3REHD

2.5 angstrom crystal structure of the nucleosome core particle assembled with a 145 bp alpha-satellite dna (ncp145)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
95
structure length
95
Chain Sequence
KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Specific DNA structural attributes modulate platinum anticancer drug site selection and cross-link generation.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
molecule keywords Histone H3.2
total genus 39
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-04-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3rehD00
5KDMB 3LJAC 5GT0A 3WTPB 5BS7A 3W96A 3UTBA 1P3MB 3MGRB 4KGCC 3W98A 4ZBJB 1P3PB 2NQBC 1R4VA 1TAFA 1P3PD 3AZMD 3AZJD 1KX3C 5AVBA 3X1SC 4J8XA 1KX4C 5CPIA 4EO5B 5DNMB 1S32A 4Z5TA 3C1CB 4J8WA 1EQZC 3NQJA 5B1LD 3TU4A 3AZEB 2HUEB 3X1TD 5B1LB 3LELB 3AZED 5AV6B 5AV9B 3LELD 3A6NC 5AV8C 1ID3C 3AZKA 2BYKA 3AZKC 5B1LC 2NZDC 3B0DB 3V9RB 2YFWB 1ZLAD 1F66B 3AZHC 3AV1C 5B1MA 1P34C 3B0CT 2CV5D 1S32C 1M18C 4J8UA 1BH8B 3LZ1D 3MGPB 3X1UC 1P3ID 5GXQC 1BH9A 2NQBB 3UT9B 5GXQA 5AVCD 1P3KB 4Z66A 1P3MC 1ZLAA 3WTPC 5GT3D 5B32G 3MGSA 1U35C 1KX5A 1M19C 2NQBD 4QLCA 3B6GA 4J8WC 5FUGB 1HQ3D 1P3IC 3REID 5AY8B 3C1CC 1TZYB 4CSRA 3AZID 1EQZB 1HQ3B 3C1BA 4WU9B 4H9SC 1KX4B 5AV5C 3AFAD 3AZGA 1AOIA 4WU9D 1P3GD 3MGSD 3AZLB 3KUYB 4G91C 1N1JB 3AFAB 3B6GD 3MGRD 5B2IB 1P3GB 4J8XC 3VH6T 5F99B 3UTAC 5BNXB 5B2ID 3W97A 5DNMA 3AN2A 1JFIB 3REHB 4QLCC 5BO0B 1B6WA 2F8NH 3AYWC 2CV5C 5B2IC 4KGCD 2BYMB 3AZMA 4G91B 3B0CW 3RELD 5B2JB 3X1UD 3O62C 5CPKA 5AVCC 4ZUXB 3AYWB 2YFVA 4NE5A 4J8WB 3NQJB 4NFTA 3AZEA 2AROB 4LD9A 1U35B 3O62D 3AZNB 3AZFC 2AROD 3MNNB 4XUJB 5B0ZB 4WU8B 3AZIC 3MNND 4NE3A 5CP6A 1P3GC 1ID3D 3KUYC 5B0YB 4DRAA 1P3LB 3B6FB 5AV5B 1M1AA 3AZJA 3NQUA 1P3KD 4JJNB 3O62A 5CPKC 1P3LD 3B6FD 3B0DC 5C3IB 3LZ1A 4JJND 4H9RA 3WKJB 3UTAD 1S32D 3X1SD 3LJAA 1M19B 3MGPA 5AV9C 5B33C 1BH9B 2NQBA 3W98C 5GXQB 4H9QB 3AV2C 1P3KA 2L5AA 3MGSB 3WAAD 3MGQC 5C3IC 4YS3C 3UTAA 5B24C 3X1VC 2CWEA 3X1VA 4Z5TC 1EQZA 2FJ7A 5GSUB 3AV1B 3C1BB 1P3BC 4KUDB 4YS3B 1KX3B 5G49A 3AZGB 1AOIB 2NZDB 5E5AD 3MGQB 3AZFD 4J8VA 3MGSC 3KUYA 4G92C 3VH6W 3AV2B 2F8NA 3VH5A 3MGRC 4KGCB 3AZFB 3AZNC 4H9PA 5B31D 2AROC 5BT1C 3AN2D 5JA4B 5AVCA 3AN2B 2HUEC 1JFIA 1P34A 5BO0A 4QLCD 3R45B 1WWSA 3REJA 5B40A 3AZHA 3KXBB 4JJNC 2F8ND 5CPJA 4AWLB 1P3LC 3B6FC 3AZIA 4J8UC 4E44A 5B0YC 2JSSA 4M6BA 4UUZB 3W98D 5GT0B 4WU8D 5B24A 3C1CD 1P3MA 4ZBJC 1P3PC 3MGRA 3WAAC 3LZ0A 2YFVB 4H9OA 1P3PA 2PYOA 5AVBD 5B0YD 4WZSB 5AVBB 5CPID 4J8XB 5JRGD 4XZQB 5CPIB 3WKJD 4XUJA 3X1TC 4WU8A 3X1TA 5CP6B 1P3FC 3TU4B 2IO5C 5B0YA 3LELA 5BNVA 5DNND 2CV5B 3AZKD 3RELA 5BT1D 3AN2C 5CPKD 4WNNA 5B32D 3LJAD 1ULYA 2BYKB 4H9RB 1P3OA 2HIOB 3V9RA 4NE6A 5B1MD 5F99C 4HGAB 4J8UD 4YS3D 5B32A 1M18B 1BFMA 1P3BB 4J8UB 4YM6A 5AY8D 1BH8A 4AWLC 4R8PD 1P3IA 1P3BD 3KXBC 3WTPD 3X1VB 1HTAA 3WA9B 1M1AD 4H9SA 3AV1A 4KHAA 4Z66B 3AZLD 1ZLAB 4J8VD 4LD9C 3REJC 3REKC 4DRBA 5B33B 3KXBD 3W99A 3AV2A 1P3KC 2F8NB 5KDMA 3LELC 3REKB 1TZYA 4G92B 3WTPA 3MGPD 3UTBB 3W96B 4WU9A 2PYOC 3B0BA 3WKJC 3REKD 1KX4A 3WA9C 1B67A 3UTBD 3W96D 1Q9CA 1P34B 5B2IA 5AV6D 3AZHB 1F66C 3KXBA 5F99A 4H9NA 5DNMD 3KSYA 1TZYD 3AZIB 3W96C 3UTBC 4WU8C 5B40C 1P3MD 4UUZA 3REHA 1KX4D 3KWQB 1P3AB 5AV8B 5E5AA 3LZ0D 1F66D 4J8WD 3KWQD 1P3AD 3LZ0B 3AZMB 5AV6A 3AZEC 5CPKB 5B2JC 3TU4C 3REHD 4ZUXA 3REJD 3AYWA 1F66A 5GT3B 3X1TB 5AV5D 2HIOD 4YM6C 2F8NG 2AROA 3A6NA 5B32C 1U35A 4XUJC 3AZNA 3MNNC 5DNNC 3REHC 3REIB 3MVDA 3MNNA 3RELB 1ID3A 4WNNB 1M18D 5B0ZA 1WWIA 3VH6A 3UT9A 3AYWD 2PYOD 5BS7C 4X23C 1KX5B 3WA9D 5GXQD 1P3LA 3B6FA 3B6GB 1M1AB 5CPJC 2RVQC 1KX5D 4JJNA 5GT3C 1U35D 3O62B 5JRGA 3X1SA 3LZ1B 3WKJA 1H3OB 1HQ3A 5B0ZD 5B33D 1HQ3C 1TZYC 5CPIC 5AY8C 1M1AC 4XZQC 1P3IB 3C1BD 1KX5C 3WA9A 4CAYB 3AFAA 3AZGD 1AOID 3LZ0C 3WAAA 5DNNA 4J8VC 5BNXA 3W99D 3W97B 3UT9C 5B2JD 3X1UB 3UTAB 1EQZD 5B33A 5GT0C 3MGPC 1P3OD 3W97D 3W99B 3AZGC 1AOIC 3REKA 2LY8A 1P3FA 4KUDA 2F8NK 5GSUC 1A7WA 3KUYD 2BYMA 4YS3A 1KX3A 2NZDA 5AV8D 3MGQA 4X23A 4YM6D 5B1MC 5F99D 5B31A 4R8PA 5B2JA 4H9PB 4H9NB 3W98B 5JA4A 3AV1D 4KUDD 5B40D 1TAFB 3KWQC 1P3AC 1KX3D 3KWQA 1P3AA 5E5AB 3R45A 5AV8A 4WV4B 5B40B 3MGQD 3REJB 4LD9B 4Z66C 3AV2D 2RVQD 3AZJC 4LD9D 1KU5A 1S32B 4KUDC 3C1BC 4EO5C 4Z5TB 5B24D 3C1CA 1M19D 4ZUXD 5CP6D 4Z5TD 5B24B 5AV5A 5B1LA 3TU4D 3AZJB 3NQUB 5B31G 4HGAC 4H9OB 2PYOB 3W99C 5GT3A 5AV9A 3A6ND 5E5AC 3AZND 3AZKB 2HIOC 3W97C 3MVDD 3A6NB 3VH5W 4XUJD 3LJAB 5AV6C 3REIA 4XZQA 3MVDB 5B31C 1M19A 5GSUD 1F1EA 5DNMC 2YFWA 3VH5T 1ID3B 1ZLAC 4H9QA 5B1MB 5AV9D 2IO5B 3LZ1C 4E45A 5BNVB 2CV5A 5JRGB 5CHLB 3X1SB 4XZQD 2FJ7B 5GSUA 1H3OA 3X1VD 5B0ZC 1P3OB 2FJ7D 5AVBC 5G49B 4QLCB 2HIOA 4Z66D 4J8VB 5FUGA 4CAYA 3WTPE 3RELC 3WAAB 4KGCA 5DNNB 4R8PC 3REIC 3AZFA 5AY8A 4CSRB 1P3OC 5B32B 1M18A 1P3BA 4YM6B 4ZUXC 2FJ7C 3UT9D 4Z2MH 3AFAC 3X1UA 5AVCB 5JRGC 1P3FD 3AZLC 5GT0D 3AZLA 1N1JA 1P3FB 5CP6C 1P3GA 2NZDD 4KHAB 4WU9C 1P34D 4X23D 5CPJB 3B6GC 3AZHD 4J8XD 5CPJD 4Z2MG 4X23B 3AZMC 5B31B 3MVDC 4R8PB
chains in the Genus database with same CATH superfamily
2XD5A 5KDMB 3LJAC 5GT0A 3WTPB 5BS7A 3W96A 3UTBA 1P3MB 3MGRB 4KGCC 3W98A 4ZBJB 1P3PB 2NQBC 1R4VA 1TAFA 1P3PD 3AZMD 3AZJD 1KX3C 5AVBA 3X1SC 4J8XA 2UWXA 1KX4C 5CPIA 4EO5B 5DNMB 1S32A 2Y2KA 4Z5TA 3C1CB 4J8WA 1EQZC 3NQJA 5B1LD 3TU4A 3AZEB 2HUEB 3X1TD 5B1LB 3LELB 3AZED 5AV6B 5AV9B 3LELD 3A6NC 5AV8C 1ID3C 3AZKA 2BYKA 3AZKC 5B1LC 2Y2NA 2NZDC 3KFUG 3B0DB 3V9RB 2YFWB 1Z2CB 1ZLAD 1F66B 3AZHC 3AV1C 5B1MA 1P34C 3B0CT 2CV5D 1S32C 1M18C 4J8UA 2F2AC 1BH8B 3LZ1D 3MGPB 3X1UC 1P3ID 5GXQC 1BH9A 2NQBB 3UT9B 5GXQA 5AVCD 1P3KB 4Z66A 1P3MC 1ZLAA 3WTPC 5GT3D 5B32G 3MGSA 1U35C 1KX5A 1M19C 2NQBD 4QLCA 2JE5A 3B6GA 4J8WC 3F6TA 5FUGB 1HQ3D 1P3IC 3REID 5AY8B 3C1CC 1TZYB 4CSRA 3AZID 1EQZB 1HQ3B 3C1BA 4WU9B 4H9SC 1KX4B 5AV5C 3AFAD 3AZGA 1AOIA 2G5IC 4WU9D 1P3GD 3AL0C 3MGSD 3AZLB 3KUYB 4G91C 1N1JB 3AFAB 3B6GD 3MGRD 5B2IB 1P3GB 4J8XC 3VH6T 5F99B 3UTAC 5BNXB 5B2ID 3W97A 5DNMA 3AN2A 1JFIB 3REHB 2Y2PA 5BO0B 4QLCC 4UPKA 1B6WA 3EPJA 2F8NH 3AYWC 2CV5C 5B2IC 4KGCD 2BYMB 3AZMA 4G91B 2Y2LA 3B0CW 3RELD 3X1UD 5B2JB 3O62C 5CPKA 2Y2IA 5AVCC 4ZUXB 3AYWB 2YFVA 4NE5A 4J8WB 3NQJB 2W8SA 4NFTA 3AZEA 2AROB 4LD9A 1U35B 2Y2OA 3O62D 3AZNB 3AZFC 2AROD 3MNNB 4XUJB 5B0ZB 4WU8B 3AZIC 3MNND 4NE3A 5CP6A 1P3GC 1ID3D 3KUYC 5B0YB 4DRAA 1P3LB 3B6FB 5AV5B 1M1AA 3AZJA 3NQUA 1P3KD 4JJNB 3O62A 5CPKC 2G5HC 1P3LD 3B6FD 3B0DC 5C3IB 3LZ1A 4JJND 4H9RA 3WKJB 3UTAD 1S32D 3X1SD 3LJAA 1M19B 3MGPA 5AV9C 5B33C 1BH9B 2NQBA 3W98C 5GXQB 4H9QB 3AV2C 1P3KA 2L5AA 3MGSB 3WAAD 3MGQC 5C3IC 4YS3C 3UTAA 5B24C 3X1VC 3EG5B 2CWEA 3X1VA 4Z5TC 1EQZA 2FJ7A 5GSUB 3AV1B 3C1BB 1P3BC 4KUDB 4YS3B 1KX3B 5G49A 3AZGB 1AOIB 2NZDB 5E5AD 3MGQB 3AZFD 4J8VA 3MGSC 3KUYA 4G92C 3VH6W 3AV2B 2F8NA 3VH5A 3MGRC 4KGCB 3AZFB 3AZNC 4H9PA 5B31D 2Y2HA 2AROC 5BT1C 3AN2D 5JA4B 3H0LC 5AVCA 3AN2B 2HUEC 1JFIA 1P34A 5BO0A 4QLCD 3R45B 1WWSA 3REJA 5B40A 3AZHA 3KXBB 4JJNC 2DQNC 2F8ND 5CPJA 4AWLB 1P3LC 2Y2QA 3AZIA 3B6FC 4J8UC 4E44A 5B0YC 2JSSA 4M6BA 4UUZB 3W98D 5GT0B 4WU8D 5B24A 3C1CD 1P3MA 4ZBJC 1P3PC 3MGRA 3WAAC 3LZ0A 2YFVB 4H9OA 1P3PA 2PYOA 5AVBD 5B0YD 2ZY5A 4WZSB 5AVBB 5CPID 4J8XB 5JRGD 4XZQB 5CPIB 3WKJD 4XUJA 3X1TC 4WU8A 3H0RC 3X1TA 5CP6B 1P3FC 3TU4B 2Y2GA 2IO5C 5B0YA 3A1IA 3LELA 5BNVA 5DNND 2CV5B 3AZKD 2Y2JA 3RELA 5BT1D 3AN2C 5CPKD 4WNNA 5B32D 3LJAD 1ULYA 2BYKB 4H9RB 1P3OA 2HIOB 3V9RA 4NE6A 5B1MD 5F99C 4HGAB 4J8UD 4YS3D 2XD1A 5B32A 1M18B 1BFMA 1P3BB 4J8UB 4YM6A 2J8PA 5AY8D 1BH8A 4AWLC 4R8PD 1P3IA 1P3BD 3KXBC 3WTPD 3X1VB 1HTAA 3WA9B 1M1AD 4H9SA 3AV1A 4KHAA 4Z66B 3AZLD 1ZLAB 3EPHA 4J8VD 4LD9C 3REJC 3REKC 4DRBA 5B33B 3KXBD 3W99A 3AV2A 1P3KC 2F8NB 5KDMA 3LELC 3REKB 1TZYA 4G92B 3WTPA 3MGPD 3UTBB 3W96B 4WU9A 2PYOC 3B0BA 3WKJC 3REKD 1KX4A 3WA9C 1B67A 3UTBD 3W96D 1Q9CA 1P34B 5B2IA 5AV6D 3AZHB 1F66C 3KXBA 5F99A 2DF4C 4H9NA 5DNMD 3KSYA 1TZYD 3AZIB 3W96C 3UTBC 4WU8C 3IP4C 5B40C 1P3MD 4UUZA 3REHA 1KX4D 3KWQB 1P3AB 5AV8B 5E5AA 3LZ0D 1F66D 4J8WD 2ZY3A 3KWQD 1P3AD 3LZ0B 3AZMB 5AV6A 3AZEC 5CPKB 5B2JC 3TU4C 3REHD 2ZY2A 4ZUXA 3REJD 3AYWA 1F66A 5GT3B 3X1TB 5AV5D 2HIOD 4YM6C 2F8NG 2AROA 2VQRA 5B32C 3A6NA 1U35A 4XUJC 3AZNA 3MNNC 5DNNC 3REHC 3REIB 3MVDA 3MNNA 3RELB 1ID3A 4WNNB 1M18D 5B0ZA 1WWIA 3VH6A 3UT9A 1PZRA 3AYWD 2PYOD 5BS7C 4X23C 1KX5B 3WA9D 5GXQD 1P3LA 3B6FA 3B6GB 1M1AB 5CPJC 2RVQC 1KX5D 4JJNA 5GT3C 1U35D 3O62B 5JRGA 3X1SA 3LZ1B 3WKJA 1H3OB 1HQ3A 5B0ZD 5B33D 1HQ3C 4DQYB 1TZYC 5CPIC 5AY8C 1M1AC 4XZQC 2Y2MA 3C1BD 1P3IB 1KX5C 2ZY4A 3WA9A 4CAYB 3AFAA 3AZGD 1AOID 3LZ0C 3WAAA 5DNNA 3EPKA 2ZM5A 4J8VC 5BNXA 3W99D 3W97B 3UT9C 5B2JD 3X1UB 3UTAB 1EQZD 5B33A 5GT0C 3MGPC 1P3OD 3W97D 3W99B 3AZGC 1AOIC 3REKA 2LY8A 1P3FA 4KUDA 2F8NK 5GSUC 3A1KA 1A7WA 3KUYD 2BYMA 4YS3A 1KX3A 2NZDA 5AV8D 3MGQA 2BG1A 4X23A 4YM6D 5B1MC 5F99D 5B31A 4R8PA 5B2JA 3P5JB 4H9PB 4H9NB 1T3UA 3W98B 5JA4A 3AV1D 4KUDD 5B40D 1TAFB 3KWQC 1P3AC 4WJ3C 1KX3D 3KWQA 1P3AA 5E5AB 3R45A 5AV8A 4WV4B 5B40B 3MGQD 3REJB 4LD9B 4Z66C 3AV2D 2RVQD 3AZJC 4LD9D 1KU5A 1S32B 4KUDC 3C1BC 4EO5C 4Z5TB 5B24D 3C1CA 1M19D 4ZUXD 5CP6D 4Z5TD 5B24B 5AV5A 5B1LA 3TU4D 3AZJB 3NQUB 5B31G 4HGAC 4H9OB 2PYOB 3W99C 5GT3A 3H0MC 5AV9A 3A6ND 5E5AC 3AZND 3AZKB 2HIOC 3W97C 3MVDD 3A6NB 3VH5W 4XUJD 3LJAB 5AV6C 3REIA 4XZQA 3MVDB 5B31C 1M19A 5GSUD 1F1EA 5DNMC 2YFWA 3VH5T 1ID3B 1ZLAC 4H9QA 5B1MB 3FDDA 5AV9D 2IO5B 3LZ1C 4E45A 1W2EA 5BNVB 3EPLA 2CV5A 5JRGB 5CHLB 3X1SB 4XZQD 2FJ7B 5GSUA 1H3OA 3X1VD 5B0ZC 1P3OB 2JCHA 2FJ7D 5AVBC 5G49B 4QLCB 2HIOA 4Z66D 4J8VB 5FUGA 4CAYA 3WTPE 3RELC 3WAAB 4KGCA 5DNNB 4R8PC 3REIC 3AZFA 5AY8A 4CSRB 2FFFB 1P3OC 5B32B 1M18A 1P3BA 4YM6B 4ZUXC 2FJ7C 3UT9D 4Z2MH 3AFAC 3X1UA 5AVCB 5JRGC 1P3FD 3AZLC 5GT0D 3AZLA 1N1JA 1P3FB 5CP6C 1P3GA 2NZDD 4KHAB 4WU9C 1P34D 4X23D 5CPJB 2RIQA 3B6GC 3AZHD 4J8XD 5CPJD 4Z2MG 4X23B 3AZMC 5B31B 3MVDC 4R8PB
chains in the Genus database with same CATH topology
2XD5A 5KDMB 3LJAC 5GT0A 3WTPB 5BS7A 3W96A 3UTBA 1P3MB 3MGRB 4KGCC 3W98A 4ZBJB 1P3PB 2NQBC 1R4VA 1TAFA 1P3PD 3AZMD 3AZJD 1KX3C 5AVBA 3X1SC 4J8XA 2UWXA 1KX4C 5CPIA 4EO5B 5DNMB 1S32A 2Y2KA 4Z5TA 3C1CB 4J8WA 1EQZC 3NQJA 5B1LD 3TU4A 3AZEB 2HUEB 3X1TD 5B1LB 3LELB 3AZED 5AV6B 5AV9B 3LELD 3A6NC 5AV8C 1ID3C 3AZKA 2BYKA 3AZKC 5B1LC 2Y2NA 2NZDC 3KFUG 3B0DB 3V9RB 2YFWB 1Z2CB 1ZLAD 1F66B 3AZHC 3AV1C 5B1MA 1P34C 3B0CT 2CV5D 1S32C 1M18C 4J8UA 2F2AC 1BH8B 3LZ1D 3MGPB 3X1UC 1P3ID 5GXQC 1BH9A 2NQBB 3UT9B 5GXQA 5AVCD 1P3KB 4Z66A 1P3MC 1ZLAA 3WTPC 5GT3D 5B32G 3MGSA 1U35C 1KX5A 1M19C 2NQBD 4QLCA 2JE5A 3B6GA 4J8WC 3F6TA 5FUGB 1HQ3D 1P3IC 3REID 5AY8B 3C1CC 1TZYB 4CSRA 3AZID 1EQZB 1HQ3B 3C1BA 4WU9B 4H9SC 1KX4B 5AV5C 3AFAD 3AZGA 1AOIA 2G5IC 4WU9D 1P3GD 3AL0C 3MGSD 3AZLB 3KUYB 4G91C 1N1JB 3AFAB 3B6GD 3MGRD 5B2IB 1P3GB 4J8XC 3VH6T 5F99B 3UTAC 5BNXB 5B2ID 3W97A 5DNMA 3AN2A 1JFIB 3REHB 2Y2PA 5BO0B 4QLCC 4UPKA 1B6WA 3EPJA 2F8NH 3AYWC 2CV5C 5B2IC 4KGCD 2BYMB 3AZMA 4G91B 2Y2LA 3B0CW 3RELD 3X1UD 5B2JB 3O62C 5CPKA 2Y2IA 5AVCC 4ZUXB 3AYWB 2YFVA 4NE5A 4J8WB 3NQJB 2W8SA 4NFTA 3AZEA 2AROB 4LD9A 1U35B 2Y2OA 3O62D 3AZNB 3AZFC 2AROD 3MNNB 4XUJB 5B0ZB 4WU8B 3AZIC 3MNND 4NE3A 5CP6A 1P3GC 1ID3D 3KUYC 5B0YB 4DRAA 1P3LB 3B6FB 5AV5B 1M1AA 3AZJA 3NQUA 1P3KD 4JJNB 3O62A 5CPKC 2G5HC 1P3LD 3B6FD 3B0DC 5C3IB 3LZ1A 4JJND 4H9RA 3WKJB 3UTAD 1S32D 3X1SD 3LJAA 1M19B 3MGPA 5AV9C 5B33C 1BH9B 2NQBA 3W98C 5GXQB 4H9QB 3AV2C 1P3KA 2L5AA 3MGSB 3WAAD 3MGQC 5C3IC 4YS3C 3UTAA 5B24C 3X1VC 3EG5B 2CWEA 3X1VA 4Z5TC 1EQZA 2FJ7A 5GSUB 3AV1B 3C1BB 1P3BC 4KUDB 4YS3B 1KX3B 5G49A 3AZGB 1AOIB 2NZDB 5E5AD 3MGQB 3AZFD 4J8VA 3MGSC 3KUYA 4G92C 3VH6W 3AV2B 2F8NA 3VH5A 3MGRC 4KGCB 3AZFB 3AZNC 4H9PA 5B31D 2Y2HA 2AROC 5BT1C 3AN2D 5JA4B 3H0LC 5AVCA 3AN2B 2HUEC 1JFIA 1P34A 5BO0A 4QLCD 3R45B 1WWSA 3REJA 5B40A 3AZHA 3KXBB 4JJNC 2DQNC 2F8ND 5CPJA 4AWLB 1P3LC 2Y2QA 3AZIA 3B6FC 4J8UC 4E44A 5B0YC 2JSSA 4M6BA 4UUZB 3W98D 5GT0B 4WU8D 5B24A 3C1CD 1P3MA 4ZBJC 1P3PC 3MGRA 3WAAC 3LZ0A 2YFVB 4H9OA 1P3PA 2PYOA 5AVBD 5B0YD 2ZY5A 4WZSB 5AVBB 5CPID 4J8XB 5JRGD 4XZQB 5CPIB 3WKJD 4XUJA 3X1TC 4WU8A 3H0RC 3X1TA 5CP6B 1P3FC 3TU4B 2Y2GA 2IO5C 5B0YA 3A1IA 3LELA 5BNVA 5DNND 2CV5B 3AZKD 2Y2JA 3RELA 5BT1D 3AN2C 5CPKD 4WNNA 5B32D 3LJAD 1ULYA 2BYKB 4H9RB 1P3OA 2HIOB 3V9RA 4NE6A 5B1MD 5F99C 4HGAB 4J8UD 4YS3D 2XD1A 5B32A 1M18B 1BFMA 1P3BB 4J8UB 4YM6A 2J8PA 5AY8D 1BH8A 4AWLC 4R8PD 1P3IA 1P3BD 3KXBC 3WTPD 3X1VB 1HTAA 3WA9B 1M1AD 4H9SA 3AV1A 4KHAA 4Z66B 3AZLD 1ZLAB 3EPHA 4J8VD 4LD9C 3REJC 3REKC 4DRBA 5B33B 3KXBD 3W99A 3AV2A 1P3KC 2F8NB 5KDMA 3LELC 3REKB 1TZYA 4G92B 3WTPA 3MGPD 3UTBB 3W96B 4WU9A 2PYOC 3B0BA 3WKJC 3REKD 1KX4A 3WA9C 1B67A 3UTBD 3W96D 1Q9CA 1P34B 5B2IA 5AV6D 3AZHB 1F66C 3KXBA 5F99A 2DF4C 4H9NA 5DNMD 3KSYA 1TZYD 3AZIB 3W96C 3UTBC 4WU8C 3IP4C 5B40C 1P3MD 4UUZA 3REHA 1KX4D 3KWQB 1P3AB 5AV8B 5E5AA 3LZ0D 1F66D 4J8WD 2ZY3A 3KWQD 1P3AD 3LZ0B 3AZMB 5AV6A 3AZEC 5CPKB 5B2JC 3TU4C 3REHD 2ZY2A 4ZUXA 3REJD 3AYWA 1F66A 5GT3B 3X1TB 5AV5D 2HIOD 4YM6C 2F8NG 2AROA 2VQRA 5B32C 3A6NA 1U35A 4XUJC 3AZNA 3MNNC 5DNNC 3REHC 3REIB 3MVDA 3MNNA 3RELB 1ID3A 4WNNB 1M18D 5B0ZA 1WWIA 3VH6A 3UT9A 1PZRA 3AYWD 2PYOD 5BS7C 4X23C 1KX5B 3WA9D 5GXQD 1P3LA 3B6FA 3B6GB 1M1AB 5CPJC 2RVQC 1KX5D 4JJNA 5GT3C 1U35D 3O62B 5JRGA 3X1SA 3LZ1B 3WKJA 1H3OB 1HQ3A 5B0ZD 5B33D 1HQ3C 4DQYB 1TZYC 5CPIC 5AY8C 1M1AC 4XZQC 2Y2MA 3C1BD 1P3IB 1KX5C 2ZY4A 3WA9A 4CAYB 3AFAA 3AZGD 1AOID 3LZ0C 3WAAA 5DNNA 3EPKA 2ZM5A 4J8VC 5BNXA 3W99D 3W97B 3UT9C 5B2JD 3X1UB 3UTAB 1EQZD 5B33A 5GT0C 3MGPC 1P3OD 3W97D 3W99B 3AZGC 1AOIC 3REKA 2LY8A 1P3FA 4KUDA 2F8NK 5GSUC 3A1KA 1A7WA 3KUYD 2BYMA 4YS3A 1KX3A 2NZDA 5AV8D 3MGQA 2BG1A 4X23A 4YM6D 5B1MC 5F99D 5B31A 4R8PA 5B2JA 3P5JB 4H9PB 4H9NB 1T3UA 3W98B 5JA4A 3AV1D 4KUDD 5B40D 1TAFB 3KWQC 1P3AC 4WJ3C 1KX3D 3KWQA 1P3AA 5E5AB 3R45A 5AV8A 4WV4B 5B40B 3MGQD 3REJB 4LD9B 4Z66C 3AV2D 2RVQD 3AZJC 4LD9D 1KU5A 1S32B 4KUDC 3C1BC 4EO5C 4Z5TB 5B24D 3C1CA 1M19D 4ZUXD 5CP6D 4Z5TD 5B24B 5AV5A 5B1LA 3TU4D 3AZJB 3NQUB 5B31G 4HGAC 4H9OB 2PYOB 3W99C 5GT3A 3H0MC 5AV9A 3A6ND 5E5AC 3AZND 3AZKB 2HIOC 3W97C 3MVDD 3A6NB 3VH5W 4XUJD 3LJAB 5AV6C 3REIA 4XZQA 3MVDB 5B31C 1M19A 5GSUD 1F1EA 5DNMC 2YFWA 3VH5T 1ID3B 1ZLAC 4H9QA 5B1MB 3FDDA 5AV9D 2IO5B 3LZ1C 4E45A 1W2EA 5BNVB 3EPLA 2CV5A 5JRGB 5CHLB 3X1SB 4XZQD 2FJ7B 5GSUA 1H3OA 3X1VD 5B0ZC 1P3OB 2JCHA 2FJ7D 5AVBC 5G49B 4QLCB 2HIOA 4Z66D 4J8VB 5FUGA 4CAYA 3WTPE 3RELC 3WAAB 4KGCA 5DNNB 4R8PC 3REIC 3AZFA 5AY8A 4CSRB 2FFFB 1P3OC 5B32B 1M18A 1P3BA 4YM6B 4ZUXC 2FJ7C 3UT9D 4Z2MH 3AFAC 3X1UA 5AVCB 5JRGC 1P3FD 3AZLC 5GT0D 3AZLA 1N1JA 1P3FB 5CP6C 1P3GA 2NZDD 4KHAB 4WU9C 1P34D 4X23D 5CPJB 2RIQA 3B6GC 3AZHD 4J8XD 5CPJD 4Z2MG 4X23B 3AZMC 5B31B 3MVDC 4R8PB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KDM B;  3LJA C;  5GT0 A;  3WTP B;  5BS7 A;  3W96 A;  3UTB A;  1P3M B;  3MGR B;  4KGC C;  3W98 A;  4ZBJ B;  1P3P B;  2NQB C;  1R4V A;  1TAF A;  1P3P D;  3AZM D;  3AZJ D;  1KX3 C;  5AVB A;  3X1S C;  4J8X A;  1KX4 C;  5CPI A;  4EO5 B;  5DNM B;  1S32 A;  4Z5T A;  3C1C B;  4J8W A;  1EQZ C;  3NQJ A;  5B1L D;  3TU4 A;  3AZE B;  2HUE B;  3X1T D;  5B1L B;  3LEL B;  3AZE D;  5AV6 B;  5AV9 B;  3LEL D;  3A6N C;  5AV8 C;  1ID3 C;  3AZK A;  2BYK A;  3AZK C;  5B1L C;  2NZD C;  3B0D B;  3V9R B;  2YFW B;  1ZLA D;  1F66 B;  3AZH C;  3AV1 C;  5B1M A;  1P34 C;  3B0C T;  2CV5 D;  1S32 C;  1M18 C;  4J8U A;  1BH8 B;  3LZ1 D;  3MGP B;  3X1U C;  1P3I D;  5GXQ C;  1BH9 A;  2NQB B;  3UT9 B;  5GXQ A;  5AVC D;  1P3K B;  4Z66 A;  1P3M C;  1ZLA A;  3WTP C;  5GT3 D;  5B32 G;  3MGS A;  1U35 C;  1KX5 A;  1M19 C;  2NQB D;  4QLC A;  3B6G A;  4J8W C;  5FUG B;  1HQ3 D;  1P3I C;  3REI D;  5AY8 B;  3C1C C;  1TZY B;  4CSR A;  3AZI D;  1EQZ B;  1HQ3 B;  3C1B A;  4WU9 B;  4H9S C;  1KX4 B;  5AV5 C;  3AFA D;  3AZG A;  1AOI A;  4WU9 D;  1P3G D;  3MGS D;  3AZL B;  3KUY B;  4G91 C;  1N1J B;  3AFA B;  3B6G D;  3MGR D;  5B2I B;  1P3G B;  4J8X C;  3VH6 T;  5F99 B;  3UTA C;  5BNX B;  5B2I D;  3W97 A;  5DNM A;  3AN2 A;  1JFI B;  3REH B;  4QLC C;  5BO0 B;  1B6W A;  2F8N H;  3AYW C;  2CV5 C;  5B2I C;  4KGC D;  2BYM B;  3AZM A;  4G91 B;  3B0C W;  3REL D;  5B2J B;  3X1U D;  3O62 C;  5CPK A;  5AVC C;  4ZUX B;  3AYW B;  2YFV A;  4NE5 A;  4J8W B;  3NQJ B;  4NFT A;  3AZE A;  2ARO B;  4LD9 A;  1U35 B;  3O62 D;  3AZN B;  3AZF C;  2ARO D;  3MNN B;  4XUJ B;  5B0Z B;  4WU8 B;  3AZI C;  3MNN D;  4NE3 A;  5CP6 A;  1P3G C;  1ID3 D;  3KUY C;  5B0Y B;  4DRA A;  1P3L B;  3B6F B;  5AV5 B;  1M1A A;  3AZJ A;  3NQU A;  1P3K D;  4JJN B;  3O62 A;  5CPK C;  1P3L D;  3B6F D;  3B0D C;  5C3I B;  3LZ1 A;  4JJN D;  4H9R A;  3WKJ B;  3UTA D;  1S32 D;  3X1S D;  3LJA A;  1M19 B;  3MGP A;  5AV9 C;  5B33 C;  1BH9 B;  2NQB A;  3W98 C;  5GXQ B;  4H9Q B;  3AV2 C;  1P3K A;  2L5A A;  3MGS B;  3WAA D;  3MGQ C;  5C3I C;  4YS3 C;  3UTA A;  5B24 C;  3X1V C;  2CWE A;  3X1V A;  4Z5T C;  1EQZ A;  2FJ7 A;  5GSU B;  3AV1 B;  3C1B B;  1P3B C;  4KUD B;  4YS3 B;  1KX3 B;  5G49 A;  3AZG B;  1AOI B;  2NZD B;  5E5A D;  3MGQ B;  3AZF D;  4J8V A;  3MGS C;  3KUY A;  4G92 C;  3VH6 W;  3AV2 B;  2F8N A;  3VH5 A;  3MGR C;  4KGC B;  3AZF B;  3AZN C;  4H9P A;  5B31 D;  2ARO C;  5BT1 C;  3AN2 D;  5JA4 B;  5AVC A;  3AN2 B;  2HUE C;  1JFI A;  1P34 A;  5BO0 A;  4QLC D;  3R45 B;  1WWS A;  3REJ A;  5B40 A;  3AZH A;  3KXB B;  4JJN C;  2F8N D;  5CPJ A;  4AWL B;  1P3L C;  3B6F C;  3AZI A;  4J8U C;  4E44 A;  5B0Y C;  2JSS A;  4M6B A;  4UUZ B;  3W98 D;  5GT0 B;  4WU8 D;  5B24 A;  3C1C D;  1P3M A;  4ZBJ C;  1P3P C;  3MGR A;  3WAA C;  3LZ0 A;  2YFV B;  4H9O A;  1P3P A;  2PYO A;  5AVB D;  5B0Y D;  4WZS B;  5AVB B;  5CPI D;  4J8X B;  5JRG D;  4XZQ B;  5CPI B;  3WKJ D;  4XUJ A;  3X1T C;  4WU8 A;  3X1T A;  5CP6 B;  1P3F C;  3TU4 B;  2IO5 C;  5B0Y A;  3LEL A;  5BNV A;  5DNN D;  2CV5 B;  3AZK D;  3REL A;  5BT1 D;  3AN2 C;  5CPK D;  4WNN A;  5B32 D;  3LJA D;  1ULY A;  2BYK B;  4H9R B;  1P3O A;  2HIO B;  3V9R A;  4NE6 A;  5B1M D;  5F99 C;  4HGA B;  4J8U D;  4YS3 D;  5B32 A;  1M18 B;  1BFM A;  1P3B B;  4J8U B;  4YM6 A;  5AY8 D;  1BH8 A;  4AWL C;  4R8P D;  1P3I A;  1P3B D;  3KXB C;  3WTP D;  3X1V B;  1HTA A;  3WA9 B;  1M1A D;  4H9S A;  3AV1 A;  4KHA A;  4Z66 B;  3AZL D;  1ZLA B;  4J8V D;  4LD9 C;  3REJ C;  3REK C;  4DRB A;  5B33 B;  3KXB D;  3W99 A;  3AV2 A;  1P3K C;  2F8N B;  5KDM A;  3LEL C;  3REK B;  1TZY A;  4G92 B;  3WTP A;  3MGP D;  3UTB B;  3W96 B;  4WU9 A;  2PYO C;  3B0B A;  3WKJ C;  3REK D;  1KX4 A;  3WA9 C;  1B67 A;  3UTB D;  3W96 D;  1Q9C A;  1P34 B;  5B2I A;  5AV6 D;  3AZH B;  1F66 C;  3KXB A;  5F99 A;  4H9N A;  5DNM D;  3KSY A;  1TZY D;  3AZI B;  3W96 C;  3UTB C;  4WU8 C;  5B40 C;  1P3M D;  4UUZ A;  3REH A;  1KX4 D;  3KWQ B;  1P3A B;  5AV8 B;  5E5A A;  3LZ0 D;  1F66 D;  4J8W D;  3KWQ D;  1P3A D;  3LZ0 B;  3AZM B;  5AV6 A;  3AZE C;  5CPK B;  5B2J C;  3TU4 C;  3REH D;  4ZUX A;  3REJ D;  3AYW A;  1F66 A;  5GT3 B;  3X1T B;  5AV5 D;  2HIO D;  4YM6 C;  2F8N G;  2ARO A;  3A6N A;  5B32 C;  1U35 A;  4XUJ C;  3AZN A;  3MNN C;  5DNN C;  3REH C;  3REI B;  3MVD A;  3MNN A;  3REL B;  1ID3 A;  4WNN B;  1M18 D;  5B0Z A;  1WWI A;  3VH6 A;  3UT9 A;  3AYW D;  2PYO D;  5BS7 C;  4X23 C;  1KX5 B;  3WA9 D;  5GXQ D;  1P3L A;  3B6F A;  3B6G B;  1M1A B;  5CPJ C;  2RVQ C;  1KX5 D;  4JJN A;  5GT3 C;  1U35 D;  3O62 B;  5JRG A;  3X1S A;  3LZ1 B;  3WKJ A;  1H3O B;  1HQ3 A;  5B0Z D;  5B33 D;  1HQ3 C;  1TZY C;  5CPI C;  5AY8 C;  1M1A C;  4XZQ C;  1P3I B;  3C1B D;  1KX5 C;  3WA9 A;  4CAY B;  3AFA A;  3AZG D;  1AOI D;  3LZ0 C;  3WAA A;  5DNN A;  4J8V C;  5BNX A;  3W99 D;  3W97 B;  3UT9 C;  5B2J D;  3X1U B;  3UTA B;  1EQZ D;  5B33 A;  5GT0 C;  3MGP C;  1P3O D;  3W97 D;  3W99 B;  3AZG C;  1AOI C;  3REK A;  2LY8 A;  1P3F A;  4KUD A;  2F8N K;  5GSU C;  1A7W A;  3KUY D;  2BYM A;  4YS3 A;  1KX3 A;  2NZD A;  5AV8 D;  3MGQ A;  4X23 A;  4YM6 D;  5B1M C;  5F99 D;  5B31 A;  4R8P A;  5B2J A;  4H9P B;  4H9N B;  3W98 B;  5JA4 A;  3AV1 D;  4KUD D;  5B40 D;  1TAF B;  3KWQ C;  1P3A C;  1KX3 D;  3KWQ A;  1P3A A;  5E5A B;  3R45 A;  5AV8 A;  4WV4 B;  5B40 B;  3MGQ D;  3REJ B;  4LD9 B;  4Z66 C;  3AV2 D;  2RVQ D;  3AZJ C;  4LD9 D;  1KU5 A;  1S32 B;  4KUD C;  3C1B C;  4EO5 C;  4Z5T B;  5B24 D;  3C1C A;  1M19 D;  4ZUX D;  5CP6 D;  4Z5T D;  5B24 B;  5AV5 A;  5B1L A;  3TU4 D;  3AZJ B;  3NQU B;  5B31 G;  4HGA C;  4H9O B;  2PYO B;  3W99 C;  5GT3 A;  5AV9 A;  3A6N D;  5E5A C;  3AZN D;  3AZK B;  2HIO C;  3W97 C;  3MVD D;  3A6N B;  3VH5 W;  4XUJ D;  3LJA B;  5AV6 C;  3REI A;  4XZQ A;  3MVD B;  5B31 C;  1M19 A;  5GSU D;  1F1E A;  5DNM C;  2YFW A;  3VH5 T;  1ID3 B;  1ZLA C;  4H9Q A;  5B1M B;  5AV9 D;  2IO5 B;  3LZ1 C;  4E45 A;  5BNV B;  2CV5 A;  5JRG B;  5CHL B;  3X1S B;  4XZQ D;  2FJ7 B;  5GSU A;  1H3O A;  3X1V D;  5B0Z C;  1P3O B;  2FJ7 D;  5AVB C;  5G49 B;  4QLC B;  2HIO A;  4Z66 D;  4J8V B;  5FUG A;  4CAY A;  3WTP E;  3REL C;  3WAA B;  4KGC A;  5DNN B;  4R8P C;  3REI C;  3AZF A;  5AY8 A;  4CSR B;  1P3O C;  5B32 B;  1M18 A;  1P3B A;  4YM6 B;  4ZUX C;  2FJ7 C;  3UT9 D;  4Z2M H;  3AFA C;  3X1U A;  5AVC B;  5JRG C;  1P3F D;  3AZL C;  5GT0 D;  3AZL A;  1N1J A;  1P3F B;  5CP6 C;  1P3G A;  2NZD D;  4KHA B;  4WU9 C;  1P34 D;  4X23 D;  5CPJ B;  3B6G C;  3AZH D;  4J8X D;  5CPJ D;  4Z2M G;  4X23 B;  3AZM C;  5B31 B;  3MVD C;  4R8P B; 
#chains in the Genus database with same CATH topology
 2XD5 A;  5KDM B;  3LJA C;  5GT0 A;  3WTP B;  5BS7 A;  3W96 A;  3UTB A;  1P3M B;  3MGR B;  4KGC C;  3W98 A;  4ZBJ B;  1P3P B;  2NQB C;  1R4V A;  1TAF A;  1P3P D;  3AZM D;  3AZJ D;  1KX3 C;  5AVB A;  3X1S C;  4J8X A;  2UWX A;  1KX4 C;  5CPI A;  4EO5 B;  5DNM B;  1S32 A;  2Y2K A;  4Z5T A;  3C1C B;  4J8W A;  1EQZ C;  3NQJ A;  5B1L D;  3TU4 A;  3AZE B;  2HUE B;  3X1T D;  5B1L B;  3LEL B;  3AZE D;  5AV6 B;  5AV9 B;  3LEL D;  3A6N C;  5AV8 C;  1ID3 C;  3AZK A;  2BYK A;  3AZK C;  5B1L C;  2Y2N A;  2NZD C;  3KFU G;  3B0D B;  3V9R B;  2YFW B;  1Z2C B;  1ZLA D;  1F66 B;  3AZH C;  3AV1 C;  5B1M A;  1P34 C;  3B0C T;  2CV5 D;  1S32 C;  1M18 C;  4J8U A;  2F2A C;  1BH8 B;  3LZ1 D;  3MGP B;  3X1U C;  1P3I D;  5GXQ C;  1BH9 A;  2NQB B;  3UT9 B;  5GXQ A;  5AVC D;  1P3K B;  4Z66 A;  1P3M C;  1ZLA A;  3WTP C;  5GT3 D;  5B32 G;  3MGS A;  1U35 C;  1KX5 A;  1M19 C;  2NQB D;  4QLC A;  2JE5 A;  3B6G A;  4J8W C;  3F6T A;  5FUG B;  1HQ3 D;  1P3I C;  3REI D;  5AY8 B;  3C1C C;  1TZY B;  4CSR A;  3AZI D;  1EQZ B;  1HQ3 B;  3C1B A;  4WU9 B;  4H9S C;  1KX4 B;  5AV5 C;  3AFA D;  3AZG A;  1AOI A;  2G5I C;  4WU9 D;  1P3G D;  3AL0 C;  3MGS D;  3AZL B;  3KUY B;  4G91 C;  1N1J B;  3AFA B;  3B6G D;  3MGR D;  5B2I B;  1P3G B;  4J8X C;  3VH6 T;  5F99 B;  3UTA C;  5BNX B;  5B2I D;  3W97 A;  5DNM A;  3AN2 A;  1JFI B;  3REH B;  2Y2P A;  5BO0 B;  4QLC C;  4UPK A;  1B6W A;  3EPJ A;  2F8N H;  3AYW C;  2CV5 C;  5B2I C;  4KGC D;  2BYM B;  3AZM A;  4G91 B;  2Y2L A;  3B0C W;  3REL D;  3X1U D;  5B2J B;  3O62 C;  5CPK A;  2Y2I A;  5AVC C;  4ZUX B;  3AYW B;  2YFV A;  4NE5 A;  4J8W B;  3NQJ B;  2W8S A;  4NFT A;  3AZE A;  2ARO B;  4LD9 A;  1U35 B;  2Y2O A;  3O62 D;  3AZN B;  3AZF C;  2ARO D;  3MNN B;  4XUJ B;  5B0Z B;  4WU8 B;  3AZI C;  3MNN D;  4NE3 A;  5CP6 A;  1P3G C;  1ID3 D;  3KUY C;  5B0Y B;  4DRA A;  1P3L B;  3B6F B;  5AV5 B;  1M1A A;  3AZJ A;  3NQU A;  1P3K D;  4JJN B;  3O62 A;  5CPK C;  2G5H C;  1P3L D;  3B6F D;  3B0D C;  5C3I B;  3LZ1 A;  4JJN D;  4H9R A;  3WKJ B;  3UTA D;  1S32 D;  3X1S D;  3LJA A;  1M19 B;  3MGP A;  5AV9 C;  5B33 C;  1BH9 B;  2NQB A;  3W98 C;  5GXQ B;  4H9Q B;  3AV2 C;  1P3K A;  2L5A A;  3MGS B;  3WAA D;  3MGQ C;  5C3I C;  4YS3 C;  3UTA A;  5B24 C;  3X1V C;  3EG5 B;  2CWE A;  3X1V A;  4Z5T C;  1EQZ A;  2FJ7 A;  5GSU B;  3AV1 B;  3C1B B;  1P3B C;  4KUD B;  4YS3 B;  1KX3 B;  5G49 A;  3AZG B;  1AOI B;  2NZD B;  5E5A D;  3MGQ B;  3AZF D;  4J8V A;  3MGS C;  3KUY A;  4G92 C;  3VH6 W;  3AV2 B;  2F8N A;  3VH5 A;  3MGR C;  4KGC B;  3AZF B;  3AZN C;  4H9P A;  5B31 D;  2Y2H A;  2ARO C;  5BT1 C;  3AN2 D;  5JA4 B;  3H0L C;  5AVC A;  3AN2 B;  2HUE C;  1JFI A;  1P34 A;  5BO0 A;  4QLC D;  3R45 B;  1WWS A;  3REJ A;  5B40 A;  3AZH A;  3KXB B;  4JJN C;  2DQN C;  2F8N D;  5CPJ A;  4AWL B;  1P3L C;  2Y2Q A;  3AZI A;  3B6F C;  4J8U C;  4E44 A;  5B0Y C;  2JSS A;  4M6B A;  4UUZ B;  3W98 D;  5GT0 B;  4WU8 D;  5B24 A;  3C1C D;  1P3M A;  4ZBJ C;  1P3P C;  3MGR A;  3WAA C;  3LZ0 A;  2YFV B;  4H9O A;  1P3P A;  2PYO A;  5AVB D;  5B0Y D;  2ZY5 A;  4WZS B;  5AVB B;  5CPI D;  4J8X B;  5JRG D;  4XZQ B;  5CPI B;  3WKJ D;  4XUJ A;  3X1T C;  4WU8 A;  3H0R C;  3X1T A;  5CP6 B;  1P3F C;  3TU4 B;  2Y2G A;  2IO5 C;  5B0Y A;  3A1I A;  3LEL A;  5BNV A;  5DNN D;  2CV5 B;  3AZK D;  2Y2J A;  3REL A;  5BT1 D;  3AN2 C;  5CPK D;  4WNN A;  5B32 D;  3LJA D;  1ULY A;  2BYK B;  4H9R B;  1P3O A;  2HIO B;  3V9R A;  4NE6 A;  5B1M D;  5F99 C;  4HGA B;  4J8U D;  4YS3 D;  2XD1 A;  5B32 A;  1M18 B;  1BFM A;  1P3B B;  4J8U B;  4YM6 A;  2J8P A;  5AY8 D;  1BH8 A;  4AWL C;  4R8P D;  1P3I A;  1P3B D;  3KXB C;  3WTP D;  3X1V B;  1HTA A;  3WA9 B;  1M1A D;  4H9S A;  3AV1 A;  4KHA A;  4Z66 B;  3AZL D;  1ZLA B;  3EPH A;  4J8V D;  4LD9 C;  3REJ C;  3REK C;  4DRB A;  5B33 B;  3KXB D;  3W99 A;  3AV2 A;  1P3K C;  2F8N B;  5KDM A;  3LEL C;  3REK B;  1TZY A;  4G92 B;  3WTP A;  3MGP D;  3UTB B;  3W96 B;  4WU9 A;  2PYO C;  3B0B A;  3WKJ C;  3REK D;  1KX4 A;  3WA9 C;  1B67 A;  3UTB D;  3W96 D;  1Q9C A;  1P34 B;  5B2I A;  5AV6 D;  3AZH B;  1F66 C;  3KXB A;  5F99 A;  2DF4 C;  4H9N A;  5DNM D;  3KSY A;  1TZY D;  3AZI B;  3W96 C;  3UTB C;  4WU8 C;  3IP4 C;  5B40 C;  1P3M D;  4UUZ A;  3REH A;  1KX4 D;  3KWQ B;  1P3A B;  5AV8 B;  5E5A A;  3LZ0 D;  1F66 D;  4J8W D;  2ZY3 A;  3KWQ D;  1P3A D;  3LZ0 B;  3AZM B;  5AV6 A;  3AZE C;  5CPK B;  5B2J C;  3TU4 C;  3REH D;  2ZY2 A;  4ZUX A;  3REJ D;  3AYW A;  1F66 A;  5GT3 B;  3X1T B;  5AV5 D;  2HIO D;  4YM6 C;  2F8N G;  2ARO A;  2VQR A;  5B32 C;  3A6N A;  1U35 A;  4XUJ C;  3AZN A;  3MNN C;  5DNN C;  3REH C;  3REI B;  3MVD A;  3MNN A;  3REL B;  1ID3 A;  4WNN B;  1M18 D;  5B0Z A;  1WWI A;  3VH6 A;  3UT9 A;  1PZR A;  3AYW D;  2PYO D;  5BS7 C;  4X23 C;  1KX5 B;  3WA9 D;  5GXQ D;  1P3L A;  3B6F A;  3B6G B;  1M1A B;  5CPJ C;  2RVQ C;  1KX5 D;  4JJN A;  5GT3 C;  1U35 D;  3O62 B;  5JRG A;  3X1S A;  3LZ1 B;  3WKJ A;  1H3O B;  1HQ3 A;  5B0Z D;  5B33 D;  1HQ3 C;  4DQY B;  1TZY C;  5CPI C;  5AY8 C;  1M1A C;  4XZQ C;  2Y2M A;  3C1B D;  1P3I B;  1KX5 C;  2ZY4 A;  3WA9 A;  4CAY B;  3AFA A;  3AZG D;  1AOI D;  3LZ0 C;  3WAA A;  5DNN A;  3EPK A;  2ZM5 A;  4J8V C;  5BNX A;  3W99 D;  3W97 B;  3UT9 C;  5B2J D;  3X1U B;  3UTA B;  1EQZ D;  5B33 A;  5GT0 C;  3MGP C;  1P3O D;  3W97 D;  3W99 B;  3AZG C;  1AOI C;  3REK A;  2LY8 A;  1P3F A;  4KUD A;  2F8N K;  5GSU C;  3A1K A;  1A7W A;  3KUY D;  2BYM A;  4YS3 A;  1KX3 A;  2NZD A;  5AV8 D;  3MGQ A;  2BG1 A;  4X23 A;  4YM6 D;  5B1M C;  5F99 D;  5B31 A;  4R8P A;  5B2J A;  3P5J B;  4H9P B;  4H9N B;  1T3U A;  3W98 B;  5JA4 A;  3AV1 D;  4KUD D;  5B40 D;  1TAF B;  3KWQ C;  1P3A C;  4WJ3 C;  1KX3 D;  3KWQ A;  1P3A A;  5E5A B;  3R45 A;  5AV8 A;  4WV4 B;  5B40 B;  3MGQ D;  3REJ B;  4LD9 B;  4Z66 C;  3AV2 D;  2RVQ D;  3AZJ C;  4LD9 D;  1KU5 A;  1S32 B;  4KUD C;  3C1B C;  4EO5 C;  4Z5T B;  5B24 D;  3C1C A;  1M19 D;  4ZUX D;  5CP6 D;  4Z5T D;  5B24 B;  5AV5 A;  5B1L A;  3TU4 D;  3AZJ B;  3NQU B;  5B31 G;  4HGA C;  4H9O B;  2PYO B;  3W99 C;  5GT3 A;  3H0M C;  5AV9 A;  3A6N D;  5E5A C;  3AZN D;  3AZK B;  2HIO C;  3W97 C;  3MVD D;  3A6N B;  3VH5 W;  4XUJ D;  3LJA B;  5AV6 C;  3REI A;  4XZQ A;  3MVD B;  5B31 C;  1M19 A;  5GSU D;  1F1E A;  5DNM C;  2YFW A;  3VH5 T;  1ID3 B;  1ZLA C;  4H9Q A;  5B1M B;  3FDD A;  5AV9 D;  2IO5 B;  3LZ1 C;  4E45 A;  1W2E A;  5BNV B;  3EPL A;  2CV5 A;  5JRG B;  5CHL B;  3X1S B;  4XZQ D;  2FJ7 B;  5GSU A;  1H3O A;  3X1V D;  5B0Z C;  1P3O B;  2JCH A;  2FJ7 D;  5AVB C;  5G49 B;  4QLC B;  2HIO A;  4Z66 D;  4J8V B;  5FUG A;  4CAY A;  3WTP E;  3REL C;  3WAA B;  4KGC A;  5DNN B;  4R8P C;  3REI C;  3AZF A;  5AY8 A;  4CSR B;  2FFF B;  1P3O C;  5B32 B;  1M18 A;  1P3B A;  4YM6 B;  4ZUX C;  2FJ7 C;  3UT9 D;  4Z2M H;  3AFA C;  3X1U A;  5AVC B;  5JRG C;  1P3F D;  3AZL C;  5GT0 D;  3AZL A;  1N1J A;  1P3F B;  5CP6 C;  1P3G A;  2NZD D;  4KHA B;  4WU9 C;  1P34 D;  4X23 D;  5CPJ B;  2RIQ A;  3B6G C;  3AZH D;  4J8X D;  5CPJ D;  4Z2M G;  4X23 B;  3AZM C;  5B31 B;  3MVD C;  4R8P B; 
#chains in the Genus database with same CATH homology
 2XD5 A;  5KDM B;  3LJA C;  5GT0 A;  3WTP B;  5BS7 A;  3W96 A;  3UTB A;  1P3M B;  3MGR B;  4KGC C;  3W98 A;  4ZBJ B;  1P3P B;  2NQB C;  1R4V A;  1TAF A;  1P3P D;  3AZM D;  3AZJ D;  1KX3 C;  5AVB A;  3X1S C;  4J8X A;  2UWX A;  1KX4 C;  5CPI A;  4EO5 B;  5DNM B;  1S32 A;  2Y2K A;  4Z5T A;  3C1C B;  4J8W A;  1EQZ C;  3NQJ A;  5B1L D;  3TU4 A;  3AZE B;  2HUE B;  3X1T D;  5B1L B;  3LEL B;  3AZE D;  5AV6 B;  5AV9 B;  3LEL D;  3A6N C;  5AV8 C;  1ID3 C;  3AZK A;  2BYK A;  3AZK C;  5B1L C;  2Y2N A;  2NZD C;  3KFU G;  3B0D B;  3V9R B;  2YFW B;  1Z2C B;  1ZLA D;  1F66 B;  3AZH C;  3AV1 C;  5B1M A;  1P34 C;  3B0C T;  2CV5 D;  1S32 C;  1M18 C;  4J8U A;  2F2A C;  1BH8 B;  3LZ1 D;  3MGP B;  3X1U C;  1P3I D;  5GXQ C;  1BH9 A;  2NQB B;  3UT9 B;  5GXQ A;  5AVC D;  1P3K B;  4Z66 A;  1P3M C;  1ZLA A;  3WTP C;  5GT3 D;  5B32 G;  3MGS A;  1U35 C;  1KX5 A;  1M19 C;  2NQB D;  4QLC A;  2JE5 A;  3B6G A;  4J8W C;  3F6T A;  5FUG B;  1HQ3 D;  1P3I C;  3REI D;  5AY8 B;  3C1C C;  1TZY B;  4CSR A;  3AZI D;  1EQZ B;  1HQ3 B;  3C1B A;  4WU9 B;  4H9S C;  1KX4 B;  5AV5 C;  3AFA D;  3AZG A;  1AOI A;  2G5I C;  4WU9 D;  1P3G D;  3AL0 C;  3MGS D;  3AZL B;  3KUY B;  4G91 C;  1N1J B;  3AFA B;  3B6G D;  3MGR D;  5B2I B;  1P3G B;  4J8X C;  3VH6 T;  5F99 B;  3UTA C;  5BNX B;  5B2I D;  3W97 A;  5DNM A;  3AN2 A;  1JFI B;  3REH B;  2Y2P A;  5BO0 B;  4QLC C;  4UPK A;  1B6W A;  3EPJ A;  2F8N H;  3AYW C;  2CV5 C;  5B2I C;  4KGC D;  2BYM B;  3AZM A;  4G91 B;  2Y2L A;  3B0C W;  3REL D;  3X1U D;  5B2J B;  3O62 C;  5CPK A;  2Y2I A;  5AVC C;  4ZUX B;  3AYW B;  2YFV A;  4NE5 A;  4J8W B;  3NQJ B;  2W8S A;  4NFT A;  3AZE A;  2ARO B;  4LD9 A;  1U35 B;  2Y2O A;  3O62 D;  3AZN B;  3AZF C;  2ARO D;  3MNN B;  4XUJ B;  5B0Z B;  4WU8 B;  3AZI C;  3MNN D;  4NE3 A;  5CP6 A;  1P3G C;  1ID3 D;  3KUY C;  5B0Y B;  4DRA A;  1P3L B;  3B6F B;  5AV5 B;  1M1A A;  3AZJ A;  3NQU A;  1P3K D;  4JJN B;  3O62 A;  5CPK C;  2G5H C;  1P3L D;  3B6F D;  3B0D C;  5C3I B;  3LZ1 A;  4JJN D;  4H9R A;  3WKJ B;  3UTA D;  1S32 D;  3X1S D;  3LJA A;  1M19 B;  3MGP A;  5AV9 C;  5B33 C;  1BH9 B;  2NQB A;  3W98 C;  5GXQ B;  4H9Q B;  3AV2 C;  1P3K A;  2L5A A;  3MGS B;  3WAA D;  3MGQ C;  5C3I C;  4YS3 C;  3UTA A;  5B24 C;  3X1V C;  3EG5 B;  2CWE A;  3X1V A;  4Z5T C;  1EQZ A;  2FJ7 A;  5GSU B;  3AV1 B;  3C1B B;  1P3B C;  4KUD B;  4YS3 B;  1KX3 B;  5G49 A;  3AZG B;  1AOI B;  2NZD B;  5E5A D;  3MGQ B;  3AZF D;  4J8V A;  3MGS C;  3KUY A;  4G92 C;  3VH6 W;  3AV2 B;  2F8N A;  3VH5 A;  3MGR C;  4KGC B;  3AZF B;  3AZN C;  4H9P A;  5B31 D;  2Y2H A;  2ARO C;  5BT1 C;  3AN2 D;  5JA4 B;  3H0L C;  5AVC A;  3AN2 B;  2HUE C;  1JFI A;  1P34 A;  5BO0 A;  4QLC D;  3R45 B;  1WWS A;  3REJ A;  5B40 A;  3AZH A;  3KXB B;  4JJN C;  2DQN C;  2F8N D;  5CPJ A;  4AWL B;  1P3L C;  2Y2Q A;  3AZI A;  3B6F C;  4J8U C;  4E44 A;  5B0Y C;  2JSS A;  4M6B A;  4UUZ B;  3W98 D;  5GT0 B;  4WU8 D;  5B24 A;  3C1C D;  1P3M A;  4ZBJ C;  1P3P C;  3MGR A;  3WAA C;  3LZ0 A;  2YFV B;  4H9O A;  1P3P A;  2PYO A;  5AVB D;  5B0Y D;  2ZY5 A;  4WZS B;  5AVB B;  5CPI D;  4J8X B;  5JRG D;  4XZQ B;  5CPI B;  3WKJ D;  4XUJ A;  3X1T C;  4WU8 A;  3H0R C;  3X1T A;  5CP6 B;  1P3F C;  3TU4 B;  2Y2G A;  2IO5 C;  5B0Y A;  3A1I A;  3LEL A;  5BNV A;  5DNN D;  2CV5 B;  3AZK D;  2Y2J A;  3REL A;  5BT1 D;  3AN2 C;  5CPK D;  4WNN A;  5B32 D;  3LJA D;  1ULY A;  2BYK B;  4H9R B;  1P3O A;  2HIO B;  3V9R A;  4NE6 A;  5B1M D;  5F99 C;  4HGA B;  4J8U D;  4YS3 D;  2XD1 A;  5B32 A;  1M18 B;  1BFM A;  1P3B B;  4J8U B;  4YM6 A;  2J8P A;  5AY8 D;  1BH8 A;  4AWL C;  4R8P D;  1P3I A;  1P3B D;  3KXB C;  3WTP D;  3X1V B;  1HTA A;  3WA9 B;  1M1A D;  4H9S A;  3AV1 A;  4KHA A;  4Z66 B;  3AZL D;  1ZLA B;  3EPH A;  4J8V D;  4LD9 C;  3REJ C;  3REK C;  4DRB A;  5B33 B;  3KXB D;  3W99 A;  3AV2 A;  1P3K C;  2F8N B;  5KDM A;  3LEL C;  3REK B;  1TZY A;  4G92 B;  3WTP A;  3MGP D;  3UTB B;  3W96 B;  4WU9 A;  2PYO C;  3B0B A;  3WKJ C;  3REK D;  1KX4 A;  3WA9 C;  1B67 A;  3UTB D;  3W96 D;  1Q9C A;  1P34 B;  5B2I A;  5AV6 D;  3AZH B;  1F66 C;  3KXB A;  5F99 A;  2DF4 C;  4H9N A;  5DNM D;  3KSY A;  1TZY D;  3AZI B;  3W96 C;  3UTB C;  4WU8 C;  3IP4 C;  5B40 C;  1P3M D;  4UUZ A;  3REH A;  1KX4 D;  3KWQ B;  1P3A B;  5AV8 B;  5E5A A;  3LZ0 D;  1F66 D;  4J8W D;  2ZY3 A;  3KWQ D;  1P3A D;  3LZ0 B;  3AZM B;  5AV6 A;  3AZE C;  5CPK B;  5B2J C;  3TU4 C;  3REH D;  2ZY2 A;  4ZUX A;  3REJ D;  3AYW A;  1F66 A;  5GT3 B;  3X1T B;  5AV5 D;  2HIO D;  4YM6 C;  2F8N G;  2ARO A;  2VQR A;  5B32 C;  3A6N A;  1U35 A;  4XUJ C;  3AZN A;  3MNN C;  5DNN C;  3REH C;  3REI B;  3MVD A;  3MNN A;  3REL B;  1ID3 A;  4WNN B;  1M18 D;  5B0Z A;  1WWI A;  3VH6 A;  3UT9 A;  1PZR A;  3AYW D;  2PYO D;  5BS7 C;  4X23 C;  1KX5 B;  3WA9 D;  5GXQ D;  1P3L A;  3B6F A;  3B6G B;  1M1A B;  5CPJ C;  2RVQ C;  1KX5 D;  4JJN A;  5GT3 C;  1U35 D;  3O62 B;  5JRG A;  3X1S A;  3LZ1 B;  3WKJ A;  1H3O B;  1HQ3 A;  5B0Z D;  5B33 D;  1HQ3 C;  4DQY B;  1TZY C;  5CPI C;  5AY8 C;  1M1A C;  4XZQ C;  2Y2M A;  3C1B D;  1P3I B;  1KX5 C;  2ZY4 A;  3WA9 A;  4CAY B;  3AFA A;  3AZG D;  1AOI D;  3LZ0 C;  3WAA A;  5DNN A;  3EPK A;  2ZM5 A;  4J8V C;  5BNX A;  3W99 D;  3W97 B;  3UT9 C;  5B2J D;  3X1U B;  3UTA B;  1EQZ D;  5B33 A;  5GT0 C;  3MGP C;  1P3O D;  3W97 D;  3W99 B;  3AZG C;  1AOI C;  3REK A;  2LY8 A;  1P3F A;  4KUD A;  2F8N K;  5GSU C;  3A1K A;  1A7W A;  3KUY D;  2BYM A;  4YS3 A;  1KX3 A;  2NZD A;  5AV8 D;  3MGQ A;  2BG1 A;  4X23 A;  4YM6 D;  5B1M C;  5F99 D;  5B31 A;  4R8P A;  5B2J A;  3P5J B;  4H9P B;  4H9N B;  1T3U A;  3W98 B;  5JA4 A;  3AV1 D;  4KUD D;  5B40 D;  1TAF B;  3KWQ C;  1P3A C;  4WJ3 C;  1KX3 D;  3KWQ A;  1P3A A;  5E5A B;  3R45 A;  5AV8 A;  4WV4 B;  5B40 B;  3MGQ D;  3REJ B;  4LD9 B;  4Z66 C;  3AV2 D;  2RVQ D;  3AZJ C;  4LD9 D;  1KU5 A;  1S32 B;  4KUD C;  3C1B C;  4EO5 C;  4Z5T B;  5B24 D;  3C1C A;  1M19 D;  4ZUX D;  5CP6 D;  4Z5T D;  5B24 B;  5AV5 A;  5B1L A;  3TU4 D;  3AZJ B;  3NQU B;  5B31 G;  4HGA C;  4H9O B;  2PYO B;  3W99 C;  5GT3 A;  3H0M C;  5AV9 A;  3A6N D;  5E5A C;  3AZN D;  3AZK B;  2HIO C;  3W97 C;  3MVD D;  3A6N B;  3VH5 W;  4XUJ D;  3LJA B;  5AV6 C;  3REI A;  4XZQ A;  3MVD B;  5B31 C;  1M19 A;  5GSU D;  1F1E A;  5DNM C;  2YFW A;  3VH5 T;  1ID3 B;  1ZLA C;  4H9Q A;  5B1M B;  3FDD A;  5AV9 D;  2IO5 B;  3LZ1 C;  4E45 A;  1W2E A;  5BNV B;  3EPL A;  2CV5 A;  5JRG B;  5CHL B;  3X1S B;  4XZQ D;  2FJ7 B;  5GSU A;  1H3O A;  3X1V D;  5B0Z C;  1P3O B;  2JCH A;  2FJ7 D;  5AVB C;  5G49 B;  4QLC B;  2HIO A;  4Z66 D;  4J8V B;  5FUG A;  4CAY A;  3WTP E;  3REL C;  3WAA B;  4KGC A;  5DNN B;  4R8P C;  3REI C;  3AZF A;  5AY8 A;  4CSR B;  2FFF B;  1P3O C;  5B32 B;  1M18 A;  1P3B A;  4YM6 B;  4ZUX C;  2FJ7 C;  3UT9 D;  4Z2M H;  3AFA C;  3X1U A;  5AVC B;  5JRG C;  1P3F D;  3AZL C;  5GT0 D;  3AZL A;  1N1J A;  1P3F B;  5CP6 C;  1P3G A;  2NZD D;  4KHA B;  4WU9 C;  1P34 D;  4X23 D;  5CPJ B;  2RIQ A;  3B6G C;  3AZH D;  4J8X D;  5CPJ D;  4Z2M G;  4X23 B;  3AZM C;  5B31 B;  3MVD C;  4R8P B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...