W99 A;  4E45 A;  5JRG B;  2XD1 A;  1P3F B;  2F8N B;  1M1A C;  4H9P B;  2DQN C;  5BNX A;  4Z5T C;  5B0Y C;  3AZI C;  3F6T A;  1U35 B;  1ULY A;  3W98 D;  4E44 A;  5B2I C;  3AFA C;  3MVD A;  3WAA C;  3KXB B;  3A6N A;  3REJ C;  5KDM B;  5AVB C;  2JCH A;  2VQR A;  1A7W A;  4H9Q B;  5B1L C;  3LZ0 A;  3KUY A;  3AN2 B;  4WU9 C;  4YM6 A;  2JE5 A;  4R8P C;  3W99 D;  5E5A C;  1P3O B;  4ZBJ B;  5BNV A;  3UT9 A;  3WTP C;  4H9R A;  5DNM C;  5G49 B;  5AY8 C;  5B31 B;  4H9N A;  5B32 C;  3AZN C;  3REH A;  3A6N D;  3AZF C;  4Z2M G;  3X1U C;  1F66 C;  3WKJ C;  4J8V A;  3LZ0 D;  3W98 B;  4CAY B;  3KUY D;  4LD9 C;  1WWS A;  4CSR B;  1BH8 B;  1B6W A;  3P5J B;  2YFV B;  3X1S C;  3UT9 D;  3REI C;  4AWL B;  3AL0 C;  3UTA C;  3NQU B;  1EQZ C;  3C1C B;  3W99 B;  1TZY A;  5JA4 A;  5B24 C;  2G5H C;  3UTB C;  1P3K C;  5DNN A;  1ZLA A;  5GT0 A;  5BT1 C;  1ID3 A;  2ARO A;  3REH D;  4J8X C;  2Y2K A;  5BNX B;  4J8V D;  4HGA C;  5B1M C;  3AYW A;  1H3O A;  3EPJ A;  2HIO D;  3B6F A;  2LY8 A;  3A6N B;  3MNN A;  3LZ0 B;  5B40 C;  3KUY B;  5BS7 A;  4YM6 B;  3LJA A;  1TZY D;  4YS3 C;  5BNV B;  3UT9 B;  4WZS B;  2XD5 A;  5GT0 D;  1ID3 D;  1Z2C B;  2ARO D;  4H9R B;  5F99 C;  4Z2M H;  1P3P C;  1M19 C;  3AZH A;  3LEL C;  4WU8 A;  3O62 C;  5GT3 C;  3AYW D;  5JRG A;  2CV5 A;  1P3F A;  2BG1 A;  3AV2 A;  3B6F D;  3REH B;  4NFT A;  5AV8 C;  4J8V B;  3AZM C;  4XUJ C;  3MNN D;  1KX4 C;  3LJA D;  1Q9C A;  3LZ1 D;  4ZUX C;  1M1A A;  2HIO B;  5C3I C;  4Z5T A;  3AZI A;  3FDD A;  5B2I A;  2NZD C;  3AZH D;  3AFA A;  1TZY B;  5JA4 B;  2NQB D;  3WAA A;  3TU4 A;  3REJ A;  3A1K A;  5AV9 D;  3KFU G;  2CV5 D;  5AVB A;  5DNN B;  5GT0 B;  3AV2 D;  1ID3 B;  2ARO B;  5B1L A;  4WU9 A;  3KWQ C;  2UWX A;  4R8P A;  1KX3 C;  3AV1 C;  3WTP A;  3AYW B;  5CP6 C;  1H3O B;  3MGP C;  1M1A D;  3B6F B;  5AY8 A;  3REK C;  4Z5T D;  3AZI D;  5CPJ C;  5B2I D;  3MNN B;  3AFA D;  3LJA B;  5B32 A;  2YFV A;  3B0B A;  5CPK C;  1BFM A;  3WAA D;  3TU4 D;  3X1T C;  2YFW B;  3REJ D;  3VH5 A;  3WKJ A;  5AVB D;  5B1L D;  3MGQ C;  4WU9 D;  4LD9 A;  4R8P D;  3AZH B;  5E5A D;  4WU8 B;  3X1S A;  3VH6 T;  3REI A;  3WTP D;  3AZL C;  4J8W A;  3H0R C;  2CV5 B;  3AV2 B;  3UTA A;  2RVQ D;  5AY8 D;  3H0M C;  5B24 A;  1P3K A;  3UTB A;  2Y2J A;  5B32 D;  5CPI C;  4JJN A;  1WWI A;  1M1A B;  3AZF D;  3WKJ D;  4Z5T B;  5B1M A;  3AZI B;  4LD9 D;  1U35 C;  5B2I B;  3AFA B;  5GXQ A;  1HTA A;  4Z66 C;  3X1S D;  3REI D;  3TU4 B;  1P3A C;  3REJ B;  3WAA B;  4G91 C;  4J8W D;  5AVB B;  3KXB C;  3UTA D;  5B1L B;  4WU9 B;  3AZG A;  4R8P B;  5B24 D;  3AN2 C;  4YS3 A;  1S32 C;  1P3K D;  3UTB D;  4DRA A;  3WA9 C;  3WTP B;  5BT1 D;  3KSY A;  4ZBJ C;  4JJN D;  5F99 A;  1P3P A;  1M19 A;  5AY8 B;  1AOI C;  3W97 C;  5B1M D;  3LEL A;  5GT3 A;  3AZE C;  5GXQ D;  5B32 B;  2HIO A;  1P3B A;  2FJ7 C;  3B0C W;  1BH9 A;  1P3L C;  3WKJ B;  3AZK C;  4X23 C;  4XUJ A;  4LD9 B;  3MGS A;  3AZG D;  2RIQ A;  3W98 C;  1R4V A;  4ZUX A;  4YS3 D;  4QLC C;  3X1S B;  3B0D B;  4EO5 C;  3REI B;  4J8W B;  3B0C T;  5F99 D;  1KU5 A;  2NZD A;  3UTA B;  3W96 C;  1HQ3 C;  5B2J C;  1P3P D;  4AWL C;  1M19 D;  1P3I A;  3LEL D;  5B24 B;  5GT3 D;  3V9R A;  2F8N K;  1P3K B;  3C1C C;  3UTB B;  1M18 A;  1P3B D;  4JJN B;  1F1E A;  4H9S C;  5BO0 A;  4J8U C;  4HGA B;  5B1M B;  4XUJ D;  3AZM D;  3AV1 A;  1KX3 A;  3R45 A;  1KX4 D;  4KHA A;  3MGS D;  5B0Z A;  3VH6 A;  5CP6 A;  3LZ1 A;  5GXQ B;  5AV6 C;  4ZUX D;  2YFW A;  3MGP A;  3AZJ A;  3REK A;  3MVD C;  5AV5 C;  4WJ3 C;  2NZD D;  1P3I D;  3AZG B;  2NQB A;  5CPK A;  3KUY C;  4YS3 B;  3X1T A;  1KX5 C;  2HUE B;  4YM6 C;  5AV9 A;  2IO5 C;  1M18 D;  5F99 B;  4XZQ C;  1P3P B;  1M19 B;  1B67 A;  1KX3 D;  3LEL B;  3AV1 D;  2ZY2 A;  1P3G C;  5GT3 B;  3AZL A;  5B0Z D;  5CP6 D;  3MGP D;  3MGR C;  1P3B B;  3AZJ D;  3REK D;  1P34 C;  2Y2N A;  5B0Y A;  1BH9 B;  5CPJ D;  2Y2I A;  4KUD C;  1T3U A;  4XUJ B;  1P3M C;  3MGS B;  4J8V C;  5CPI A;  5CPK D;  2ZY3 A;  4ZUX B;  3X1T D;  5C3I B;  3C1B C;  2G5I C;  5FUG A;  2NZD B;  5E5A A;  5AVC C;  4Z66 A;  1P3I B;  3V9R B;  1W2E A;  3AZL D;  1P3A A;  1M18 B;  5DNM A;  2BYK A;  5B0Y D;  5DNN C;  4H9O A;  5BO0 B;  1ZLA C;  1KX3 B;  3AV1 B;  1S32 A;  3R45 B;  3WA9 A;  4KHA B;  5B0Z B;  5CPI D;  5CP6 B;  3LZ1 B;  2ZM5 A;  3AZN A;  3MGP B;  3AZF A;  3X1U A;  1F66 A;  3AZJ B;  3W97 A;  3REK B;  3X1V C;  1AOI A;  2PYO C;  4KGC C;  5B33 C;  3AZE A;  3B6G C;  4WNN A;  4Z66 D;  3MNN C;  2NQB B;  5CPK B;  2FJ7 A;  5BS7 C;  3X1T B;  2Y2Q A;  1P3A D;  5GSU C;  5AV9 B;  4G92 C;  1P3L A;  3AZK A;  5DNM D;  4X23 A;  4WV4 B;  2BYM A;  3REL C;  1EQZ A;  1PZR A;  1S32 D;  4QLC A;  3WA9 D;  3AZL B;  4WU8 C;  3AZN D;  4DQY B;  4J8X A;  5JRG C;  1N1J A;  3X1U D;  3W96 A;  1HQ3 A;  5B2J A;  1P3F C;  5B0Y B;  1AOI D;  1F66 D;  2F8N G;  3AV2 C;  3W97 D;  4M6B A;  3AZE D;  5CPI B;  3NQJ A;  2FJ7 D;  2ZY4 A;  4H9S A;  1P3L D;  4J8U A;  3AZK D;  4X23 D;  1TAF A;  5B40 A;  3H0L C;  5FUG B;  1EQZ D;  2L5A A;  5E5A B;  5AV6 A;  2JSS A;  4Z66 B;  4QLC D;  3EPK A;  1P3A B;  5AV5 A;  1P3O C;  4G91 B;  2J8P A;  5DNM B;  4J8X D;  3TU4 C;  3W96 D;  1HQ3 D;  5B2J D;  2BYK B;  4NE6 A;  4H9O B;  3O62 A;  2FFF B;  1KX5 A;  1S32 B;  3C1C D;  5B31 C;  5B31 G;  3WA9 B;  3AZN B;  5AV8 A;  4XZQ A;  3AZF B;  3X1U B;  1F66 B;  1AOI B;  3W97 B;  4J8U D;  2Y2P A;  3AZM A;  5B40 D;  4NE3 A;  1KX4 A;  1P3G A;  2RVQ C;  3AZE B;  5AV6 D;  4NE5 A;  4WNN B;  3MGR A;  2FJ7 B;  1P34 A;  3MVD D;  5AV5 D;  5B32 G;  1P3L B;  3AZK B;  4KUD A;  4X23 B;  1P3M A;  2F8N H;  2BYM B;  1EQZ B;  3O62 D;  1KX5 D;  4YM6 D;  1JFI A;  4QLC B;  3W99 C;  4EO5 B;  3C1B A;  2Y2H A;  3B0D C;  3KWQ A;  4J8X B;  5AV8 D;  4XZQ D;  1N1J B;  4J8W C;  3VH5 W;  1HQ3 B;  5B2J B;  3W96 B;  5AVC A;  1P3G D;  4UPK A;  3MGR D;  3NQJ B;  1P34 D;  4JJN C;  4J8U B;  5CPJ A;  4UUZ A;  4KUD D;  1TAF B;  5CHL B;  3VH5 T;  5B40 B;  3A6N C;  1P3M D;  3LZ0 C;  5AV6 B;  4KGC A;  2PYO A;  5GXQ C;  3MVD B;  5AV5 B;  3C1B D;  3X1V A;  3UT9 C;  3MGQ A;  5B33 A;  3KWQ D;  3B6G A;  5AVC D;  3EPL A;  3O62 B;  1KX5 B;  5GSU A;  2IO5 B;  3AZG C;  2F2A C;  2HUE C;  3REL A;  5AV8 B;  4XZQ B;  5DNN D;  1ZLA D;  3EPH A;  3REH C;  3AZM B;  2Y2O A;  1KX4 B;  1P3G B;  3EG5 B;  2Y2G A;  3A1I A;  4H9N B;  3MGR B; 
#chains in the Genus database with same CATH homology
 1P34 B;  4KGC D;  2F8N A;  3X1V D;  2PYO D;  2HIO C;  4H9P A;  1P3B C;  3MGQ D;  4KUD B;  5B33 D;  1U35 A;  3WTP E;  1P3M B;  3B6G D;  2Y2L A;  3MGS C;  1JFI B;  2Y2M A;  5GSU D;  1TZY C;  3C1B B;  3KXB A;  5KDM A;  3REL D;  2DF4 C;  3KWQ B;  5GT0 C;  1ID3 C;  2ARO C;  4H9Q A;  3AN2 A;  4DRB A;  5AVC B;  1P3O A;  1P3I C;  4WU8 D;  3AYW C;  5JRG D;  1M18 C;  1P3F D;  2F8N D;  1ZLA B;  3B6F C;  5G49 A;  5CPJ B;  4UUZ B;  1U35 D;  2CWE A;  5B31 A;  3IP4 C;  5B0Z C;  3LJA C;  4KGC B;  3LZ1 C;  2PYO B;  3X1V B;  3KXB D;  2ZY5 A;  3MGQ B;  3AZJ C;  5B33 B;  3B6G B;  3AN2 D;  4CAY A;  3W98 A;  4CSR A;  3AZH C;  1BH8 A;  1P3O D;  3VH6 W;  5GSU B;  4G92 B;  2NQB C;  5AV9 C;  3REL B;  2CV5 C;  2W8S A;  3NQU A;  3C1C A;  5B31 D;  3W99 A;  4E45 A;  5JRG B;  2XD1 A;  1P3F B;  2F8N B;  1M1A C;  4H9P B;  2DQN C;  5BNX A;  4Z5T C;  5B0Y C;  3AZI C;  3F6T A;  1U35 B;  1ULY A;  3W98 D;  4E44 A;  5B2I C;  3AFA C;  3MVD A;  3WAA C;  3KXB B;  3A6N A;  3REJ C;  5KDM B;  5AVB C;  2JCH A;  2VQR A;  1A7W A;  4H9Q B;  5B1L C;  3LZ0 A;  3KUY A;  3AN2 B;  4WU9 C;  4YM6 A;  2JE5 A;  4R8P C;  3W99 D;  5E5A C;  1P3O B;  4ZBJ B;  5BNV A;  3UT9 A;  3WTP C;  4H9R A;  5DNM C;  5G49 B;  5AY8 C;  5B31 B;  4H9N A;  5B32 C;  3AZN C;  3REH A;  3A6N D;  3AZF C;  4Z2M G;  3X1U C;  1F66 C;  3WKJ C;  4J8V A;  3LZ0 D;  3W98 B;  4CAY B;  3KUY D;  4LD9 C;  1WWS A;  4CSR B;  1BH8 B;  1B6W A;  3P5J B;  2YFV B;  3X1S C;  3UT9 D;  3REI C;  4AWL B;  3AL0 C;  3UTA C;  3NQU B;  1EQZ C;  3C1C B;  3W99 B;  1TZY A;  5JA4 A;  5B24 C;  2G5H C;  3UTB C;  1P3K C;  5DNN A;  1ZLA A;  5GT0 A;  5BT1 C;  1ID3 A;  2ARO A;  3REH D;  4J8X C;  2Y2K A;  5BNX B;  4J8V D;  4HGA C;  5B1M C;  3AYW A;  1H3O A;  3EPJ A;  2HIO D;  3B6F A;  2LY8 A;  3A6N B;  3MNN A;  3LZ0 B;  5B40 C;  3KUY B;  5BS7 A;  4YM6 B;  3LJA A;  1TZY D;  4YS3 C;  5BNV B;  3UT9 B;  4WZS B;  2XD5 A;  5GT0 D;  1ID3 D;  1Z2C B;  2ARO D;  4H9R B;  5F99 C;  4Z2M H;  1P3P C;  1M19 C;  3AZH A;  3LEL C;  4WU8 A;  3O62 C;  5GT3 C;  3AYW D;  5JRG A;  2CV5 A;  1P3F A;  2BG1 A;  3AV2 A;  3B6F D;  3REH B;  4NFT A;  5AV8 C;  4J8V B;  3AZM C;  4XUJ C;  3MNN D;  1KX4 C;  3LJA D;  1Q9C A;  3LZ1 D;  4ZUX C;  1M1A A;  2HIO B;  5C3I C;  4Z5T A;  3AZI A;  3FDD A;  5B2I A;  2NZD C;  3AZH D;  3AFA A;  1TZY B;  5JA4 B;  2NQB D;  3WAA A;  3TU4 A;  3REJ A;  3A1K A;  5AV9 D;  3KFU G;  2CV5 D;  5AVB A;  5DNN B;  5GT0 B;  3AV2 D;  1ID3 B;  2ARO B;  5B1L A;  4WU9 A;  3KWQ C;  2UWX A;  4R8P A;  1KX3 C;  3AV1 C;  3WTP A;  3AYW B;  5CP6 C;  1H3O B;  3MGP C;  1M1A D;  3B6F B;  5AY8 A;  3REK C;  4Z5T D;  3AZI D;  5CPJ C;  5B2I D;  3MNN B;  3AFA D;  3LJA B;  5B32 A;  2YFV A;  3B0B A;  5CPK C;  1BFM A;  3WAA D;  3TU4 D;  3X1T C;  2YFW B;  3REJ D;  3VH5 A;  3WKJ A;  5AVB D;  5B1L D;  3MGQ C;  4WU9 D;  4LD9 A;  4R8P D;  3AZH B;  5E5A D;  4WU8 B;  3X1S A;  3VH6 T;  3REI A;  3WTP D;  3AZL C;  4J8W A;  3H0R C;  2CV5 B;  3AV2 B;  3UTA A;  2RVQ D;  5AY8 D;  3H0M C;  5B24 A;  1P3K A;  3UTB A;  2Y2J A;  5B32 D;  5CPI C;  4JJN A;  1WWI A;  1M1A B;  3AZF D;  3WKJ D;  4Z5T B;  5B1M A;  3AZI B;  4LD9 D;  1U35 C;  5B2I B;  3AFA B;  5GXQ A;  1HTA A;  4Z66 C;  3X1S D;  3REI D;  3TU4 B;  1P3A C;  3REJ B;  3WAA B;  4G91 C;  4J8W D;  5AVB B;  3KXB C;  3UTA D;  5B1L B;  4WU9 B;  3AZG A;  4R8P B;  5B24 D;  3AN2 C;  4YS3 A;  1S32 C;  1P3K D;  3UTB D;  4DRA A;  3WA9 C;  3WTP B;  5BT1 D;  3KSY A;  4ZBJ C;  4JJN D;  5F99 A;  1P3P A;  1M19 A;  5AY8 B;  1AOI C;  3W97 C;  5B1M D;  3LEL A;  5GT3 A;  3AZE C;  5GXQ D;  5B32 B;  2HIO A;  1P3B A;  2FJ7 C;  3B0C W;  1BH9 A;  1P3L C;  3WKJ B;  3AZK C;  4X23 C;  4XUJ A;  4LD9 B;  3MGS A;  3AZG D;  2RIQ A;  3W98 C;  1R4V A;  4ZUX A;  4YS3 D;  4QLC C;  3X1S B;  3B0D B;  4EO5 C;  3REI B;  4J8W B;  3B0C T;  5F99 D;  1KU5 A;  2NZD A;  3UTA B;  3W96 C;  1HQ3 C;  5B2J C;  1P3P D;  4AWL C;  1M19 D;  1P3I A;  3LEL D;  5B24 B;  5GT3 D;  3V9R A;  2F8N K;  1P3K B;  3C1C C;  3UTB B;  1M18 A;  1P3B D;  4JJN B;  1F1E A;  4H9S C;  5BO0 A;  4J8U C;  4HGA B;  5B1M B;  4XUJ D;  3AZM D;  3AV1 A;  1KX3 A;  3R45 A;  1KX4 D;  4KHA A;  3MGS D;  5B0Z A;  3VH6 A;  5CP6 A;  3LZ1 A;  5GXQ B;  5AV6 C;  4ZUX D;  2YFW A;  3MGP A;  3AZJ A;  3REK A;  3MVD C;  5AV5 C;  4WJ3 C;  2NZD D;  1P3I D;  3AZG B;  2NQB A;  5CPK A;  3KUY C;  4YS3 B;  3X1T A;  1KX5 C;  2HUE B;  4YM6 C;  5AV9 A;  2IO5 C;  1M18 D;  5F99 B;  4XZQ C;  1P3P B;  1M19 B;  1B67 A;  1KX3 D;  3LEL B;  3AV1 D;  2ZY2 A;  1P3G C;  5GT3 B;  3AZL A;  5B0Z D;  5CP6 D;  3MGP D;  3MGR C;  1P3B B;  3AZJ D;  3REK D;  1P34 C;  2Y2N A;  5B0Y A;  1BH9 B;  5CPJ D;  2Y2I A;  4KUD C;  1T3U A;  4XUJ B;  1P3M C;  3MGS B;  4J8V C;  5CPI A;  5CPK D;  2ZY3 A;  4ZUX B;  3X1T D;  5C3I B;  3C1B C;  2G5I C;  5FUG A;  2NZD B;  5E5A A;  5AVC C;  4Z66 A;  1P3I B;  3V9R B;  1W2E A;  3AZL D;  1P3A A;  1M18 B;  5DNM A;  2BYK A;  5B0Y D;  5DNN C;  4H9O A;  5BO0 B;  1ZLA C;  1KX3 B;  3AV1 B;  1S32 A;  3R45 B;  3WA9 A;  4KHA B;  5B0Z B;  5CPI D;  5CP6 B;  3LZ1 B;  2ZM5 A;  3AZN A;  3MGP B;  3AZF A;  3X1U A;  1F66 A;  3AZJ B;  3W97 A;  3REK B;  3X1V C;  1AOI A;  2PYO C;  4KGC C;  5B33 C;  3AZE A;  3B6G C;  4WNN A;  4Z66 D;  3MNN C;  2NQB B;  5CPK B;  2FJ7 A;  5BS7 C;  3X1T B;  2Y2Q A;  1P3A D;  5GSU C;  5AV9 B;  4G92 C;  1P3L A;  3AZK A;  5DNM D;  4X23 A;  4WV4 B;  2BYM A;  3REL C;  1EQZ A;  1PZR A;  1S32 D;  4QLC A;  3WA9 D;  3AZL B;  4WU8 C;  3AZN D;  4DQY B;  4J8X A;  5JRG C;  1N1J A;  3X1U D;  3W96 A;  1HQ3 A;  5B2J A;  1P3F C;  5B0Y B;  1AOI D;  1F66 D;  2F8N G;  3AV2 C;  3W97 D;  4M6B A;  3AZE D;  5CPI B;  3NQJ A;  2FJ7 D;  2ZY4 A;  4H9S A;  1P3L D;  4J8U A;  3AZK D;  4X23 D;  1TAF A;  5B40 A;  3H0L C;  5FUG B;  1EQZ D;  2L5A A;  5E5A B;  5AV6 A;  2JSS A;  4Z66 B;  4QLC D;  3EPK A;  1P3A B;  5AV5 A;  1P3O C;  4G91 B;  2J8P A;  5DNM B;  4J8X D;  3TU4 C;  3W96 D;  1HQ3 D;  5B2J D;  2BYK B;  4NE6 A;  4H9O B;  3O62 A;  2FFF B;  1KX5 A;  1S32 B;  3C1C D;  5B31 C;  5B31 G;  3WA9 B;  3AZN B;  5AV8 A;  4XZQ A;  3AZF B;  3X1U B;  1F66 B;  1AOI B;  3W97 B;  4J8U D;  2Y2P A;  3AZM A;  5B40 D;  4NE3 A;  1KX4 A;  1P3G A;  2RVQ C;  3AZE B;  5AV6 D;  4NE5 A;  4WNN B;  3MGR A;  2FJ7 B;  1P34 A;  3MVD D;  5AV5 D;  5B32 G;  1P3L B;  3AZK B;  4KUD A;  4X23 B;  1P3M A;  2F8N H;  2BYM B;  1EQZ B;  3O62 D;  1KX5 D;  4YM6 D;  1JFI A;  4QLC B;  3W99 C;  4EO5 B;  3C1B A;  2Y2H A;  3B0D C;  3KWQ A;  4J8X B;  5AV8 D;  4XZQ D;  1N1J B;  4J8W C;  3VH5 W;  1HQ3 B;  5B2J B;  3W96 B;  5AVC A;  1P3G D;  4UPK A;  3MGR D;  3NQJ B;  1P34 D;  4JJN C;  4J8U B;  5CPJ A;  4UUZ A;  4KUD D;  1TAF B;  5CHL B;  3VH5 T;  5B40 B;  3A6N C;  1P3M D;  3LZ0 C;  5AV6 B;  4KGC A;  2PYO A;  5GXQ C;  3MVD B;  5AV5 B;  3C1B D;  3X1V A;  3UT9 C;  3MGQ A;  5B33 A;  3KWQ D;  3B6G A;  5AVC D;  3EPL A;  3O62 B;  1KX5 B;  5GSU A;  2IO5 B;  3AZG C;  2F2A C;  2HUE C;  3REL A;  5AV8 B;  4XZQ B;  5DNN D;  1ZLA D;  3EPH A;  3REH C;  3AZM B;  2Y2O A;  1KX4 B;  1P3G B;  3EG5 B;  2Y2G A;  3A1I A;  4H9N B;  3MGR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...