3REHD

2.5 angstrom crystal structure of the nucleosome core particle assembled with a 145 bp alpha-satellite dna (ncp145)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
95
structure length
95
Chain Sequence
KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Specific DNA structural attributes modulate platinum anticancer drug site selection and cross-link generation.
pubmed doi rcsb
source organism Xenopus laevis
total genus 39
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-04-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3rehD00
5AVBA 3AZMC 1JFIB 1ZLAA 3C1BA 3MGRA 1P3GA 3AZGD 4ZUXC 1KX3B 4YS3C 1R4VA 2BYMB 4UUZA 3LELA 3X1TD 1P3FD 3AFAD 5BT1C 5E5AA 1P3PC 3AZLA 1P3MB 1HQ3A 5B2JB 4YM6A 3MGQD 3W97D 5GXQA 3REIA 4KGCD 1P3LB 3AV2A 5GT0A 4H9PB 2NQBC 1P3OB 1KX4A 1TZYC 1WWSA 3AN2D 1Q9CA 3MGPB 3AZID 3A6ND 1P34A 3RELA 5FUGA 3KXBB 4J8UB 4J8XB 2CV5B 5GSUD 2NZDA 4ZBJB 5CPJD 5B40B 3VH6A 5B1MC 5B24C 5AV9D 1P3AA 3REJD 4R8PC 3KUYD 2JSSA 3LJAC 3C1CD 4G91C 3LZ1B 1U35C 5GSUB 3KWQD 3B6GC 5B1LC 5KDMB 2HIOB 1KX5C 3WTPD 3REHA 4KGCA 5CPKB 3TU4D 1P3BB 4H9SA 5B2IC 1F1EA 2AROC 4WU9B 1M1AC 4XZQB 4AWLB 3W99B 3UTBD 3O62D 3UTAA 1P3KA 3WKJB 1ID3B 3W98A 4H9QB 5B0YC 5B31C 2PYOB 4JJND 1P3IC 5AV6C 2YFWB 2IO5C 5G49A 5AY8D 4G92C 5AV5B 3NQJA 5DNMA 5CPJA 1F66B 5JRGA 1M18B 5BO0A 4QLCB 3NQUA 3X1UA 5CPIA 1KX3C 3KUYA 5B0ZB 4CAYB 3KWQA 4Z5TA 1BH9A 4H9RB 4H9OB 3X1SA 2F8NA 4WU8B 5B2JC 4X23D 4Z66A 3UT9B 3AZJD 1P3LC 1BH8A 2YFVB 3AZFB 1P3OC 4LD9D 1M19D 3WA9D 3O62A 2FJ7B 5DNNB 3MGPC 5BS7C 5BNXB 3AYWB 1AOIA 5F99B 5BT1D 5AY8A 3KXBC 4J8UC 2LY8A 3AZNA 4J8XC 2CV5C 1EQZD 5AV8A 3LZ0A 3MGSB 5CP6D 3W96D 3REKA 5B32A 1S32D 3WAAB 4HGAB 3MVDB 5AVBD 4KUDB 1ZLAD 1TZYD 3C1BD 3X1VA 3LZ1C 3MGRD 4H9NA 2BYKB 1P3GD 4NE5A 3B6FB 3AV1C 3LELD 5JA4B 5CPKC 1P3BC 5E5AD 3AZLD 1HQ3D 4WU9C 3W99C 5GXQD 3REID 4ZUXA 3AV2D 4YS3A 5GT0D 3AZHB 3WKJC 3LELB 1ID3C 1KX4D 4WNNB 1TAFA 3B0CW 5AV5C 1KX5D 1P3PA 4YM6B 1F66C 3RELD 1H3OA 4J8VB 1M18C 4QLCC 5B2ID 1M1AD 5B31G 5B0ZC 4XUJB 2NZDD 1TZYA 3B0DB 1P34B 1P3AD 5AVCC 5B31D 4WU8C 3MNNB 5GT3D 3UT9C 3AZFC 5B1MA 5B24A 2F8NK 4J8WC 3AZGB 3REHD 2FJ7C 4R8PA 5DNNC 3LJAA 3X1TB 3AYWC 1P3FB 3AFAB 1U35A 3KSYA 3AZEC 5B1LA 3B0CT 3UTAD 1KX5A 1P3KD 1N1JB 3AZKC 3W98D 5BNVB 3MGQB 3W97B 4KGCB 3MGSC 3WAAC 5B2IA 4HGAC 1BFMA 2AROA 3MVDC 1M1AA 4KUDC 3VH5A 5B33C 5DNMD 3AN2B 3AZIB 5JRGD 3W98B 3A6NB 4Z2MH 3X1UD 5CPID 5B0YA 5B31A 3B6FC 1P3IA 5AV6A 2F8NG 1KU5A 5GT3A 3NQJB 4CSRA 1JFIA 4Z5TD 5CPJB 3X1SD 2F8ND 5BO0B 5AV9B 3NQUB 3REJB 4Z66D 3KUYB 1KX3A 2CWEA 1B67A 3C1CB 2BYMA 3AZHC 1A7WA 3KWQB 1B6WA 4NFTA 3AV1D 3WTPB 5B2JA 3TU4B 1AOID 1P3LA 4J8VC 4H9PA 5B32G 1P3OA 3AZND 2HUEB 3UTBB 4DRBA 3O62B 5AV8D 4XUJC 3LZ0D 3REKD 5B32D 3MGPA 5BS7A 5CHLB 4JJNB 5AY8B 3KXBA 3MNNC 3X1VD 4J8UA 4J8XA 2CV5A 3V9RB 1P3MC 3VH6W 3AZGC 4EO5B 3AZMD 3X1TC 1P3FC 3AFAC 3LZ1A 4H9NB 5KDMA 4ZUXD 4YS3D 5AVCD 3AV1A 4KHAB 4X23B 3MGQC 3W97C 3AZJB 5CPKA 1P3BA 4LD9B 1P3PD 1M19B 3WA9B 4NE6A 4WU9A 3W99A 4J8WD 4ZBJC 3AN2C 5B40C 3AZIC 3WKJA 2NQBD 3A6NC 1ID3A 1TAFB 4H9QA 4CSRB 4DRAA 3AZED 5AV5A 1EQZB 3AZKD 5GSUC 5CP6B 2HIOC 3W96B 3R45B 1H3OB 1S32B 1F66A 1M18A 3WTPE 5AV9C 4QLCA 4E44A 4E45A 3REJC 3VH6T 5AVBB 3AZMA 3C1CC 1ZLAB 1TZYB 5B33D 5B0ZA 3C1BB 4CAYA 3MGRB 5B1MD 4XZQC 5B24D 4AWLC 1P3GB 4R8PD 5AVCA 4H9OA 4UUZB 3WTPC 3LJAD 4WU8A 2PYOC 1U35D 3TU4C 3UT9A 3B6GD 5E5AB 5B1LD 2YFVA 2F8NH 3AZLB 3AZFA 1HQ3B 2HUEC 3UTBC 4J8WA 5GXQB 3REIB 4R8PB 3AV2B 2FJ7A 5GT0B 5DNNA 2NQBA 1KX4B 5BNXA 3AYWA 2AROD 4JJNC 3AZEA 1KX5B 3AZKA 4WZSB 5B0YD 3MGSA 3RELB 5FUGB 1P3ID 5AV6D 5B2IB 1M1AB 2NZDB 4KUDA 5B33A 1WWIA 1P3AB 2BYKA 5B31B 1KX3D 3B6FA 4X23C 2IO5B 5GT3B 3AZJC 5F99C 3B6GA 4LD9C 1M19C 3WA9C 1P3MD 5B2JD 3REHB 1P3LD 3AZHA 1P3OD 4WNNA 4NE3A 3UTAB 1P3KB 3MGPD 1EQZC 5CP6C 3W96C 1S32C 5G49B 4J8VA 3KXBD 4J8UD 5AVBC 4J8XD 2CV5D 5DNMB 1ZLAC 3C1BC 4XUJA 5JRGB 3MGRC 5B40D 1P3GC 3X1UB 5CPIB 3LELC 3MNNA 3LZ1D 4Z5TB 5E5AC 2L5AA 1BH9B 3X1SB 2HIOD 2F8NB 3AZLC 1HQ3C 1P3MA 4YM6C 4Z66B 5GXQC 3REIC 3AZGA 1BH8B 3AV2C 5GT0C 5CPKD 1P3BD 1KX4C 2RVQC 5C3IB 3X1TA 1P3FA 3AFAA 4WU9D 3W99D 4XZQD 3B0DC 3AV1B 3WKJD 1N1JA 1ID3D 5BNVA 1P34C 3MGQA 3W97A 1AOIB 3RELC 2PYOD 4M6BA 5AV5D 3AZNB 5AV8B 3LZ0B 2NZDC 3VH5W 3AN2A 3REKB 5B32B 5B40A 3AZIA 1M18D 1F66D 4QLCD 3A6NA 1P3AC 5B0ZD 3X1VB 5GT3C 5GSUA 2HIOA 4WU8D 3REHC 5AV9A 4KGCC 3REJA 3AZMB 3UT9D 4H9SC 3C1CA 3AZFD 4XZQA 4WV4B 3UTAC 4ZUXB 4YS3B 5AVCB 1P3KC 5DNND 2FJ7D 3W98C 3WTPA 3AYWD 2PYOA 3TU4A 5F99D 2YFWA 1P3PB 4Z2MG 4J8WB 3UTBA 5DNMC 5CPJC 3MGSD 5JRGC 3VH5T 2NQBB 3WAAD 3X1UC 5CPIC 1ULYA 3KUYC 4JJNA 3MVDD 3AZEB 4KUDD 3AZKB 3KWQC 4Z5TC 3V9RA 3X1SC 3B6FD 4H9RA 4Z66C 5B33B 5C3IC 5B1MB 5B24B 3O62C 3LJAB 3AZHD 4KHAA 4X23A 4G91B 1HTAA 1U35B 1AOIC 3AZJA 3B6GB 5F99A 5B1LB 5AY8C 4LD9A 3AZNC 1M19A 3WA9A 5AV8C 3LZ0C 4YM6D 3REKC 5B32C 3WAAA 4J8VD 2AROB 2RVQD 3MVDA 4EO5C 3B0BA 4XUJD 3X1VC 1EQZA 5B0YB 1P34D 5CP6A 3W96A 3R45A 5AV6B 1P3IB 1S32A 4G92B 3MNND 5JA4A
chains in the Genus database with same CATH superfamily
5AVBA 3AZMC 1JFIB 1ZLAA 3C1BA 2Y2QA 3MGRA 1P3GA 3AZGD 4ZUXC 1KX3B 4YS3C 1R4VA 2BYMB 4UUZA 3LELA 3X1TD 1P3FD 3AFAD 5BT1C 2ZY2A 5E5AA 1P3PC 3AZLA 1P3MB 1HQ3A 5B2JB 4YM6A 3MGQD 3W97D 5GXQA 3REIA 4KGCD 1P3LB 3AV2A 5GT0A 4H9PB 2NQBC 1P3OB 1KX4A 1TZYC 1WWSA 3AN2D 1Q9CA 3MGPB 3AZID 3A6ND 1P34A 3RELA 5FUGA 3KXBB 4J8UB 4J8XB 2CV5B 5GSUD 2NZDA 2Y2KA 4ZBJB 5CPJD 5B40B 3VH6A 5B1MC 5B24C 5AV9D 1P3AA 3REJD 4R8PC 3KUYD 2JSSA 3LJAC 3C1CD 2ZY5A 4G91C 3LZ1B 1U35C 5GSUB 3KWQD 3B6GC 5B1LC 5KDMB 2HIOB 1KX5C 2DF4C 3WTPD 3REHA 4KGCA 5CPKB 3AL0C 3TU4D 1P3BB 4H9SA 5B2IC 1F1EA 2AROC 4WU9B 1M1AC 4XZQB 4AWLB 3W99B 3UTBD 3O62D 3UTAA 1P3KA 3WKJB 2F2AC 1ID3B 3W98A 4H9QB 5B0YC 5B31C 2PYOB 4JJND 1P3IC 5AV6C 2YFWB 2IO5C 5G49A 5AY8D 4G92C 5AV5B 3NQJA 5DNMA 5CPJA 1F66B 5JRGA 1M18B 5BO0A 4QLCB 3NQUA 3X1UA 5CPIA 1KX3C 3KUYA 5B0ZB 4CAYB 3KWQA 4Z5TA 1BH9A 4H9RB 4H9OB 3X1SA 2F8NA 4WU8B 5B2JC 4X23D 4Z66A 3UT9B 3AZJD 1P3LC 1BH8A 2YFVB 3AZFB 1P3OC 4LD9D 1M19D 3WA9D 3O62A 2FJ7B 5DNNB 3MGPC 5BS7C 5BNXB 3AYWB 1AOIA 5F99B 5BT1D 5AY8A 3KXBC 4J8UC 2LY8A 3AZNA 4J8XC 2CV5C 1EQZD 5AV8A 3LZ0A 3MGSB 5CP6D 3W96D 3REKA 5B32A 1S32D 3WAAB 4HGAB 3MVDB 5AVBD 4KUDB 1ZLAD 1TZYD 3C1BD 3X1VA 3LZ1C 3MGRD 4H9NA 2BYKB 1P3GD 3FDDA 4NE5A 3B6FB 3AV1C 3LELD 5JA4B 5CPKC 1P3BC 5E5AD 3AZLD 1HQ3D 4WU9C 3W99C 5GXQD 3REID 4ZUXA 3AV2D 4YS3A 5GT0D 3AZHB 3WKJC 3LELB 1ID3C 1KX4D 4WNNB 1TAFA 3B0CW 5AV5C 1KX5D 1P3PA 4YM6B 1F66C 3RELD 1H3OA 4J8VB 1M18C 4QLCC 5B2ID 2Y2HA 5B31G 5B0ZC 4XUJB 1M1AD 2NZDD 1TZYA 3B0DB 1P34B 1P3AD 2J8PA 5AVCC 5B31D 3H0MC 4WU8C 3MNNB 5GT3D 3UT9C 3AZFC 5B1MA 5B24A 2F8NK 4J8WC 3AZGB 3REHD 2ZY4A 2FJ7C 4R8PA 5DNNC 3EPKA 2W8SA 2RIQA 3LJAA 3X1TB 3AYWC 1P3FB 3AFAB 1U35A 2FFFB 3KSYA 2JE5A 4UPKA 3AZEC 5B1LA 3B0CT 3UTAD 1KX5A 1P3KD 1N1JB 3AZKC 3W98D 5BNVB 3MGQB 3W97B 4KGCB 3MGSC 3WAAC 3IP4C 5B2IA 4HGAC 1BFMA 2AROA 3MVDC 1M1AA 4KUDC 3VH5A 5B33C 5DNMD 3AN2B 3AZIB 5JRGD 3W98B 3A6NB 4Z2MH 3X1UD 5CPID 5B0YA 5B31A 3B6FC 1P3IA 5AV6A 2F8NG 1KU5A 3P5JB 5GT3A 3NQJB 4CSRA 1JFIA 4Z5TD 5CPJB 3X1SD 2F8ND 5BO0B 5AV9B 3NQUB 3REJB 4Z66D 3KUYB 1KX3A 2CWEA 1B67A 3C1CB 2BYMA 3AZHC 1A7WA 3KWQB 1B6WA 4NFTA 3AV1D 3WTPB 2XD1A 5B2JA 3TU4B 1AOID 1P3LA 4J8VC 4H9PA 5B32G 1P3OA 3AZND 2HUEB 3UTBB 4DRBA 3O62B 5AV8D 4XUJC 3LZ0D 3REKD 5B32D 3MGPA 5BS7A 5CHLB 4JJNB 5AY8B 3KXBA 3MNNC 3X1VD 4J8UA 2G5IC 4J8XA 2CV5A 3V9RB 1P3MC 3VH6W 3AZGC 4EO5B 3AZMD 3X1TC 1P3FC 3AFAC 3LZ1A 4H9NB 2Y2MA 5KDMA 4ZUXD 4YS3D 5AVCD 3AV1A 4KHAB 4X23B 3MGQC 3W97C 3AZJB 5CPKA 1P3BA 4LD9B 1P3PD 1M19B 3WA9B 4NE6A 4WU9A 3W99A 4J8WD 4ZBJC 3AN2C 2UWXA 5B40C 3AZIC 3WKJA 2NQBD 3A6NC 3EPJA 1ID3A 1TAFB 4H9QA 2VQRA 4CSRB 4DRAA 3AZED 5AV5A 1EQZB 3AZKD 5GSUC 5CP6B 2HIOC 3W96B 3R45B 1H3OB 1S32B 1F66A 1M18A 5AV9C 4QLCA 3WTPE 4E44A 4E45A 3REJC 3VH6T 5AVBB 3AZMA 3C1CC 1ZLAB 1TZYB 5B33D 5B0ZA 3C1BB 4CAYA 3MGRB 5B1MD 4XZQC 5B24D 4AWLC 1P3GB 4R8PD 5AVCA 4H9OA 4UUZB 3WTPC 3LJAD 4WU8A 1Z2CB 2PYOC 1U35D 3TU4C 3UT9A 3B6GD 5E5AB 5B1LD 2YFVA 2F8NH 3AZLB 3AZFA 1HQ3B 2HUEC 3UTBC 4J8WA 5GXQB 3REIB 4R8PB 3AV2B 2FJ7A 5GT0B 5DNNA 2NQBA 1KX4B 5BNXA 3AYWA 2AROD 4JJNC 2Y2NA 3AZEA 2DQNC 1KX5B 3AZKA 4WZSB 5B0YD 3MGSA 3RELB 2Y2GA 5FUGB 1P3ID 5AV6D 5B2IB 1T3UA 1M1AB 2NZDB 4KUDA 5B33A 1WWIA 1P3AB 2BYKA 5B31B 1KX3D 3B6FA 4X23C 2IO5B 5GT3B 3AZJC 5F99C 3B6GA 2BG1A 4LD9C 1M19C 2Y2JA 3WA9C 1P3MD 5B2JD 3REHB 1P3LD 3AZHA 1P3OD 4WNNA 4NE3A 3UTAB 1P3KB 3MGPD 1EQZC 5CP6C 3W96C 2JCHA 1S32C 5G49B 2G5HC 4J8VA 3KXBD 4J8UD 5AVBC 2ZY3A 4J8XD 2CV5D 5DNMB 1ZLAC 3C1BC 4XUJA 5JRGB 3MGRC 5B40D 1W2EA 1P3GC 3X1UB 5CPIB 3LELC 3MNNA 3LZ1D 4DQYB 4Z5TB 5E5AC 2L5AA 1BH9B 3X1SB 2HIOD 2F8NB 3AZLC 1HQ3C 1P3MA 4YM6C 4Z66B 3H0LC 5GXQC 3REIC 3AZGA 1BH8B 3AV2C 5GT0C 5CPKD 1P3BD 2ZM5A 1KX4C 2RVQC 5C3IB 3X1TA 1P3FA 3AFAA 4WU9D 3W99D 4XZQD 3B0DC 3AV1B 2Y2PA 3WKJD 1N1JA 2Y2LA 1ID3D 3KFUG 5BNVA 1P34C 3MGQA 3W97A 1AOIB 3RELC 2PYOD 4M6BA 5AV5D 3AZNB 5AV8B 3LZ0B 2NZDC 3VH5W 3AN2A 3REKB 5B32B 5B40A 3AZIA 1M18D 1F66D 4QLCD 3A6NA 1P3AC 3A1IA 5B0ZD 3X1VB 1PZRA 5GT3C 5GSUA 2HIOA 3EPLA 4WU8D 3REHC 5AV9A 4KGCC 3REJA 3AZMB 3UT9D 4H9SC 3EG5B 3C1CA 3AZFD 4XZQA 4WV4B 3UTAC 4ZUXB 4YS3B 5AVCB 1P3KC 5DNND 2FJ7D 3W98C 3WTPA 3AYWD 2Y2IA 2PYOA 3TU4A 5F99D 2YFWA 1P3PB 4Z2MG 4J8WB 3UTBA 5DNMC 5CPJC 3MGSD 5JRGC 3VH5T 2NQBB 3WAAD 3X1UC 5CPIC 1ULYA 3KUYC 4JJNA 3MVDD 3AZEB 4KUDD 3AZKB 3KWQC 3F6TA 4Z5TC 3V9RA 3X1SC 3B6FD 4H9RA 4Z66C 5B33B 2XD5A 5C3IC 5B1MB 5B24B 3O62C 4WJ3C 3LJAB 3AZHD 4KHAA 4X23A 4G91B 1HTAA 1U35B 1AOIC 3AZJA 3A1KA 3B6GB 5F99A 5B1LB 5AY8C 4LD9A 2Y2OA 3AZNC 1M19A 3EPHA 3WA9A 3H0RC 5AV8C 4YM6D 3LZ0C 3REKC 5B32C 3WAAA 4J8VD 2AROB 2RVQD 3MVDA 4EO5C 3B0BA 4XUJD 3X1VC 1EQZA 5B0YB 1P34D 5CP6A 3W96A 3R45A 5AV6B 1P3IB 1S32A 4G92B 3MNND 5JA4A
chains in the Genus database with same CATH topology
5AVBA 3AZMC 1JFIB 1ZLAA 3C1BA 2Y2QA 3MGRA 1P3GA 3AZGD 4ZUXC 1KX3B 4YS3C 1R4VA 2BYMB 4UUZA 3LELA 3X1TD 1P3FD 3AFAD 5BT1C 2ZY2A 5E5AA 1P3PC 3AZLA 1P3MB 1HQ3A 5B2JB 4YM6A 3MGQD 3W97D 5GXQA 3REIA 4KGCD 1P3LB 3AV2A 5GT0A 4H9PB 2NQBC 1P3OB 1KX4A 1TZYC 1WWSA 3AN2D 1Q9CA 3MGPB 3AZID 3A6ND 1P34A 3RELA 5FUGA 3KXBB 4J8UB 4J8XB 2CV5B 5GSUD 2NZDA 2Y2KA 4ZBJB 5CPJD 5B40B 3VH6A 5B1MC 5B24C 5AV9D 1P3AA 3REJD 4R8PC 3KUYD 2JSSA 3LJAC 3C1CD 2ZY5A 4G91C 3LZ1B 1U35C 5GSUB 3KWQD 3B6GC 5B1LC 5KDMB 2HIOB 1KX5C 2DF4C 3WTPD 3REHA 4KGCA 5CPKB 3AL0C 3TU4D 1P3BB 4H9SA 5B2IC 1F1EA 2AROC 4WU9B 1M1AC 4XZQB 4AWLB 3W99B 3UTBD 3O62D 3UTAA 1P3KA 3WKJB 2F2AC 1ID3B 3W98A 4H9QB 5B0YC 5B31C 2PYOB 4JJND 1P3IC 5AV6C 2YFWB 2IO5C 5G49A 5AY8D 4G92C 5AV5B 3NQJA 5DNMA 5CPJA 1F66B 5JRGA 1M18B 5BO0A 4QLCB 3NQUA 3X1UA 5CPIA 1KX3C 3KUYA 5B0ZB 4CAYB 3KWQA 4Z5TA 1BH9A 4H9RB 4H9OB 3X1SA 2F8NA 4WU8B 5B2JC 4X23D 4Z66A 3UT9B 3AZJD 1P3LC 1BH8A 2YFVB 3AZFB 1P3OC 4LD9D 1M19D 3WA9D 3O62A 2FJ7B 5DNNB 3MGPC 5BS7C 5BNXB 3AYWB 1AOIA 5F99B 5BT1D 5AY8A 3KXBC 4J8UC 2LY8A 3AZNA 4J8XC 2CV5C 1EQZD 5AV8A 3LZ0A 3MGSB 5CP6D 3W96D 3REKA 5B32A 1S32D 3WAAB 4HGAB 3MVDB 5AVBD 4KUDB 1ZLAD 1TZYD 3C1BD 3X1VA 3LZ1C 3MGRD 4H9NA 2BYKB 1P3GD 3FDDA 4NE5A 3B6FB 3AV1C 3LELD 5JA4B 5CPKC 1P3BC 5E5AD 3AZLD 1HQ3D 4WU9C 3W99C 5GXQD 3REID 4ZUXA 3AV2D 4YS3A 5GT0D 3AZHB 3WKJC 3LELB 1ID3C 1KX4D 4WNNB 1TAFA 3B0CW 5AV5C 1KX5D 1P3PA 4YM6B 1F66C 3RELD 1H3OA 4J8VB 1M18C 4QLCC 5B2ID 2Y2HA 5B31G 5B0ZC 4XUJB 1M1AD 2NZDD 1TZYA 3B0DB 1P34B 1P3AD 2J8PA 5AVCC 5B31D 3H0MC 4WU8C 3MNNB 5GT3D 3UT9C 3AZFC 5B1MA 5B24A 2F8NK 4J8WC 3AZGB 3REHD 2ZY4A 2FJ7C 4R8PA 5DNNC 3EPKA 2W8SA 2RIQA 3LJAA 3X1TB 3AYWC 1P3FB 3AFAB 1U35A 2FFFB 3KSYA 2JE5A 4UPKA 3AZEC 5B1LA 3B0CT 3UTAD 1KX5A 1P3KD 1N1JB 3AZKC 3W98D 5BNVB 3MGQB 3W97B 4KGCB 3MGSC 3WAAC 3IP4C 5B2IA 4HGAC 1BFMA 2AROA 3MVDC 1M1AA 4KUDC 3VH5A 5B33C 5DNMD 3AN2B 3AZIB 5JRGD 3W98B 3A6NB 4Z2MH 3X1UD 5CPID 5B0YA 5B31A 3B6FC 1P3IA 5AV6A 2F8NG 1KU5A 3P5JB 5GT3A 3NQJB 4CSRA 1JFIA 4Z5TD 5CPJB 3X1SD 2F8ND 5BO0B 5AV9B 3NQUB 3REJB 4Z66D 3KUYB 1KX3A 2CWEA 1B67A 3C1CB 2BYMA 3AZHC 1A7WA 3KWQB 1B6WA 4NFTA 3AV1D 3WTPB 2XD1A 5B2JA 3TU4B 1AOID 1P3LA 4J8VC 4H9PA 5B32G 1P3OA 3AZND 2HUEB 3UTBB 4DRBA 3O62B 5AV8D 4XUJC 3LZ0D 3REKD 5B32D 3MGPA 5BS7A 5CHLB 4JJNB 5AY8B 3KXBA 3MNNC 3X1VD 4J8UA 2G5IC 4J8XA 2CV5A 3V9RB 1P3MC 3VH6W 3AZGC 4EO5B 3AZMD 3X1TC 1P3FC 3AFAC 3LZ1A 4H9NB 2Y2MA 5KDMA 4ZUXD 4YS3D 5AVCD 3AV1A 4KHAB 4X23B 3MGQC 3W97C 3AZJB 5CPKA 1P3BA 4LD9B 1P3PD 1M19B 3WA9B 4NE6A 4WU9A 3W99A 4J8WD 4ZBJC 3AN2C 2UWXA 5B40C 3AZIC 3WKJA 2NQBD 3A6NC 3EPJA 1ID3A 1TAFB 4H9QA 2VQRA 4CSRB 4DRAA 3AZED 5AV5A 1EQZB 3AZKD 5GSUC 5CP6B 2HIOC 3W96B 3R45B 1H3OB 1S32B 1F66A 1M18A 5AV9C 4QLCA 3WTPE 4E44A 4E45A 3REJC 3VH6T 5AVBB 3AZMA 3C1CC 1ZLAB 1TZYB 5B33D 5B0ZA 3C1BB 4CAYA 3MGRB 5B1MD 4XZQC 5B24D 4AWLC 1P3GB 4R8PD 5AVCA 4H9OA 4UUZB 3WTPC 3LJAD 4WU8A 1Z2CB 2PYOC 1U35D 3TU4C 3UT9A 3B6GD 5E5AB 5B1LD 2YFVA 2F8NH 3AZLB 3AZFA 1HQ3B 2HUEC 3UTBC 4J8WA 5GXQB 3REIB 4R8PB 3AV2B 2FJ7A 5GT0B 5DNNA 2NQBA 1KX4B 5BNXA 3AYWA 2AROD 4JJNC 2Y2NA 3AZEA 2DQNC 1KX5B 3AZKA 4WZSB 5B0YD 3MGSA 3RELB 2Y2GA 5FUGB 1P3ID 5AV6D 5B2IB 1T3UA 1M1AB 2NZDB 4KUDA 5B33A 1WWIA 1P3AB 2BYKA 5B31B 1KX3D 3B6FA 4X23C 2IO5B 5GT3B 3AZJC 5F99C 3B6GA 2BG1A 4LD9C 1M19C 2Y2JA 3WA9C 1P3MD 5B2JD 3REHB 1P3LD 3AZHA 1P3OD 4WNNA 4NE3A 3UTAB 1P3KB 3MGPD 1EQZC 5CP6C 3W96C 2JCHA 1S32C 5G49B 2G5HC 4J8VA 3KXBD 4J8UD 5AVBC 2ZY3A 4J8XD 2CV5D 5DNMB 1ZLAC 3C1BC 4XUJA 5JRGB 3MGRC 5B40D 1W2EA 1P3GC 3X1UB 5CPIB 3LELC 3MNNA 3LZ1D 4DQYB 4Z5TB 5E5AC 2L5AA 1BH9B 3X1SB 2HIOD 2F8NB 3AZLC 1HQ3C 1P3MA 4YM6C 4Z66B 3H0LC 5GXQC 3REIC 3AZGA 1BH8B 3AV2C 5GT0C 5CPKD 1P3BD 2ZM5A 1KX4C 2RVQC 5C3IB 3X1TA 1P3FA 3AFAA 4WU9D 3W99D 4XZQD 3B0DC 3AV1B 2Y2PA 3WKJD 1N1JA 2Y2LA 1ID3D 3KFUG 5BNVA 1P34C 3MGQA 3W97A 1AOIB 3RELC 2PYOD 4M6BA 5AV5D 3AZNB 5AV8B 3LZ0B 2NZDC 3VH5W 3AN2A 3REKB 5B32B 5B40A 3AZIA 1M18D 1F66D 4QLCD 3A6NA 1P3AC 3A1IA 5B0ZD 3X1VB 1PZRA 5GT3C 5GSUA 2HIOA 3EPLA 4WU8D 3REHC 5AV9A 4KGCC 3REJA 3AZMB 3UT9D 4H9SC 3EG5B 3C1CA 3AZFD 4XZQA 4WV4B 3UTAC 4ZUXB 4YS3B 5AVCB 1P3KC 5DNND 2FJ7D 3W98C 3WTPA 3AYWD 2Y2IA 2PYOA 3TU4A 5F99D 2YFWA 1P3PB 4Z2MG 4J8WB 3UTBA 5DNMC 5CPJC 3MGSD 5JRGC 3VH5T 2NQBB 3WAAD 3X1UC 5CPIC 1ULYA 3KUYC 4JJNA 3MVDD 3AZEB 4KUDD 3AZKB 3KWQC 3F6TA 4Z5TC 3V9RA 3X1SC 3B6FD 4H9RA 4Z66C 5B33B 2XD5A 5C3IC 5B1MB 5B24B 3O62C 4WJ3C 3LJAB 3AZHD 4KHAA 4X23A 4G91B 1HTAA 1U35B 1AOIC 3AZJA 3A1KA 3B6GB 5F99A 5B1LB 5AY8C 4LD9A 2Y2OA 3AZNC 1M19A 3EPHA 3WA9A 3H0RC 5AV8C 4YM6D 3LZ0C 3REKC 5B32C 3WAAA 4J8VD 2AROB 2RVQD 3MVDA 4EO5C 3B0BA 4XUJD 3X1VC 1EQZA 5B0YB 1P34D 5CP6A 3W96A 3R45A 5AV6B 1P3IB 1S32A 4G92B 3MNND 5JA4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AVB A;  3AZM C;  1JFI B;  1ZLA A;  3C1B A;  3MGR A;  1P3G A;  3AZG D;  4ZUX C;  1KX3 B;  4YS3 C;  1R4V A;  2BYM B;  4UUZ A;  3LEL A;  3X1T D;  1P3F D;  3AFA D;  5BT1 C;  5E5A A;  1P3P C;  3AZL A;  1P3M B;  1HQ3 A;  5B2J B;  4YM6 A;  3MGQ D;  3W97 D;  5GXQ A;  3REI A;  4KGC D;  1P3L B;  3AV2 A;  5GT0 A;  4H9P B;  2NQB C;  1P3O B;  1KX4 A;  1TZY C;  1WWS A;  3AN2 D;  1Q9C A;  3MGP B;  3AZI D;  3A6N D;  1P34 A;  3REL A;  5FUG A;  3KXB B;  4J8U B;  4J8X B;  2CV5 B;  5GSU D;  2NZD A;  4ZBJ B;  5CPJ D;  5B40 B;  3VH6 A;  5B1M C;  5B24 C;  5AV9 D;  1P3A A;  3REJ D;  4R8P C;  3KUY D;  2JSS A;  3LJA C;  3C1C D;  4G91 C;  3LZ1 B;  1U35 C;  5GSU B;  3KWQ D;  3B6G C;  5B1L C;  5KDM B;  2HIO B;  1KX5 C;  3WTP D;  3REH A;  4KGC A;  5CPK B;  3TU4 D;  1P3B B;  4H9S A;  5B2I C;  1F1E A;  2ARO C;  4WU9 B;  1M1A C;  4XZQ B;  4AWL B;  3W99 B;  3UTB D;  3O62 D;  3UTA A;  1P3K A;  3WKJ B;  1ID3 B;  3W98 A;  4H9Q B;  5B0Y C;  5B31 C;  2PYO B;  4JJN D;  1P3I C;  5AV6 C;  2YFW B;  2IO5 C;  5G49 A;  5AY8 D;  4G92 C;  5AV5 B;  3NQJ A;  5DNM A;  5CPJ A;  1F66 B;  5JRG A;  1M18 B;  5BO0 A;  4QLC B;  3NQU A;  3X1U A;  5CPI A;  1KX3 C;  3KUY A;  5B0Z B;  4CAY B;  3KWQ A;  4Z5T A;  1BH9 A;  4H9R B;  4H9O B;  3X1S A;  2F8N A;  4WU8 B;  5B2J C;  4X23 D;  4Z66 A;  3UT9 B;  3AZJ D;  1P3L C;  1BH8 A;  2YFV B;  3AZF B;  1P3O C;  4LD9 D;  1M19 D;  3WA9 D;  3O62 A;  2FJ7 B;  5DNN B;  3MGP C;  5BS7 C;  5BNX B;  3AYW B;  1AOI A;  5F99 B;  5BT1 D;  5AY8 A;  3KXB C;  4J8U C;  2LY8 A;  3AZN A;  4J8X C;  2CV5 C;  1EQZ D;  5AV8 A;  3LZ0 A;  3MGS B;  5CP6 D;  3W96 D;  3REK A;  5B32 A;  1S32 D;  3WAA B;  4HGA B;  3MVD B;  5AVB D;  4KUD B;  1ZLA D;  1TZY D;  3C1B D;  3X1V A;  3LZ1 C;  3MGR D;  4H9N A;  2BYK B;  1P3G D;  4NE5 A;  3B6F B;  3AV1 C;  3LEL D;  5JA4 B;  5CPK C;  1P3B C;  5E5A D;  3AZL D;  1HQ3 D;  4WU9 C;  3W99 C;  5GXQ D;  3REI D;  4ZUX A;  3AV2 D;  4YS3 A;  5GT0 D;  3AZH B;  3WKJ C;  3LEL B;  1ID3 C;  1KX4 D;  4WNN B;  1TAF A;  3B0C W;  5AV5 C;  1KX5 D;  1P3P A;  4YM6 B;  1F66 C;  3REL D;  1H3O A;  4J8V B;  1M18 C;  4QLC C;  5B2I D;  1M1A D;  5B31 G;  5B0Z C;  4XUJ B;  2NZD D;  1TZY A;  3B0D B;  1P34 B;  1P3A D;  5AVC C;  5B31 D;  4WU8 C;  3MNN B;  5GT3 D;  3UT9 C;  3AZF C;  5B1M A;  5B24 A;  2F8N K;  4J8W C;  3AZG B;  3REH D;  2FJ7 C;  4R8P A;  5DNN C;  3LJA A;  3X1T B;  3AYW C;  1P3F B;  3AFA B;  1U35 A;  3KSY A;  3AZE C;  5B1L A;  3B0C T;  3UTA D;  1KX5 A;  1P3K D;  1N1J B;  3AZK C;  3W98 D;  5BNV B;  3MGQ B;  3W97 B;  4KGC B;  3MGS C;  3WAA C;  5B2I A;  4HGA C;  1BFM A;  2ARO A;  3MVD C;  1M1A A;  4KUD C;  3VH5 A;  5B33 C;  5DNM D;  3AN2 B;  3AZI B;  5JRG D;  3W98 B;  3A6N B;  4Z2M H;  3X1U D;  5CPI D;  5B0Y A;  5B31 A;  3B6F C;  1P3I A;  5AV6 A;  2F8N G;  1KU5 A;  5GT3 A;  3NQJ B;  4CSR A;  1JFI A;  4Z5T D;  5CPJ B;  3X1S D;  2F8N D;  5BO0 B;  5AV9 B;  3NQU B;  3REJ B;  4Z66 D;  3KUY B;  1KX3 A;  2CWE A;  1B67 A;  3C1C B;  2BYM A;  3AZH C;  1A7W A;  3KWQ B;  1B6W A;  4NFT A;  3AV1 D;  3WTP B;  5B2J A;  3TU4 B;  1AOI D;  1P3L A;  4J8V C;  4H9P A;  5B32 G;  1P3O A;  3AZN D;  2HUE B;  3UTB B;  4DRB A;  3O62 B;  5AV8 D;  4XUJ C;  3LZ0 D;  3REK D;  5B32 D;  3MGP A;  5BS7 A;  5CHL B;  4JJN B;  5AY8 B;  3KXB A;  3MNN C;  3X1V D;  4J8U A;  4J8X A;  2CV5 A;  3V9R B;  1P3M C;  3VH6 W;  3AZG C;  4EO5 B;  3AZM D;  3X1T C;  1P3F C;  3AFA C;  3LZ1 A;  4H9N B;  5KDM A;  4ZUX D;  4YS3 D;  5AVC D;  3AV1 A;  4KHA B;  4X23 B;  3MGQ C;  3W97 C;  3AZJ B;  5CPK A;  1P3B A;  4LD9 B;  1P3P D;  1M19 B;  3WA9 B;  4NE6 A;  4WU9 A;  3W99 A;  4J8W D;  4ZBJ C;  3AN2 C;  5B40 C;  3AZI C;  3WKJ A;  2NQB D;  3A6N C;  1ID3 A;  1TAF B;  4H9Q A;  4CSR B;  4DRA A;  3AZE D;  5AV5 A;  1EQZ B;  3AZK D;  5GSU C;  5CP6 B;  2HIO C;  3W96 B;  3R45 B;  1H3O B;  1S32 B;  1F66 A;  1M18 A;  3WTP E;  5AV9 C;  4QLC A;  4E44 A;  4E45 A;  3REJ C;  3VH6 T;  5AVB B;  3AZM A;  3C1C C;  1ZLA B;  1TZY B;  5B33 D;  5B0Z A;  3C1B B;  4CAY A;  3MGR B;  5B1M D;  4XZQ C;  5B24 D;  4AWL C;  1P3G B;  4R8P D;  5AVC A;  4H9O A;  4UUZ B;  3WTP C;  3LJA D;  4WU8 A;  2PYO C;  1U35 D;  3TU4 C;  3UT9 A;  3B6G D;  5E5A B;  5B1L D;  2YFV A;  2F8N H;  3AZL B;  3AZF A;  1HQ3 B;  2HUE C;  3UTB C;  4J8W A;  5GXQ B;  3REI B;  4R8P B;  3AV2 B;  2FJ7 A;  5GT0 B;  5DNN A;  2NQB A;  1KX4 B;  5BNX A;  3AYW A;  2ARO D;  4JJN C;  3AZE A;  1KX5 B;  3AZK A;  4WZS B;  5B0Y D;  3MGS A;  3REL B;  5FUG B;  1P3I D;  5AV6 D;  5B2I B;  1M1A B;  2NZD B;  4KUD A;  5B33 A;  1WWI A;  1P3A B;  2BYK A;  5B31 B;  1KX3 D;  3B6F A;  4X23 C;  2IO5 B;  5GT3 B;  3AZJ C;  5F99 C;  3B6G A;  4LD9 C;  1M19 C;  3WA9 C;  1P3M D;  5B2J D;  3REH B;  1P3L D;  3AZH A;  1P3O D;  4WNN A;  4NE3 A;  3UTA B;  1P3K B;  3MGP D;  1EQZ C;  5CP6 C;  3W96 C;  1S32 C;  5G49 B;  4J8V A;  3KXB D;  4J8U D;  5AVB C;  4J8X D;  2CV5 D;  5DNM B;  1ZLA C;  3C1B C;  4XUJ A;  5JRG B;  3MGR C;  5B40 D;  1P3G C;  3X1U B;  5CPI B;  3LEL C;  3MNN A;  3LZ1 D;  4Z5T B;  5E5A C;  2L5A A;  1BH9 B;  3X1S B;  2HIO D;  2F8N B;  3AZL C;  1HQ3 C;  1P3M A;  4YM6 C;  4Z66 B;  5GXQ C;  3REI C;  3AZG A;  1BH8 B;  3AV2 C;  5GT0 C;  5CPK D;  1P3B D;  1KX4 C;  2RVQ C;  5C3I B;  3X1T A;  1P3F A;  3AFA A;  4WU9 D;  3W99 D;  4XZQ D;  3B0D C;  3AV1 B;  3WKJ D;  1N1J A;  1ID3 D;  5BNV A;  1P34 C;  3MGQ A;  3W97 A;  1AOI B;  3REL C;  2PYO D;  4M6B A;  5AV5 D;  3AZN B;  5AV8 B;  3LZ0 B;  2NZD C;  3VH5 W;  3AN2 A;  3REK B;  5B32 B;  5B40 A;  3AZI A;  1M18 D;  1F66 D;  4QLC D;  3A6N A;  1P3A C;  5B0Z D;  3X1V B;  5GT3 C;  5GSU A;  2HIO A;  4WU8 D;  3REH C;  5AV9 A;  4KGC C;  3REJ A;  3AZM B;  3UT9 D;  4H9S C;  3C1C A;  3AZF D;  4XZQ A;  4WV4 B;  3UTA C;  4ZUX B;  4YS3 B;  5AVC B;  1P3K C;  5DNN D;  2FJ7 D;  3W98 C;  3WTP A;  3AYW D;  2PYO A;  3TU4 A;  5F99 D;  2YFW A;  1P3P B;  4Z2M G;  4J8W B;  3UTB A;  5DNM C;  5CPJ C;  3MGS D;  5JRG C;  3VH5 T;  2NQB B;  3WAA D;  3X1U C;  5CPI C;  1ULY A;  3KUY C;  4JJN A;  3MVD D;  3AZE B;  4KUD D;  3AZK B;  3KWQ C;  4Z5T C;  3V9R A;  3X1S C;  3B6F D;  4H9R A;  4Z66 C;  5B33 B;  5C3I C;  5B1M B;  5B24 B;  3O62 C;  3LJA B;  3AZH D;  4KHA A;  4X23 A;  4G91 B;  1HTA A;  1U35 B;  1AOI C;  3AZJ A;  3B6G B;  5F99 A;  5B1L B;  5AY8 C;  4LD9 A;  3AZN C;  1M19 A;  3WA9 A;  5AV8 C;  3LZ0 C;  4YM6 D;  3REK C;  5B32 C;  3WAA A;  4J8V D;  2ARO B;  2RVQ D;  3MVD A;  4EO5 C;  3B0B A;  4XUJ D;  3X1V C;  1EQZ A;  5B0Y B;  1P34 D;  5CP6 A;  3W96 A;  3R45 A;  5AV6 B;  1P3I B;  1S32 A;  4G92 B;  3MNN D;  5JA4 A; 
#chains in the Genus database with same CATH topology
 5AVB A;  3AZM C;  1JFI B;  1ZLA A;  3C1B A;  2Y2Q A;  3MGR A;  1P3G A;  3AZG D;  4ZUX C;  1KX3 B;  4YS3 C;  1R4V A;  2BYM B;  4UUZ A;  3LEL A;  3X1T D;  1P3F D;  3AFA D;  5BT1 C;  2ZY2 A;  5E5A A;  1P3P C;  3AZL A;  1P3M B;  1HQ3 A;  5B2J B;  4YM6 A;  3MGQ D;  3W97 D;  5GXQ A;  3REI A;  4KGC D;  1P3L B;  3AV2 A;  5GT0 A;  4H9P B;  2NQB C;  1P3O B;  1KX4 A;  1TZY C;  1WWS A;  3AN2 D;  1Q9C A;  3MGP B;  3AZI D;  3A6N D;  1P34 A;  3REL A;  5FUG A;  3KXB B;  4J8U B;  4J8X B;  2CV5 B;  5GSU D;  2NZD A;  2Y2K A;  4ZBJ B;  5CPJ D;  5B40 B;  3VH6 A;  5B1M C;  5B24 C;  5AV9 D;  1P3A A;  3REJ D;  4R8P C;  3KUY D;  2JSS A;  3LJA C;  3C1C D;  2ZY5 A;  4G91 C;  3LZ1 B;  1U35 C;  5GSU B;  3KWQ D;  3B6G C;  5B1L C;  5KDM B;  2HIO B;  1KX5 C;  2DF4 C;  3WTP D;  3REH A;  4KGC A;  5CPK B;  3AL0 C;  3TU4 D;  1P3B B;  4H9S A;  5B2I C;  1F1E A;  2ARO C;  4WU9 B;  1M1A C;  4XZQ B;  4AWL B;  3W99 B;  3UTB D;  3O62 D;  3UTA A;  1P3K A;  3WKJ B;  2F2A C;  1ID3 B;  3W98 A;  4H9Q B;  5B0Y C;  5B31 C;  2PYO B;  4JJN D;  1P3I C;  5AV6 C;  2YFW B;  2IO5 C;  5G49 A;  5AY8 D;  4G92 C;  5AV5 B;  3NQJ A;  5DNM A;  5CPJ A;  1F66 B;  5JRG A;  1M18 B;  5BO0 A;  4QLC B;  3NQU A;  3X1U A;  5CPI A;  1KX3 C;  3KUY A;  5B0Z B;  4CAY B;  3KWQ A;  4Z5T A;  1BH9 A;  4H9R B;  4H9O B;  3X1S A;  2F8N A;  4WU8 B;  5B2J C;  4X23 D;  4Z66 A;  3UT9 B;  3AZJ D;  1P3L C;  1BH8 A;  2YFV B;  3AZF B;  1P3O C;  4LD9 D;  1M19 D;  3WA9 D;  3O62 A;  2FJ7 B;  5DNN B;  3MGP C;  5BS7 C;  5BNX B;  3AYW B;  1AOI A;  5F99 B;  5BT1 D;  5AY8 A;  3KXB C;  4J8U C;  2LY8 A;  3AZN A;  4J8X C;  2CV5 C;  1EQZ D;  5AV8 A;  3LZ0 A;  3MGS B;  5CP6 D;  3W96 D;  3REK A;  5B32 A;  1S32 D;  3WAA B;  4HGA B;  3MVD B;  5AVB D;  4KUD B;  1ZLA D;  1TZY D;  3C1B D;  3X1V A;  3LZ1 C;  3MGR D;  4H9N A;  2BYK B;  1P3G D;  3FDD A;  4NE5 A;  3B6F B;  3AV1 C;  3LEL D;  5JA4 B;  5CPK C;  1P3B C;  5E5A D;  3AZL D;  1HQ3 D;  4WU9 C;  3W99 C;  5GXQ D;  3REI D;  4ZUX A;  3AV2 D;  4YS3 A;  5GT0 D;  3AZH B;  3WKJ C;  3LEL B;  1ID3 C;  1KX4 D;  4WNN B;  1TAF A;  3B0C W;  5AV5 C;  1KX5 D;  1P3P A;  4YM6 B;  1F66 C;  3REL D;  1H3O A;  4J8V B;  1M18 C;  4QLC C;  5B2I D;  2Y2H A;  5B31 G;  5B0Z C;  4XUJ B;  1M1A D;  2NZD D;  1TZY A;  3B0D B;  1P34 B;  1P3A D;  2J8P A;  5AVC C;  5B31 D;  3H0M C;  4WU8 C;  3MNN B;  5GT3 D;  3UT9 C;  3AZF C;  5B1M A;  5B24 A;  2F8N K;  4J8W C;  3AZG B;  3REH D;  2ZY4 A;  2FJ7 C;  4R8P A;  5DNN C;  3EPK A;  2W8S A;  2RIQ A;  3LJA A;  3X1T B;  3AYW C;  1P3F B;  3AFA B;  1U35 A;  2FFF B;  3KSY A;  2JE5 A;  4UPK A;  3AZE C;  5B1L A;  3B0C T;  3UTA D;  1KX5 A;  1P3K D;  1N1J B;  3AZK C;  3W98 D;  5BNV B;  3MGQ B;  3W97 B;  4KGC B;  3MGS C;  3WAA C;  3IP4 C;  5B2I A;  4HGA C;  1BFM A;  2ARO A;  3MVD C;  1M1A A;  4KUD C;  3VH5 A;  5B33 C;  5DNM D;  3AN2 B;  3AZI B;  5JRG D;  3W98 B;  3A6N B;  4Z2M H;  3X1U D;  5CPI D;  5B0Y A;  5B31 A;  3B6F C;  1P3I A;  5AV6 A;  2F8N G;  1KU5 A;  3P5J B;  5GT3 A;  3NQJ B;  4CSR A;  1JFI A;  4Z5T D;  5CPJ B;  3X1S D;  2F8N D;  5BO0 B;  5AV9 B;  3NQU B;  3REJ B;  4Z66 D;  3KUY B;  1KX3 A;  2CWE A;  1B67 A;  3C1C B;  2BYM A;  3AZH C;  1A7W A;  3KWQ B;  1B6W A;  4NFT A;  3AV1 D;  3WTP B;  2XD1 A;  5B2J A;  3TU4 B;  1AOI D;  1P3L A;  4J8V C;  4H9P A;  5B32 G;  1P3O A;  3AZN D;  2HUE B;  3UTB B;  4DRB A;  3O62 B;  5AV8 D;  4XUJ C;  3LZ0 D;  3REK D;  5B32 D;  3MGP A;  5BS7 A;  5CHL B;  4JJN B;  5AY8 B;  3KXB A;  3MNN C;  3X1V D;  4J8U A;  2G5I C;  4J8X A;  2CV5 A;  3V9R B;  1P3M C;  3VH6 W;  3AZG C;  4EO5 B;  3AZM D;  3X1T C;  1P3F C;  3AFA C;  3LZ1 A;  4H9N B;  2Y2M A;  5KDM A;  4ZUX D;  4YS3 D;  5AVC D;  3AV1 A;  4KHA B;  4X23 B;  3MGQ C;  3W97 C;  3AZJ B;  5CPK A;  1P3B A;  4LD9 B;  1P3P D;  1M19 B;  3WA9 B;  4NE6 A;  4WU9 A;  3W99 A;  4J8W D;  4ZBJ C;  3AN2 C;  2UWX A;  5B40 C;  3AZI C;  3WKJ A;  2NQB D;  3A6N C;  3EPJ A;  1ID3 A;  1TAF B;  4H9Q A;  2VQR A;  4CSR B;  4DRA A;  3AZE D;  5AV5 A;  1EQZ B;  3AZK D;  5GSU C;  5CP6 B;  2HIO C;  3W96 B;  3R45 B;  1H3O B;  1S32 B;  1F66 A;  1M18 A;  5AV9 C;  4QLC A;  3WTP E;  4E44 A;  4E45 A;  3REJ C;  3VH6 T;  5AVB B;  3AZM A;  3C1C C;  1ZLA B;  1TZY B;  5B33 D;  5B0Z A;  3C1B B;  4CAY A;  3MGR B;  5B1M D;  4XZQ C;  5B24 D;  4AWL C;  1P3G B;  4R8P D;  5AVC A;  4H9O A;  4UUZ B;  3WTP C;  3LJA D;  4WU8 A;  1Z2C B;  2PYO C;  1U35 D;  3TU4 C;  3UT9 A;  3B6G D;  5E5A B;  5B1L D;  2YFV A;  2F8N H;  3AZL B;  3AZF A;  1HQ3 B;  2HUE C;  3UTB C;  4J8W A;  5GXQ B;  3REI B;  4R8P B;  3AV2 B;  2FJ7 A;  5GT0 B;  5DNN A;  2NQB A;  1KX4 B;  5BNX A;  3AYW A;  2ARO D;  4JJN C;  2Y2N A;  3AZE A;  2DQN C;  1KX5 B;  3AZK A;  4WZS B;  5B0Y D;  3MGS A;  3REL B;  2Y2G A;  5FUG B;  1P3I D;  5AV6 D;  5B2I B;  1T3U A;  1M1A B;  2NZD B;  4KUD A;  5B33 A;  1WWI A;  1P3A B;  2BYK A;  5B31 B;  1KX3 D;  3B6F A;  4X23 C;  2IO5 B;  5GT3 B;  3AZJ C;  5F99 C;  3B6G A;  2BG1 A;  4LD9 C;  1M19 C;  2Y2J A;  3WA9 C;  1P3M D;  5B2J D;  3REH B;  1P3L D;  3AZH A;  1P3O D;  4WNN A;  4NE3 A;  3UTA B;  1P3K B;  3MGP D;  1EQZ C;  5CP6 C;  3W96 C;  2JCH A;  1S32 C;  5G49 B;  2G5H C;  4J8V A;  3KXB D;  4J8U D;  5AVB C;  2ZY3 A;  4J8X D;  2CV5 D;  5DNM B;  1ZLA C;  3C1B C;  4XUJ A;  5JRG B;  3MGR C;  5B40 D;  1W2E A;  1P3G C;  3X1U B;  5CPI B;  3LEL C;  3MNN A;  3LZ1 D;  4DQY B;  4Z5T B;  5E5A C;  2L5A A;  1BH9 B;  3X1S B;  2HIO D;  2F8N B;  3AZL C;  1HQ3 C;  1P3M A;  4YM6 C;  4Z66 B;  3H0L C;  5GXQ C;  3REI C;  3AZG A;  1BH8 B;  3AV2 C;  5GT0 C;  5CPK D;  1P3B D;  2ZM5 A;  1KX4 C;  2RVQ C;  5C3I B;  3X1T A;  1P3F A;  3AFA A;  4WU9 D;  3W99 D;  4XZQ D;  3B0D C;  3AV1 B;  2Y2P A;  3WKJ D;  1N1J A;  2Y2L A;  1ID3 D;  3KFU G;  5BNV A;  1P34 C;  3MGQ A;  3W97 A;  1AOI B;  3REL C;  2PYO D;  4M6B A;  5AV5 D;  3AZN B;  5AV8 B;  3LZ0 B;  2NZD C;  3VH5 W;  3AN2 A;  3REK B;  5B32 B;  5B40 A;  3AZI A;  1M18 D;  1F66 D;  4QLC D;  3A6N A;  1P3A C;  3A1I A;  5B0Z D;  3X1V B;  1PZR A;  5GT3 C;  5GSU A;  2HIO A;  3EPL A;  4WU8 D;  3REH C;  5AV9 A;  4KGC C;  3REJ A;  3AZM B;  3UT9 D;  4H9S C;  3EG5 B;  3C1C A;  3AZF D;  4XZQ A;  4WV4 B;  3UTA C;  4ZUX B;  4YS3 B;  5AVC B;  1P3K C;  5DNN D;  2FJ7 D;  3W98 C;  3WTP A;  3AYW D;  2Y2I A;  2PYO A;  3TU4 A;  5F99 D;  2YFW A;  1P3P B;  4Z2M G;  4J8W B;  3UTB A;  5DNM C;  5CPJ C;  3MGS D;  5JRG C;  3VH5 T;  2NQB B;  3WAA D;  3X1U C;  5CPI C;  1ULY A;  3KUY C;  4JJN A;  3MVD D;  3AZE B;  4KUD D;  3AZK B;  3KWQ C;  3F6T A;  4Z5T C;  3V9R A;  3X1S C;  3B6F D;  4H9R A;  4Z66 C;  5B33 B;  2XD5 A;  5C3I C;  5B1M B;  5B24 B;  3O62 C;  4WJ3 C;  3LJA B;  3AZH D;  4KHA A;  4X23 A;  4G91 B;  1HTA A;  1U35 B;  1AOI C;  3AZJ A;  3A1K A;  3B6G B;  5F99 A;  5B1L B;  5AY8 C;  4LD9 A;  2Y2O A;  3AZN C;  1M19 A;  3EPH A;  3WA9 A;  3H0R C;  5AV8 C;  4YM6 D;  3LZ0 C;  3REK C;  5B32 C;  3WAA A;  4J8V D;  2ARO B;  2RVQ D;  3MVD A;  4EO5 C;  3B0B A;  4XUJ D;  3X1V C;  1EQZ A;  5B0Y B;  1P34 D;  5CP6 A;  3W96 A;  3R45 A;  5AV6 B;  1P3I B;  1S32 A;  4G92 B;  3MNN D;  5JA4 A; 
#chains in the Genus database with same CATH homology
 5AVB A;  3AZM C;  1JFI B;  1ZLA A;  3C1B A;  2Y2Q A;  3MGR A;  1P3G A;  3AZG D;  4ZUX C;  1KX3 B;  4YS3 C;  1R4V A;  2BYM B;  4UUZ A;  3LEL A;  3X1T D;  1P3F D;  3AFA D;  5BT1 C;  2ZY2 A;  5E5A A;  1P3P C;  3AZL A;  1P3M B;  1HQ3 A;  5B2J B;  4YM6 A;  3MGQ D;  3W97 D;  5GXQ A;  3REI A;  4KGC D;  1P3L B;  3AV2 A;  5GT0 A;  4H9P B;  2NQB C;  1P3O B;  1KX4 A;  1TZY C;  1WWS A;  3AN2 D;  1Q9C A;  3MGP B;  3AZI D;  3A6N D;  1P34 A;  3REL A;  5FUG A;  3KXB B;  4J8U B;  4J8X B;  2CV5 B;  5GSU D;  2NZD A;  2Y2K A;  4ZBJ B;  5CPJ D;  5B40 B;  3VH6 A;  5B1M C;  5B24 C;  5AV9 D;  1P3A A;  3REJ D;  4R8P C;  3KUY D;  2JSS A;  3LJA C;  3C1C D;  2ZY5 A;  4G91 C;  3LZ1 B;  1U35 C;  5GSU B;  3KWQ D;  3B6G C;  5B1L C;  5KDM B;  2HIO B;  1KX5 C;  2DF4 C;  3WTP D;  3REH A;  4KGC A;  5CPK B;  3AL0 C;  3TU4 D;  1P3B B;  4H9S A;  5B2I C;  1F1E A;  2ARO C;  4WU9 B;  1M1A C;  4XZQ B;  4AWL B;  3W99 B;  3UTB D;  3O62 D;  3UTA A;  1P3K A;  3WKJ B;  2F2A C;  1ID3 B;  3W98 A;  4H9Q B;  5B0Y C;  5B31 C;  2PYO B;  4JJN D;  1P3I C;  5AV6 C;  2YFW B;  2IO5 C;  5G49 A;  5AY8 D;  4G92 C;  5AV5 B;  3NQJ A;  5DNM A;  5CPJ A;  1F66 B;  5JRG A;  1M18 B;  5BO0 A;  4QLC B;  3NQU A;  3X1U A;  5CPI A;  1KX3 C;  3KUY A;  5B0Z B;  4CAY B;  3KWQ A;  4Z5T A;  1BH9 A;  4H9R B;  4H9O B;  3X1S A;  2F8N A;  4WU8 B;  5B2J C;  4X23 D;  4Z66 A;  3UT9 B;  3AZJ D;  1P3L C;  1BH8 A;  2YFV B;  3AZF B;  1P3O C;  4LD9 D;  1M19 D;  3WA9 D;  3O62 A;  2FJ7 B;  5DNN B;  3MGP C;  5BS7 C;  5BNX B;  3AYW B;  1AOI A;  5F99 B;  5BT1 D;  5AY8 A;  3KXB C;  4J8U C;  2LY8 A;  3AZN A;  4J8X C;  2CV5 C;  1EQZ D;  5AV8 A;  3LZ0 A;  3MGS B;  5CP6 D;  3W96 D;  3REK A;  5B32 A;  1S32 D;  3WAA B;  4HGA B;  3MVD B;  5AVB D;  4KUD B;  1ZLA D;  1TZY D;  3C1B D;  3X1V A;  3LZ1 C;  3MGR D;  4H9N A;  2BYK B;  1P3G D;  3FDD A;  4NE5 A;  3B6F B;  3AV1 C;  3LEL D;  5JA4 B;  5CPK C;  1P3B C;  5E5A D;  3AZL D;  1HQ3 D;  4WU9 C;  3W99 C;  5GXQ D;  3REI D;  4ZUX A;  3AV2 D;  4YS3 A;  5GT0 D;  3AZH B;  3WKJ C;  3LEL B;  1ID3 C;  1KX4 D;  4WNN B;  1TAF A;  3B0C W;  5AV5 C;  1KX5 D;  1P3P A;  4YM6 B;  1F66 C;  3REL D;  1H3O A;  4J8V B;  1M18 C;  4QLC C;  5B2I D;  2Y2H A;  5B31 G;  5B0Z C;  4XUJ B;  1M1A D;  2NZD D;  1TZY A;  3B0D B;  1P34 B;  1P3A D;  2J8P A;  5AVC C;  5B31 D;  3H0M C;  4WU8 C;  3MNN B;  5GT3 D;  3UT9 C;  3AZF C;  5B1M A;  5B24 A;  2F8N K;  4J8W C;  3AZG B;  3REH D;  2ZY4 A;  2FJ7 C;  4R8P A;  5DNN C;  3EPK A;  2W8S A;  2RIQ A;  3LJA A;  3X1T B;  3AYW C;  1P3F B;  3AFA B;  1U35 A;  2FFF B;  3KSY A;  2JE5 A;  4UPK A;  3AZE C;  5B1L A;  3B0C T;  3UTA D;  1KX5 A;  1P3K D;  1N1J B;  3AZK C;  3W98 D;  5BNV B;  3MGQ B;  3W97 B;  4KGC B;  3MGS C;  3WAA C;  3IP4 C;  5B2I A;  4HGA C;  1BFM A;  2ARO A;  3MVD C;  1M1A A;  4KUD C;  3VH5 A;  5B33 C;  5DNM D;  3AN2 B;  3AZI B;  5JRG D;  3W98 B;  3A6N B;  4Z2M H;  3X1U D;  5CPI D;  5B0Y A;  5B31 A;  3B6F C;  1P3I A;  5AV6 A;  2F8N G;  1KU5 A;  3P5J B;  5GT3 A;  3NQJ B;  4CSR A;  1JFI A;  4Z5T D;  5CPJ B;  3X1S D;  2F8N D;  5BO0 B;  5AV9 B;  3NQU B;  3REJ B;  4Z66 D;  3KUY B;  1KX3 A;  2CWE A;  1B67 A;  3C1C B;  2BYM A;  3AZH C;  1A7W A;  3KWQ B;  1B6W A;  4NFT A;  3AV1 D;  3WTP B;  2XD1 A;  5B2J A;  3TU4 B;  1AOI D;  1P3L A;  4J8V C;  4H9P A;  5B32 G;  1P3O A;  3AZN D;  2HUE B;  3UTB B;  4DRB A;  3O62 B;  5AV8 D;  4XUJ C;  3LZ0 D;  3REK D;  5B32 D;  3MGP A;  5BS7 A;  5CHL B;  4JJN B;  5AY8 B;  3KXB A;  3MNN C;  3X1V D;  4J8U A;  2G5I C;  4J8X A;  2CV5 A;  3V9R B;  1P3M C;  3VH6 W;  3AZG C;  4EO5 B;  3AZM D;  3X1T C;  1P3F C;  3AFA C;  3LZ1 A;  4H9N B;  2Y2M A;  5KDM A;  4ZUX D;  4YS3 D;  5AVC D;  3AV1 A;  4KHA B;  4X23 B;  3MGQ C;  3W97 C;  3AZJ B;  5CPK A;  1P3B A;  4LD9 B;  1P3P D;  1M19 B;  3WA9 B;  4NE6 A;  4WU9 A;  3W99 A;  4J8W D;  4ZBJ C;  3AN2 C;  2UWX A;  5B40 C;  3AZI C;  3WKJ A;  2NQB D;  3A6N C;  3EPJ A;  1ID3 A;  1TAF B;  4H9Q A;  2VQR A;  4CSR B;  4DRA A;  3AZE D;  5AV5 A;  1EQZ B;  3AZK D;  5GSU C;  5CP6 B;  2HIO C;  3W96 B;  3R45 B;  1H3O B;  1S32 B;  1F66 A;  1M18 A;  5AV9 C;  4QLC A;  3WTP E;  4E44 A;  4E45 A;  3REJ C;  3VH6 T;  5AVB B;  3AZM A;  3C1C C;  1ZLA B;  1TZY B;  5B33 D;  5B0Z A;  3C1B B;  4CAY A;  3MGR B;  5B1M D;  4XZQ C;  5B24 D;  4AWL C;  1P3G B;  4R8P D;  5AVC A;  4H9O A;  4UUZ B;  3WTP C;  3LJA D;  4WU8 A;  1Z2C B;  2PYO C;  1U35 D;  3TU4 C;  3UT9 A;  3B6G D;  5E5A B;  5B1L D;  2YFV A;  2F8N H;  3AZL B;  3AZF A;  1HQ3 B;  2HUE C;  3UTB C;  4J8W A;  5GXQ B;  3REI B;  4R8P B;  3AV2 B;  2FJ7 A;  5GT0 B;  5DNN A;  2NQB A;  1KX4 B;  5BNX A;  3AYW A;  2ARO D;  4JJN C;  2Y2N A;  3AZE A;  2DQN C;  1KX5 B;  3AZK A;  4WZS B;  5B0Y D;  3MGS A;  3REL B;  2Y2G A;  5FUG B;  1P3I D;  5AV6 D;  5B2I B;  1T3U A;  1M1A B;  2NZD B;  4KUD A;  5B33 A;  1WWI A;  1P3A B;  2BYK A;  5B31 B;  1KX3 D;  3B6F A;  4X23 C;  2IO5 B;  5GT3 B;  3AZJ C;  5F99 C;  3B6G A;  2BG1 A;  4LD9 C;  1M19 C;  2Y2J A;  3WA9 C;  1P3M D;  5B2J D;  3REH B;  1P3L D;  3AZH A;  1P3O D;  4WNN A;  4NE3 A;  3UTA B;  1P3K B;  3MGP D;  1EQZ C;  5CP6 C;  3W96 C;  2JCH A;  1S32 C;  5G49 B;  2G5H C;  4J8V A;  3KXB D;  4J8U D;  5AVB C;  2ZY3 A;  4J8X D;  2CV5 D;  5DNM B;  1ZLA C;  3C1B C;  4XUJ A;  5JRG B;  3MGR C;  5B40 D;  1W2E A;  1P3G C;  3X1U B;  5CPI B;  3LEL C;  3MNN A;  3LZ1 D;  4DQY B;  4Z5T B;  5E5A C;  2L5A A;  1BH9 B;  3X1S B;  2HIO D;  2F8N B;  3AZL C;  1HQ3 C;  1P3M A;  4YM6 C;  4Z66 B;  3H0L C;  5GXQ C;  3REI C;  3AZG A;  1BH8 B;  3AV2 C;  5GT0 C;  5CPK D;  1P3B D;  2ZM5 A;  1KX4 C;  2RVQ C;  5C3I B;  3X1T A;  1P3F A;  3AFA A;  4WU9 D;  3W99 D;  4XZQ D;  3B0D C;  3AV1 B;  2Y2P A;  3WKJ D;  1N1J A;  2Y2L A;  1ID3 D;  3KFU G;  5BNV A;  1P34 C;  3MGQ A;  3W97 A;  1AOI B;  3REL C;  2PYO D;  4M6B A;  5AV5 D;  3AZN B;  5AV8 B;  3LZ0 B;  2NZD C;  3VH5 W;  3AN2 A;  3REK B;  5B32 B;  5B40 A;  3AZI A;  1M18 D;  1F66 D;  4QLC D;  3A6N A;  1P3A C;  3A1I A;  5B0Z D;  3X1V B;  1PZR A;  5GT3 C;  5GSU A;  2HIO A;  3EPL A;  4WU8 D;  3REH C;  5AV9 A;  4KGC C;  3REJ A;  3AZM B;  3UT9 D;  4H9S C;  3EG5 B;  3C1C A;  3AZF D;  4XZQ A;  4WV4 B;  3UTA C;  4ZUX B;  4YS3 B;  5AVC B;  1P3K C;  5DNN D;  2FJ7 D;  3W98 C;  3WTP A;  3AYW D;  2Y2I A;  2PYO A;  3TU4 A;  5F99 D;  2YFW A;  1P3P B;  4Z2M G;  4J8W B;  3UTB A;  5DNM C;  5CPJ C;  3MGS D;  5JRG C;  3VH5 T;  2NQB B;  3WAA D;  3X1U C;  5CPI C;  1ULY A;  3KUY C;  4JJN A;  3MVD D;  3AZE B;  4KUD D;  3AZK B;  3KWQ C;  3F6T A;  4Z5T C;  3V9R A;  3X1S C;  3B6F D;  4H9R A;  4Z66 C;  5B33 B;  2XD5 A;  5C3I C;  5B1M B;  5B24 B;  3O62 C;  4WJ3 C;  3LJA B;  3AZH D;  4KHA A;  4X23 A;  4G91 B;  1HTA A;  1U35 B;  1AOI C;  3AZJ A;  3A1K A;  3B6G B;  5F99 A;  5B1L B;  5AY8 C;  4LD9 A;  2Y2O A;  3AZN C;  1M19 A;  3EPH A;  3WA9 A;  3H0R C;  5AV8 C;  4YM6 D;  3LZ0 C;  3REK C;  5B32 C;  3WAA A;  4J8V D;  2ARO B;  2RVQ D;  3MVD A;  4EO5 C;  3B0B A;  4XUJ D;  3X1V C;  1EQZ A;  5B0Y B;  1P34 D;  5CP6 A;  3W96 A;  3R45 A;  5AV6 B;  1P3I B;  1S32 A;  4G92 B;  3MNN D;  5JA4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...