3REHD

2.5 angstrom crystal structure of the nucleosome core particle assembled with a 145 bp alpha-satellite dna (ncp145)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
95
structure length
95
Chain Sequence
KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Specific DNA structural attributes modulate platinum anticancer drug site selection and cross-link generation.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 39
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-04-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3rehD00
3C1BC 2NQBD 1KX3A 2F8NK 3KWQC 4YS3A 1P3AC 5AV9C 1P3GC 4H9RA 3MGRC 4G92B 2HIOA 3MGPA 5CPID 1P34B 3AV1B 3B6FC 4XZQA 3TU4B 1KX3B 4YS3B 1JFIA 4H9RB 3LELD 2HIOB 3VH6T 5BS7A 4XZQB 1U35A 5B24C 4R8PC 5CPKC 5FUGA 5AVCC 1KX5C 4LD9B 3X1SD 1S32B 3MNND 3VH5T 3X1UA 5GT3C 1ZLAB 3AZKC 4ZUXC 4AWLC 3AYWA 2AROA 5FUGB 5E5AA 1M19D 5B40C 3WA9A 5AY8A 1M1AD 5B0YA 3B6GC 2AROB 3UTBD 5E5AB 4NE5A 3WA9B 5AY8B 1M18C 1P3OA 5B2JC 3X1TA 3W97C 4KGCB 5CP6B 4WZSB 3MGQA 3WTPB 1P3PC 3REHD 2F8NB 3REIA 2CV5D 3AZEB 3AZID 3X1TB 3W98B 3X1VD 4G92C 1P34C 3AV1C 5AV6D 2HUEB 2BYMB 1HQ3A 1EQZA 3LZ1A 4Z66A 3TU4C 3AV2D 3LJAA 1KX3C 5B1MA 4YS3C 3REIB 4WNNA 4YM6D 3W96A 1P3KB 3MGPC 1P3MB 4XZQC 4M6BA 4WU9D 3UTAD 3AZJA 1EQZB 3LZ1B 3LJAB 1P3BD 5B1MB 3AN2D 4WNNB 3W96B 5AV5D 3B0BA 5BS7C 5DNND 1R4VA 3AFAD 3AZJB 5B32D 1U35C 5C3IB 4JJNA 1WWIA 4CSRA 4H9QA 1P3FA 1HTAA 4E45A 3RELA 3O62A 5AVBB 3X1UC 2FJ7D 4XUJD 5B31D 3AYWC 4JJNB 3MVDA 2AROC 1BH9A 3WAAA 5E5AC 3WA9C 1P3FB 5AY8C 5B2ID 3RELB 3O62B 2NQBA 5B0YC 3MVDB 1BH9B 3WAAB 3AZFA 5CPIA 5GT0B 2NZDA 5G49A 1P3OC 4UUZB 2PYOD 5BNXA 1Q9CA 3C1CD 2NQBB 3X1TC 4X23D 1ULYA 3MGQC 5CPIB 5G49B 5BNXB 4J8XD 3REIC 1AOID 1P3ID 3LELB 3REKA 5CHLB 3MNNA 4H9NA 1HQ3C 2RVQC 3LZ1C 4Z66C 1EQZC 5B1MC 5CPJA 3W96C 5JRGD 4ZBJB 4CAYA 3LZ0D 3MNNB 4H9NB 3AZJC 3AZHA 1TAFA 3UTBA 1M19B 1M1AB 3AZLD 4JJNC 2YFVB 1TAFB 3UTBB 5BT1C 1P3FC 3UT9D 3REHA 3WKJD 4HGAB 1KU5A 3RELC 4J8UC 3O62C 5DNMD 3X1VA 3REHB 4Z5TD 3AV2A 2NQBC 3KXBA 2CV5B 3AZMC 5BO0B 3KUYC 5AV8D 4LD9A 3C1BD 1S32A 3X1VB 3AZFC 5CPIC 5AV9D 1P3GD 5AV6B 1ZLAA 2NZDC 3MGRD 3UTAA 3AV2B 3B6FD 5GSUD 3KXBB 4J8VD 3AN2A 4YM6B 5GXQD 5AV5A 3NQUA 3UTAB 4WU9B 3AN2B 4H9OB 5B24D 4R8PD 5AV5B 3REKC 4ZBJC 3NQUB 5DNNB 5AVCD 3MNNC 3AFAB 1KX5D 2FJ7A 4XUJA 5B32B 5B31A 4KGCA 5CP6A 5CPJC 3WTPA 2F8NA 4ZUXD 5B2IA 3AZEA 3W98A 3AZHC 1TZYD 4XUJB 2FJ7B 5B31B 5JA4B 3WTPE 3UTBC 2BYMA 3B6GD 4HGAC 5B2IB 4KUDD 1P3KA 1P3MA 4X23A 5F99D 4G91B 3MGSD 3REHC 2PYOB 3C1CB 4QLCD 2HIOC 1AOIA 4X23B 1A7WA 5B31G 2F8NG 3AV2C 4J8XB 3KXBC 4LD9C 1BH8A 1AOIB 1S32C 1P3IB 5AVBA 5JRGA 3LZ0A 1ZLAC 1F1EA 3UTAC 1P3LD 3MGPD 3AN2C 1ID3D 1BH8B 5AV5C 5JRGB 3LZ0B 3AZLA 3R45A 5GT0A 3A6ND 1U35D 5BNVB 4EO5B 4UUZA 3WKJA 3B0DB 3AZLB 3R45B 5B1LD 4XUJC 2FJ7C 3NQJB 5B31C 5CP6C 1F66D 4KGCC 3X1UD 3WTPC 3AYWD 2L5AA 3UT9B 3WKJB 4Z5TA 3AZEC 3AZGD 3W98C 5DNMB 5AV8A 4H9PA 3LELA 2BYKA 5B0YD 2HUEC 5AV9A 3AZND 3B0CT 3REJD 4Z5TB 1H3OB 5GSUA 4J8VA 1P3OD 5B0ZD 1P3KC 5AV8B 4H9PB 5GXQA 3C1BB 1P3MC 1KX4D 2BYKB 3X1SA 4X23C 3X1TD 5B33D 5AV9B 1P3GB 3MGRB 3LJAC 3W99D 3MGQD 4Z2MG 5GSUB 4J8VB 1M19A 5GXQB 1AOIC 2JSSA 5B24A 3X1SB 1M1AA 4H9SA 5C3IC 4WU8D 4J8WD 2YFVA 1HQ3D 2RVQD 4Z66D 5B1MD 5B24B 4R8PB 5AVBC 5JRGC 3LZ0C 5AVCB 1KX5B 1TZYA 4EO5C 4ZUXB 3B0DC 1BFMA 4NE3A 2CV5A 5BO0A 4KUDA 3AZIA 3AZLC 3MVDC 1N1JB 1TZYB 3WAAC 2F8NH 5GT0C 5AV6A 3B6GB 5F99A 3MGSA 3WKJC 4KUDB 4YM6A 3AZIB 3RELD 4QLCA 4NFTA 4J8UD 3KWQD 1P3AD 4DRBA 2IO5B 4WU9A 5F99B 3MGSB 4Z5TC 1P3BA 4H9OA 4QLCB 5AV8C 3LELC 5DNNA 3AZMD 3AFAA 3KUYD 5B32A 3AZFD 1P3LA 1P3BB 2NZDD 5GSUC 4J8VC 1ID3A 5GXQC 5CPKD 3X1SC 1P3LB 3MGPB 5JA4A 5GT3D 3AZKD 1M19C 1ID3B 3A6NA 1M1AC 5KDMA 5B40D 1JFIB 4H9SC 3REKD 5B1LA 1F66A 3KSYA 3A6NB 1U35B 5CPJD 4WV4B 2PYOA 5KDMB 3C1CA 1M18D 3AZGA 5B2JD 1TZYC 5B1LB 5B32G 1F66B 3X1UB 4Z2MH 3AZHD 3W97D 3AYWB 3AZNA 1P3PD 4J8XA 3REJA 2CV5C 4KUDC 3AZIC 3AZGB 1P3IA 5B0ZA 3X1VC 1KX4A 2IO5C 5AV6C 5B0YB 5B33A 5F99C 3AZNB 3MGSC 3AV1D 1P34D 3REJB 3W99A 4YM6C 3TU4D 4QLCC 1P3OB 1KX3D 5B0ZB 4YS3D 1KX4B 2YFWA 1B67A 2HIOD 3B0CW 5B33B 4WU9C 4XZQD 4WU8A 3MGQB 1P3BC 4J8WA 3W99B 5BNVA 3KXBD 5DNNC 2YFWB 3AFAC 4LD9D 1S32D 5B32C 3NQJA 1P3LC 4WU8B 1ZLAD 4J8WB 1HQ3B 4Z66B 1ID3C 3UT9A 2LY8A 4E44A 1WWSA 5DNMA 4KHAA 4NE6A 2AROD 3A6NC 5E5AD 5B2IC 3V9RA 2CWEA 3WA9D 1H3OA 5AY8D 5B1LC 3C1BA 4KHAB 4J8UA 3KWQA 1P3AA 1F66C 1P3GA 4G91C 3MGRA 5CP6D 4KGCD 3V9RB 3WTPD 2PYOC 4CSRB 2F8ND 3C1CC 4H9QB 3B6FA 3AZGC 4J8UB 3KWQB 1P3AB 3AZED 3W98D 3AZMA 3KUYA 3AZNC 4J8XC 3REJC 3B6FB 1P3IC 5B0ZC 3REID 4R8PA 1KX4C 5CPKA 3AZMB 5AVCA 3KUYB 1P3KD 5B33C 1P3MD 1KX5A 3AZFB 3W99C 1EQZD 5GT3A 3LZ1D 2NZDB 3AZKA 3LJAD 4ZUXA 5CPKB 4DRAA 3W96D 5B40A 1N1JA 4WU8C 4J8WC 3AZJD 5GT3B 3AZKB 4AWLB 3B6GA 1B6WA 3VH6A 5B40B 3VH6W 1M18A 5B2JA 5AVBD 3REKB 4JJND 3UT9C 3W97A 5CPJB 5BT1D 1P3FD 1P3PA 1M18B 5DNMC 3VH5A 5B2JB 3O62D 3VH5W 4CAYB 3MVDD 3AZHB 3WAAD 3W97B 1P34A 3AV1A 5GT0D 1P3PB 3TU4A
chains in the Genus database with same CATH superfamily
3C1BC 2NQBD 1KX3A 2F8NK 3KWQC 4YS3A 1P3AC 5AV9C 1P3GC 4H9RA 3MGRC 4G92B 2HIOA 3MGPA 5CPID 1P34B 3AV1B 3B6FC 4XZQA 2Y2KA 3TU4B 1KX3B 4YS3B 1JFIA 4H9RB 3LELD 2HIOB 3VH6T 5BS7A 4XZQB 1U35A 5B24C 4R8PC 2G5HC 5CPKC 5FUGA 2JCHA 5AVCC 1KX5C 4LD9B 3X1SD 1S32B 2W8SA 3MNND 3VH5T 3X1UA 5GT3C 1ZLAB 2Y2IA 3AZKC 2ZY2A 4ZUXC 4AWLC 3AYWA 2AROA 5FUGB 5E5AA 1M19D 5B40C 3WA9A 5AY8A 1M1AD 5B0YA 3B6GC 2AROB 3UTBD 5E5AB 4NE5A 3WA9B 5AY8B 1M18C 1P3OA 2RIQA 5B2JC 3X1TA 3W97C 4KGCB 5CP6B 4WZSB 3MGQA 3WTPB 1P3PC 3REHD 2F8NB 3EPKA 3REIA 2CV5D 3AZEB 3AZID 1Z2CB 3X1TB 3W98B 3X1VD 4G92C 1P34C 3AV1C 5AV6D 2HUEB 2BYMB 1HQ3A 1EQZA 3LZ1A 4Z66A 3TU4C 3AV2D 3LJAA 1KX3C 5B1MA 4YS3C 3REIB 4WNNA 4YM6D 2VQRA 3W96A 1P3KB 3MGPC 1P3MB 4XZQC 4M6BA 4WU9D 3UTAD 3AZJA 1EQZB 3LZ1B 3LJAB 1P3BD 5B1MB 3AN2D 4WNNB 3W96B 5AV5D 3B0BA 5BS7C 5DNND 1R4VA 3AFAD 3AZJB 2ZY5A 5B32D 1U35C 5C3IB 4JJNA 1WWIA 4CSRA 2DF4C 4H9QA 2XD1A 1P3FA 1HTAA 4E45A 3RELA 3O62A 2JE5A 5AVBB 3X1UC 2FJ7D 4XUJD 5B31D 3AYWC 2UWXA 4JJNB 3MVDA 2AROC 1BH9A 3WAAA 5E5AC 3A1KA 3WA9C 1P3FB 5AY8C 5B2ID 3RELB 3O62B 2NQBA 5B0YC 3MVDB 1BH9B 3H0MC 3WAAB 3AZFA 5CPIA 5GT0B 2NZDA 5G49A 1P3OC 4UUZB 2PYOD 5BNXA 1Q9CA 3C1CD 2NQBB 3X1TC 4X23D 1ULYA 3MGQC 5CPIB 5G49B 5BNXB 4J8XD 3REIC 1AOID 1P3ID 3LELB 3REKA 2BG1A 5CHLB 3MNNA 4H9NA 1HQ3C 2RVQC 3LZ1C 4Z66C 1EQZC 5B1MC 5CPJA 3W96C 5JRGD 2Y2QA 4ZBJB 4CAYA 3LZ0D 3MNNB 4H9NB 3AZJC 2Y2LA 3AZHA 3KFUG 1TAFA 3UTBA 1M19B 1M1AB 3AZLD 4JJNC 1T3UA 2YFVB 1TAFB 3UTBB 5BT1C 1P3FC 3UT9D 3REHA 3WKJD 4HGAB 1KU5A 3RELC 4J8UC 3O62C 2XD5A 5DNMD 3X1VA 3REHB 4Z5TD 3AV2A 2NQBC 3KXBA 2CV5B 3AZMC 5BO0B 3KUYC 5AV8D 4LD9A 3C1BD 1S32A 3X1VB 3AZFC 5CPIC 5AV9D 1P3GD 5AV6B 1ZLAA 2NZDC 3MGRD 3UTAA 2Y2MA 3AV2B 3B6FD 5GSUD 3KXBB 4J8VD 3AN2A 4YM6B 5GXQD 2Y2JA 5AV5A 3NQUA 3UTAB 4WU9B 2ZM5A 3AN2B 4H9OB 5B24D 4R8PD 5AV5B 3REKC 4ZBJC 3NQUB 5DNNB 5AVCD 3MNNC 3AFAB 1KX5D 2FJ7A 4XUJA 5B32B 5B31A 4KGCA 5CP6A 5CPJC 3WTPA 2F8NA 4ZUXD 5B2IA 3AZEA 3W98A 3AZHC 1TZYD 4XUJB 2FJ7B 5B31B 5JA4B 3WTPE 3UTBC 2BYMA 3B6GD 4HGAC 5B2IB 4KUDD 1P3KA 1P3MA 4X23A 3FDDA 5F99D 4G91B 3MGSD 3REHC 3EPHA 2PYOB 2F2AC 3C1CB 4QLCD 2HIOC 3H0RC 1AOIA 1W2EA 4X23B 1A7WA 5B31G 2Y2GA 2F8NG 3AV2C 4J8XB 3KXBC 1PZRA 4LD9C 1BH8A 1AOIB 1S32C 1P3IB 3IP4C 5AVBA 5JRGA 3LZ0A 1ZLAC 1F1EA 3UTAC 1P3LD 3MGPD 3AN2C 1ID3D 1BH8B 5AV5C 5JRGB 3LZ0B 3AL0C 3AZLA 3R45A 5GT0A 3A6ND 1U35D 5BNVB 4EO5B 4UUZA 3WKJA 3B0DB 3AZLB 3R45B 5B1LD 4XUJC 2FJ7C 3NQJB 5B31C 5CP6C 1F66D 4KGCC 3X1UD 2Y2PA 3WTPC 2G5IC 3AYWD 2L5AA 3UT9B 2Y2OA 3F6TA 3WKJB 4Z5TA 3AZEC 3AZGD 3W98C 5DNMB 5AV8A 4H9PA 3LELA 2BYKA 5B0YD 2HUEC 5AV9A 3AZND 3B0CT 3REJD 4Z5TB 1H3OB 5GSUA 4J8VA 1P3OD 5B0ZD 1P3KC 5AV8B 4H9PB 5GXQA 3C1BB 1P3MC 1KX4D 2BYKB 3X1SA 4X23C 3X1TD 5B33D 5AV9B 1P3GB 3MGRB 3LJAC 3W99D 3MGQD 4Z2MG 5GSUB 4J8VB 1M19A 5GXQB 1AOIC 2JSSA 5B24A 3X1SB 1M1AA 4H9SA 5C3IC 4WU8D 4J8WD 2YFVA 1HQ3D 2RVQD 4Z66D 5B1MD 5B24B 4R8PB 5AVBC 5JRGC 3LZ0C 5AVCB 1KX5B 1TZYA 4EO5C 4ZUXB 3B0DC 1BFMA 4NE3A 2CV5A 5BO0A 4KUDA 3AZIA 3AZLC 3MVDC 1N1JB 1TZYB 3WAAC 2F8NH 5GT0C 5AV6A 3B6GB 5F99A 3MGSA 3WKJC 3H0LC 4KUDB 4YM6A 4UPKA 3AZIB 3RELD 4QLCA 4NFTA 4J8UD 3KWQD 1P3AD 4DRBA 2IO5B 4WU9A 5F99B 3MGSB 4Z5TC 1P3BA 4H9OA 4QLCB 5AV8C 3LELC 5DNNA 3AZMD 3AFAA 3KUYD 5B32A 3AZFD 1P3LA 1P3BB 2NZDD 5GSUC 2FFFB 4J8VC 1ID3A 5GXQC 5CPKD 3X1SC 1P3LB 3MGPB 5JA4A 5GT3D 3AZKD 1M19C 1ID3B 3A6NA 1M1AC 5KDMA 5B40D 1JFIB 4H9SC 3EG5B 4DQYB 5B1LA 3REKD 1F66A 3KSYA 3A6NB 1U35B 5CPJD 4WV4B 2PYOA 5KDMB 3C1CA 1M18D 3AZGA 5B2JD 1TZYC 5B1LB 5B32G 1F66B 3X1UB 4Z2MH 3AZHD 3W97D 3AYWB 3AZNA 1P3PD 4J8XA 3REJA 2CV5C 4KUDC 3AZIC 3AZGB 1P3IA 3A1IA 5B0ZA 3X1VC 1KX4A 2IO5C 5AV6C 5B0YB 5B33A 5F99C 3AZNB 3MGSC 3AV1D 1P34D 4WJ3C 3REJB 3W99A 4YM6C 3TU4D 4QLCC 1P3OB 1KX3D 5B0ZB 4YS3D 1KX4B 2YFWA 1B67A 2HIOD 3B0CW 5B33B 4WU9C 4XZQD 4WU8A 3MGQB 1P3BC 4J8WA 3W99B 5BNVA 3KXBD 5DNNC 2YFWB 3AFAC 4LD9D 1S32D 5B32C 3NQJA 1P3LC 4WU8B 1ZLAD 4J8WB 1HQ3B 4Z66B 1ID3C 3UT9A 2LY8A 4E44A 1WWSA 5DNMA 2Y2HA 4KHAA 4NE6A 2AROD 3A6NC 5E5AD 5B2IC 3V9RA 2CWEA 2Y2NA 3WA9D 1H3OA 5AY8D 5B1LC 3C1BA 4KHAB 4J8UA 3KWQA 1P3AA 1F66C 1P3GA 4G91C 3MGRA 5CP6D 4KGCD 3V9RB 3WTPD 2PYOC 2DQNC 4CSRB 2F8ND 3C1CC 4H9QB 3B6FA 3AZGC 4J8UB 3KWQB 1P3AB 3AZED 3W98D 3AZMA 3KUYA 3AZNC 4J8XC 3REJC 3B6FB 1P3IC 5B0ZC 3REID 4R8PA 1KX4C 5CPKA 3AZMB 5AVCA 3KUYB 1P3KD 5B33C 1P3MD 1KX5A 3AZFB 3W99C 1EQZD 5GT3A 3LZ1D 2NZDB 3AZKA 3LJAD 4ZUXA 2ZY4A 5CPKB 4DRAA 3W96D 5B40A 1N1JA 4WU8C 4J8WC 3AZJD 5GT3B 3AZKB 4AWLB 3B6GA 1B6WA 3VH6A 5B40B 3VH6W 1M18A 5B2JA 5AVBD 3REKB 3EPJA 2ZY3A 2J8PA 4JJND 3UT9C 3W97A 5CPJB 5BT1D 1P3FD 1P3PA 1M18B 5DNMC 3VH5A 5B2JB 3O62D 3VH5W 4CAYB 3P5JB 3MVDD 3AZHB 3WAAD 3EPLA 3W97B 1P34A 3AV1A 5GT0D 1P3PB 3TU4A
chains in the Genus database with same CATH topology
3C1BC 2NQBD 1KX3A 2F8NK 3KWQC 4YS3A 1P3AC 5AV9C 1P3GC 4H9RA 3MGRC 4G92B 2HIOA 3MGPA 5CPID 1P34B 3AV1B 3B6FC 4XZQA 2Y2KA 3TU4B 1KX3B 4YS3B 1JFIA 4H9RB 3LELD 2HIOB 3VH6T 5BS7A 4XZQB 1U35A 5B24C 4R8PC 2G5HC 5CPKC 5FUGA 2JCHA 5AVCC 1KX5C 4LD9B 3X1SD 1S32B 2W8SA 3MNND 3VH5T 3X1UA 5GT3C 1ZLAB 2Y2IA 3AZKC 2ZY2A 4ZUXC 4AWLC 3AYWA 2AROA 5FUGB 5E5AA 1M19D 5B40C 3WA9A 5AY8A 1M1AD 5B0YA 3B6GC 2AROB 3UTBD 5E5AB 4NE5A 3WA9B 5AY8B 1M18C 1P3OA 2RIQA 5B2JC 3X1TA 3W97C 4KGCB 5CP6B 4WZSB 3MGQA 3WTPB 1P3PC 3REHD 2F8NB 3EPKA 3REIA 2CV5D 3AZEB 3AZID 1Z2CB 3X1TB 3W98B 3X1VD 4G92C 1P34C 3AV1C 5AV6D 2HUEB 2BYMB 1HQ3A 1EQZA 3LZ1A 4Z66A 3TU4C 3AV2D 3LJAA 1KX3C 5B1MA 4YS3C 3REIB 4WNNA 4YM6D 2VQRA 3W96A 1P3KB 3MGPC 1P3MB 4XZQC 4M6BA 4WU9D 3UTAD 3AZJA 1EQZB 3LZ1B 3LJAB 1P3BD 5B1MB 3AN2D 4WNNB 3W96B 5AV5D 3B0BA 5BS7C 5DNND 1R4VA 3AFAD 3AZJB 2ZY5A 5B32D 1U35C 5C3IB 4JJNA 1WWIA 4CSRA 2DF4C 4H9QA 2XD1A 1P3FA 1HTAA 4E45A 3RELA 3O62A 2JE5A 5AVBB 3X1UC 2FJ7D 4XUJD 5B31D 3AYWC 2UWXA 4JJNB 3MVDA 2AROC 1BH9A 3WAAA 5E5AC 3A1KA 3WA9C 1P3FB 5AY8C 5B2ID 3RELB 3O62B 2NQBA 5B0YC 3MVDB 1BH9B 3H0MC 3WAAB 3AZFA 5CPIA 5GT0B 2NZDA 5G49A 1P3OC 4UUZB 2PYOD 5BNXA 1Q9CA 3C1CD 2NQBB 3X1TC 4X23D 1ULYA 3MGQC 5CPIB 5G49B 5BNXB 4J8XD 3REIC 1AOID 1P3ID 3LELB 3REKA 2BG1A 5CHLB 3MNNA 4H9NA 1HQ3C 2RVQC 3LZ1C 4Z66C 1EQZC 5B1MC 5CPJA 3W96C 5JRGD 2Y2QA 4ZBJB 4CAYA 3LZ0D 3MNNB 4H9NB 3AZJC 2Y2LA 3AZHA 3KFUG 1TAFA 3UTBA 1M19B 1M1AB 3AZLD 4JJNC 1T3UA 2YFVB 1TAFB 3UTBB 5BT1C 1P3FC 3UT9D 3REHA 3WKJD 4HGAB 1KU5A 3RELC 4J8UC 3O62C 2XD5A 5DNMD 3X1VA 3REHB 4Z5TD 3AV2A 2NQBC 3KXBA 2CV5B 3AZMC 5BO0B 3KUYC 5AV8D 4LD9A 3C1BD 1S32A 3X1VB 3AZFC 5CPIC 5AV9D 1P3GD 5AV6B 1ZLAA 2NZDC 3MGRD 3UTAA 2Y2MA 3AV2B 3B6FD 5GSUD 3KXBB 4J8VD 3AN2A 4YM6B 5GXQD 2Y2JA 5AV5A 3NQUA 3UTAB 4WU9B 2ZM5A 3AN2B 4H9OB 5B24D 4R8PD 5AV5B 3REKC 4ZBJC 3NQUB 5DNNB 5AVCD 3MNNC 3AFAB 1KX5D 2FJ7A 4XUJA 5B32B 5B31A 4KGCA 5CP6A 5CPJC 3WTPA 2F8NA 4ZUXD 5B2IA 3AZEA 3W98A 3AZHC 1TZYD 4XUJB 2FJ7B 5B31B 5JA4B 3WTPE 3UTBC 2BYMA 3B6GD 4HGAC 5B2IB 4KUDD 1P3KA 1P3MA 4X23A 3FDDA 5F99D 4G91B 3MGSD 3REHC 3EPHA 2PYOB 2F2AC 3C1CB 4QLCD 2HIOC 3H0RC 1AOIA 1W2EA 4X23B 1A7WA 5B31G 2Y2GA 2F8NG 3AV2C 4J8XB 3KXBC 1PZRA 4LD9C 1BH8A 1AOIB 1S32C 1P3IB 3IP4C 5AVBA 5JRGA 3LZ0A 1ZLAC 1F1EA 3UTAC 1P3LD 3MGPD 3AN2C 1ID3D 1BH8B 5AV5C 5JRGB 3LZ0B 3AL0C 3AZLA 3R45A 5GT0A 3A6ND 1U35D 5BNVB 4EO5B 4UUZA 3WKJA 3B0DB 3AZLB 3R45B 5B1LD 4XUJC 2FJ7C 3NQJB 5B31C 5CP6C 1F66D 4KGCC 3X1UD 2Y2PA 3WTPC 2G5IC 3AYWD 2L5AA 3UT9B 2Y2OA 3F6TA 3WKJB 4Z5TA 3AZEC 3AZGD 3W98C 5DNMB 5AV8A 4H9PA 3LELA 2BYKA 5B0YD 2HUEC 5AV9A 3AZND 3B0CT 3REJD 4Z5TB 1H3OB 5GSUA 4J8VA 1P3OD 5B0ZD 1P3KC 5AV8B 4H9PB 5GXQA 3C1BB 1P3MC 1KX4D 2BYKB 3X1SA 4X23C 3X1TD 5B33D 5AV9B 1P3GB 3MGRB 3LJAC 3W99D 3MGQD 4Z2MG 5GSUB 4J8VB 1M19A 5GXQB 1AOIC 2JSSA 5B24A 3X1SB 1M1AA 4H9SA 5C3IC 4WU8D 4J8WD 2YFVA 1HQ3D 2RVQD 4Z66D 5B1MD 5B24B 4R8PB 5AVBC 5JRGC 3LZ0C 5AVCB 1KX5B 1TZYA 4EO5C 4ZUXB 3B0DC 1BFMA 4NE3A 2CV5A 5BO0A 4KUDA 3AZIA 3AZLC 3MVDC 1N1JB 1TZYB 3WAAC 2F8NH 5GT0C 5AV6A 3B6GB 5F99A 3MGSA 3WKJC 3H0LC 4KUDB 4YM6A 4UPKA 3AZIB 3RELD 4QLCA 4NFTA 4J8UD 3KWQD 1P3AD 4DRBA 2IO5B 4WU9A 5F99B 3MGSB 4Z5TC 1P3BA 4H9OA 4QLCB 5AV8C 3LELC 5DNNA 3AZMD 3AFAA 3KUYD 5B32A 3AZFD 1P3LA 1P3BB 2NZDD 5GSUC 2FFFB 4J8VC 1ID3A 5GXQC 5CPKD 3X1SC 1P3LB 3MGPB 5JA4A 5GT3D 3AZKD 1M19C 1ID3B 3A6NA 1M1AC 5KDMA 5B40D 1JFIB 4H9SC 3EG5B 4DQYB 5B1LA 3REKD 1F66A 3KSYA 3A6NB 1U35B 5CPJD 4WV4B 2PYOA 5KDMB 3C1CA 1M18D 3AZGA 5B2JD 1TZYC 5B1LB 5B32G 1F66B 3X1UB 4Z2MH 3AZHD 3W97D 3AYWB 3AZNA 1P3PD 4J8XA 3REJA 2CV5C 4KUDC 3AZIC 3AZGB 1P3IA 3A1IA 5B0ZA 3X1VC 1KX4A 2IO5C 5AV6C 5B0YB 5B33A 5F99C 3AZNB 3MGSC 3AV1D 1P34D 4WJ3C 3REJB 3W99A 4YM6C 3TU4D 4QLCC 1P3OB 1KX3D 5B0ZB 4YS3D 1KX4B 2YFWA 1B67A 2HIOD 3B0CW 5B33B 4WU9C 4XZQD 4WU8A 3MGQB 1P3BC 4J8WA 3W99B 5BNVA 3KXBD 5DNNC 2YFWB 3AFAC 4LD9D 1S32D 5B32C 3NQJA 1P3LC 4WU8B 1ZLAD 4J8WB 1HQ3B 4Z66B 1ID3C 3UT9A 2LY8A 4E44A 1WWSA 5DNMA 2Y2HA 4KHAA 4NE6A 2AROD 3A6NC 5E5AD 5B2IC 3V9RA 2CWEA 2Y2NA 3WA9D 1H3OA 5AY8D 5B1LC 3C1BA 4KHAB 4J8UA 3KWQA 1P3AA 1F66C 1P3GA 4G91C 3MGRA 5CP6D 4KGCD 3V9RB 3WTPD 2PYOC 2DQNC 4CSRB 2F8ND 3C1CC 4H9QB 3B6FA 3AZGC 4J8UB 3KWQB 1P3AB 3AZED 3W98D 3AZMA 3KUYA 3AZNC 4J8XC 3REJC 3B6FB 1P3IC 5B0ZC 3REID 4R8PA 1KX4C 5CPKA 3AZMB 5AVCA 3KUYB 1P3KD 5B33C 1P3MD 1KX5A 3AZFB 3W99C 1EQZD 5GT3A 3LZ1D 2NZDB 3AZKA 3LJAD 4ZUXA 2ZY4A 5CPKB 4DRAA 3W96D 5B40A 1N1JA 4WU8C 4J8WC 3AZJD 5GT3B 3AZKB 4AWLB 3B6GA 1B6WA 3VH6A 5B40B 3VH6W 1M18A 5B2JA 5AVBD 3REKB 3EPJA 2ZY3A 2J8PA 4JJND 3UT9C 3W97A 5CPJB 5BT1D 1P3FD 1P3PA 1M18B 5DNMC 3VH5A 5B2JB 3O62D 3VH5W 4CAYB 3P5JB 3MVDD 3AZHB 3WAAD 3EPLA 3W97B 1P34A 3AV1A 5GT0D 1P3PB 3TU4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C1B C;  2NQB D;  1KX3 A;  2F8N K;  3KWQ C;  4YS3 A;  1P3A C;  5AV9 C;  1P3G C;  4H9R A;  3MGR C;  4G92 B;  2HIO A;  3MGP A;  5CPI D;  1P34 B;  3AV1 B;  3B6F C;  4XZQ A;  3TU4 B;  1KX3 B;  4YS3 B;  1JFI A;  4H9R B;  3LEL D;  2HIO B;  3VH6 T;  5BS7 A;  4XZQ B;  1U35 A;  5B24 C;  4R8P C;  5CPK C;  5FUG A;  5AVC C;  1KX5 C;  4LD9 B;  3X1S D;  1S32 B;  3MNN D;  3VH5 T;  3X1U A;  5GT3 C;  1ZLA B;  3AZK C;  4ZUX C;  4AWL C;  3AYW A;  2ARO A;  5FUG B;  5E5A A;  1M19 D;  5B40 C;  3WA9 A;  5AY8 A;  1M1A D;  5B0Y A;  3B6G C;  2ARO B;  3UTB D;  5E5A B;  4NE5 A;  3WA9 B;  5AY8 B;  1M18 C;  1P3O A;  5B2J C;  3X1T A;  3W97 C;  4KGC B;  5CP6 B;  4WZS B;  3MGQ A;  3WTP B;  1P3P C;  3REH D;  2F8N B;  3REI A;  2CV5 D;  3AZE B;  3AZI D;  3X1T B;  3W98 B;  3X1V D;  4G92 C;  1P34 C;  3AV1 C;  5AV6 D;  2HUE B;  2BYM B;  1HQ3 A;  1EQZ A;  3LZ1 A;  4Z66 A;  3TU4 C;  3AV2 D;  3LJA A;  1KX3 C;  5B1M A;  4YS3 C;  3REI B;  4WNN A;  4YM6 D;  3W96 A;  1P3K B;  3MGP C;  1P3M B;  4XZQ C;  4M6B A;  4WU9 D;  3UTA D;  3AZJ A;  1EQZ B;  3LZ1 B;  3LJA B;  1P3B D;  5B1M B;  3AN2 D;  4WNN B;  3W96 B;  5AV5 D;  3B0B A;  5BS7 C;  5DNN D;  1R4V A;  3AFA D;  3AZJ B;  5B32 D;  1U35 C;  5C3I B;  4JJN A;  1WWI A;  4CSR A;  4H9Q A;  1P3F A;  1HTA A;  4E45 A;  3REL A;  3O62 A;  5AVB B;  3X1U C;  2FJ7 D;  4XUJ D;  5B31 D;  3AYW C;  4JJN B;  3MVD A;  2ARO C;  1BH9 A;  3WAA A;  5E5A C;  3WA9 C;  1P3F B;  5AY8 C;  5B2I D;  3REL B;  3O62 B;  2NQB A;  5B0Y C;  3MVD B;  1BH9 B;  3WAA B;  3AZF A;  5CPI A;  5GT0 B;  2NZD A;  5G49 A;  1P3O C;  4UUZ B;  2PYO D;  5BNX A;  1Q9C A;  3C1C D;  2NQB B;  3X1T C;  4X23 D;  1ULY A;  3MGQ C;  5CPI B;  5G49 B;  5BNX B;  4J8X D;  3REI C;  1AOI D;  1P3I D;  3LEL B;  3REK A;  5CHL B;  3MNN A;  4H9N A;  1HQ3 C;  2RVQ C;  3LZ1 C;  4Z66 C;  1EQZ C;  5B1M C;  5CPJ A;  3W96 C;  5JRG D;  4ZBJ B;  4CAY A;  3LZ0 D;  3MNN B;  4H9N B;  3AZJ C;  3AZH A;  1TAF A;  3UTB A;  1M19 B;  1M1A B;  3AZL D;  4JJN C;  2YFV B;  1TAF B;  3UTB B;  5BT1 C;  1P3F C;  3UT9 D;  3REH A;  3WKJ D;  4HGA B;  1KU5 A;  3REL C;  4J8U C;  3O62 C;  5DNM D;  3X1V A;  3REH B;  4Z5T D;  3AV2 A;  2NQB C;  3KXB A;  2CV5 B;  3AZM C;  5BO0 B;  3KUY C;  5AV8 D;  4LD9 A;  3C1B D;  1S32 A;  3X1V B;  3AZF C;  5CPI C;  5AV9 D;  1P3G D;  5AV6 B;  1ZLA A;  2NZD C;  3MGR D;  3UTA A;  3AV2 B;  3B6F D;  5GSU D;  3KXB B;  4J8V D;  3AN2 A;  4YM6 B;  5GXQ D;  5AV5 A;  3NQU A;  3UTA B;  4WU9 B;  3AN2 B;  4H9O B;  5B24 D;  4R8P D;  5AV5 B;  3REK C;  4ZBJ C;  3NQU B;  5DNN B;  5AVC D;  3MNN C;  3AFA B;  1KX5 D;  2FJ7 A;  4XUJ A;  5B32 B;  5B31 A;  4KGC A;  5CP6 A;  5CPJ C;  3WTP A;  2F8N A;  4ZUX D;  5B2I A;  3AZE A;  3W98 A;  3AZH C;  1TZY D;  4XUJ B;  2FJ7 B;  5B31 B;  5JA4 B;  3WTP E;  3UTB C;  2BYM A;  3B6G D;  4HGA C;  5B2I B;  4KUD D;  1P3K A;  1P3M A;  4X23 A;  5F99 D;  4G91 B;  3MGS D;  3REH C;  2PYO B;  3C1C B;  4QLC D;  2HIO C;  1AOI A;  4X23 B;  1A7W A;  5B31 G;  2F8N G;  3AV2 C;  4J8X B;  3KXB C;  4LD9 C;  1BH8 A;  1AOI B;  1S32 C;  1P3I B;  5AVB A;  5JRG A;  3LZ0 A;  1ZLA C;  1F1E A;  3UTA C;  1P3L D;  3MGP D;  3AN2 C;  1ID3 D;  1BH8 B;  5AV5 C;  5JRG B;  3LZ0 B;  3AZL A;  3R45 A;  5GT0 A;  3A6N D;  1U35 D;  5BNV B;  4EO5 B;  4UUZ A;  3WKJ A;  3B0D B;  3AZL B;  3R45 B;  5B1L D;  4XUJ C;  2FJ7 C;  3NQJ B;  5B31 C;  5CP6 C;  1F66 D;  4KGC C;  3X1U D;  3WTP C;  3AYW D;  2L5A A;  3UT9 B;  3WKJ B;  4Z5T A;  3AZE C;  3AZG D;  3W98 C;  5DNM B;  5AV8 A;  4H9P A;  3LEL A;  2BYK A;  5B0Y D;  2HUE C;  5AV9 A;  3AZN D;  3B0C T;  3REJ D;  4Z5T B;  1H3O B;  5GSU A;  4J8V A;  1P3O D;  5B0Z D;  1P3K C;  5AV8 B;  4H9P B;  5GXQ A;  3C1B B;  1P3M C;  1KX4 D;  2BYK B;  3X1S A;  4X23 C;  3X1T D;  5B33 D;  5AV9 B;  1P3G B;  3MGR B;  3LJA C;  3W99 D;  3MGQ D;  4Z2M G;  5GSU B;  4J8V B;  1M19 A;  5GXQ B;  1AOI C;  2JSS A;  5B24 A;  3X1S B;  1M1A A;  4H9S A;  5C3I C;  4WU8 D;  4J8W D;  2YFV A;  1HQ3 D;  2RVQ D;  4Z66 D;  5B1M D;  5B24 B;  4R8P B;  5AVB C;  5JRG C;  3LZ0 C;  5AVC B;  1KX5 B;  1TZY A;  4EO5 C;  4ZUX B;  3B0D C;  1BFM A;  4NE3 A;  2CV5 A;  5BO0 A;  4KUD A;  3AZI A;  3AZL C;  3MVD C;  1N1J B;  1TZY B;  3WAA C;  2F8N H;  5GT0 C;  5AV6 A;  3B6G B;  5F99 A;  3MGS A;  3WKJ C;  4KUD B;  4YM6 A;  3AZI B;  3REL D;  4QLC A;  4NFT A;  4J8U D;  3KWQ D;  1P3A D;  4DRB A;  2IO5 B;  4WU9 A;  5F99 B;  3MGS B;  4Z5T C;  1P3B A;  4H9O A;  4QLC B;  5AV8 C;  3LEL C;  5DNN A;  3AZM D;  3AFA A;  3KUY D;  5B32 A;  3AZF D;  1P3L A;  1P3B B;  2NZD D;  5GSU C;  4J8V C;  1ID3 A;  5GXQ C;  5CPK D;  3X1S C;  1P3L B;  3MGP B;  5JA4 A;  5GT3 D;  3AZK D;  1M19 C;  1ID3 B;  3A6N A;  1M1A C;  5KDM A;  5B40 D;  1JFI B;  4H9S C;  3REK D;  5B1L A;  1F66 A;  3KSY A;  3A6N B;  1U35 B;  5CPJ D;  4WV4 B;  2PYO A;  5KDM B;  3C1C A;  1M18 D;  3AZG A;  5B2J D;  1TZY C;  5B1L B;  5B32 G;  1F66 B;  3X1U B;  4Z2M H;  3AZH D;  3W97 D;  3AYW B;  3AZN A;  1P3P D;  4J8X A;  3REJ A;  2CV5 C;  4KUD C;  3AZI C;  3AZG B;  1P3I A;  5B0Z A;  3X1V C;  1KX4 A;  2IO5 C;  5AV6 C;  5B0Y B;  5B33 A;  5F99 C;  3AZN B;  3MGS C;  3AV1 D;  1P34 D;  3REJ B;  3W99 A;  4YM6 C;  3TU4 D;  4QLC C;  1P3O B;  1KX3 D;  5B0Z B;  4YS3 D;  1KX4 B;  2YFW A;  1B67 A;  2HIO D;  3B0C W;  5B33 B;  4WU9 C;  4XZQ D;  4WU8 A;  3MGQ B;  1P3B C;  4J8W A;  3W99 B;  5BNV A;  3KXB D;  5DNN C;  2YFW B;  3AFA C;  4LD9 D;  1S32 D;  5B32 C;  3NQJ A;  1P3L C;  4WU8 B;  1ZLA D;  4J8W B;  1HQ3 B;  4Z66 B;  1ID3 C;  3UT9 A;  2LY8 A;  4E44 A;  1WWS A;  5DNM A;  4KHA A;  4NE6 A;  2ARO D;  3A6N C;  5E5A D;  5B2I C;  3V9R A;  2CWE A;  3WA9 D;  1H3O A;  5AY8 D;  5B1L C;  3C1B A;  4KHA B;  4J8U A;  3KWQ A;  1P3A A;  1F66 C;  1P3G A;  4G91 C;  3MGR A;  5CP6 D;  4KGC D;  3V9R B;  3WTP D;  2PYO C;  4CSR B;  2F8N D;  3C1C C;  4H9Q B;  3B6F A;  3AZG C;  4J8U B;  3KWQ B;  1P3A B;  3AZE D;  3W98 D;  3AZM A;  3KUY A;  3AZN C;  4J8X C;  3REJ C;  3B6F B;  1P3I C;  5B0Z C;  3REI D;  4R8P A;  1KX4 C;  5CPK A;  3AZM B;  5AVC A;  3KUY B;  1P3K D;  5B33 C;  1P3M D;  1KX5 A;  3AZF B;  3W99 C;  1EQZ D;  5GT3 A;  3LZ1 D;  2NZD B;  3AZK A;  3LJA D;  4ZUX A;  5CPK B;  4DRA A;  3W96 D;  5B40 A;  1N1J A;  4WU8 C;  4J8W C;  3AZJ D;  5GT3 B;  3AZK B;  4AWL B;  3B6G A;  1B6W A;  3VH6 A;  5B40 B;  3VH6 W;  1M18 A;  5B2J A;  5AVB D;  3REK B;  4JJN D;  3UT9 C;  3W97 A;  5CPJ B;  5BT1 D;  1P3F D;  1P3P A;  1M18 B;  5DNM C;  3VH5 A;  5B2J B;  3O62 D;  3VH5 W;  4CAY B;  3MVD D;  3AZH B;  3WAA D;  3W97 B;  1P34 A;  3AV1 A;  5GT0 D;  1P3P B;  3TU4 A; 
#chains in the Genus database with same CATH topology
 3C1B C;  2NQB D;  1KX3 A;  2F8N K;  3KWQ C;  4YS3 A;  1P3A C;  5AV9 C;  1P3G C;  4H9R A;  3MGR C;  4G92 B;  2HIO A;  3MGP A;  5CPI D;  1P34 B;  3AV1 B;  3B6F C;  4XZQ A;  2Y2K A;  3TU4 B;  1KX3 B;  4YS3 B;  1JFI A;  4H9R B;  3LEL D;  2HIO B;  3VH6 T;  5BS7 A;  4XZQ B;  1U35 A;  5B24 C;  4R8P C;  2G5H C;  5CPK C;  5FUG A;  2JCH A;  5AVC C;  1KX5 C;  4LD9 B;  3X1S D;  1S32 B;  2W8S A;  3MNN D;  3VH5 T;  3X1U A;  5GT3 C;  1ZLA B;  2Y2I A;  3AZK C;  2ZY2 A;  4ZUX C;  4AWL C;  3AYW A;  2ARO A;  5FUG B;  5E5A A;  1M19 D;  5B40 C;  3WA9 A;  5AY8 A;  1M1A D;  5B0Y A;  3B6G C;  2ARO B;  3UTB D;  5E5A B;  4NE5 A;  3WA9 B;  5AY8 B;  1M18 C;  1P3O A;  2RIQ A;  5B2J C;  3X1T A;  3W97 C;  4KGC B;  5CP6 B;  4WZS B;  3MGQ A;  3WTP B;  1P3P C;  3REH D;  2F8N B;  3EPK A;  3REI A;  2CV5 D;  3AZE B;  3AZI D;  1Z2C B;  3X1T B;  3W98 B;  3X1V D;  4G92 C;  1P34 C;  3AV1 C;  5AV6 D;  2HUE B;  2BYM B;  1HQ3 A;  1EQZ A;  3LZ1 A;  4Z66 A;  3TU4 C;  3AV2 D;  3LJA A;  1KX3 C;  5B1M A;  4YS3 C;  3REI B;  4WNN A;  4YM6 D;  2VQR A;  3W96 A;  1P3K B;  3MGP C;  1P3M B;  4XZQ C;  4M6B A;  4WU9 D;  3UTA D;  3AZJ A;  1EQZ B;  3LZ1 B;  3LJA B;  1P3B D;  5B1M B;  3AN2 D;  4WNN B;  3W96 B;  5AV5 D;  3B0B A;  5BS7 C;  5DNN D;  1R4V A;  3AFA D;  3AZJ B;  2ZY5 A;  5B32 D;  1U35 C;  5C3I B;  4JJN A;  1WWI A;  4CSR A;  2DF4 C;  4H9Q A;  2XD1 A;  1P3F A;  1HTA A;  4E45 A;  3REL A;  3O62 A;  2JE5 A;  5AVB B;  3X1U C;  2FJ7 D;  4XUJ D;  5B31 D;  3AYW C;  2UWX A;  4JJN B;  3MVD A;  2ARO C;  1BH9 A;  3WAA A;  5E5A C;  3A1K A;  3WA9 C;  1P3F B;  5AY8 C;  5B2I D;  3REL B;  3O62 B;  2NQB A;  5B0Y C;  3MVD B;  1BH9 B;  3H0M C;  3WAA B;  3AZF A;  5CPI A;  5GT0 B;  2NZD A;  5G49 A;  1P3O C;  4UUZ B;  2PYO D;  5BNX A;  1Q9C A;  3C1C D;  2NQB B;  3X1T C;  4X23 D;  1ULY A;  3MGQ C;  5CPI B;  5G49 B;  5BNX B;  4J8X D;  3REI C;  1AOI D;  1P3I D;  3LEL B;  3REK A;  2BG1 A;  5CHL B;  3MNN A;  4H9N A;  1HQ3 C;  2RVQ C;  3LZ1 C;  4Z66 C;  1EQZ C;  5B1M C;  5CPJ A;  3W96 C;  5JRG D;  2Y2Q A;  4ZBJ B;  4CAY A;  3LZ0 D;  3MNN B;  4H9N B;  3AZJ C;  2Y2L A;  3AZH A;  3KFU G;  1TAF A;  3UTB A;  1M19 B;  1M1A B;  3AZL D;  4JJN C;  1T3U A;  2YFV B;  1TAF B;  3UTB B;  5BT1 C;  1P3F C;  3UT9 D;  3REH A;  3WKJ D;  4HGA B;  1KU5 A;  3REL C;  4J8U C;  3O62 C;  2XD5 A;  5DNM D;  3X1V A;  3REH B;  4Z5T D;  3AV2 A;  2NQB C;  3KXB A;  2CV5 B;  3AZM C;  5BO0 B;  3KUY C;  5AV8 D;  4LD9 A;  3C1B D;  1S32 A;  3X1V B;  3AZF C;  5CPI C;  5AV9 D;  1P3G D;  5AV6 B;  1ZLA A;  2NZD C;  3MGR D;  3UTA A;  2Y2M A;  3AV2 B;  3B6F D;  5GSU D;  3KXB B;  4J8V D;  3AN2 A;  4YM6 B;  5GXQ D;  2Y2J A;  5AV5 A;  3NQU A;  3UTA B;  4WU9 B;  2ZM5 A;  3AN2 B;  4H9O B;  5B24 D;  4R8P D;  5AV5 B;  3REK C;  4ZBJ C;  3NQU B;  5DNN B;  5AVC D;  3MNN C;  3AFA B;  1KX5 D;  2FJ7 A;  4XUJ A;  5B32 B;  5B31 A;  4KGC A;  5CP6 A;  5CPJ C;  3WTP A;  2F8N A;  4ZUX D;  5B2I A;  3AZE A;  3W98 A;  3AZH C;  1TZY D;  4XUJ B;  2FJ7 B;  5B31 B;  5JA4 B;  3WTP E;  3UTB C;  2BYM A;  3B6G D;  4HGA C;  5B2I B;  4KUD D;  1P3K A;  1P3M A;  4X23 A;  3FDD A;  5F99 D;  4G91 B;  3MGS D;  3REH C;  3EPH A;  2PYO B;  2F2A C;  3C1C B;  4QLC D;  2HIO C;  3H0R C;  1AOI A;  1W2E A;  4X23 B;  1A7W A;  5B31 G;  2Y2G A;  2F8N G;  3AV2 C;  4J8X B;  3KXB C;  1PZR A;  4LD9 C;  1BH8 A;  1AOI B;  1S32 C;  1P3I B;  3IP4 C;  5AVB A;  5JRG A;  3LZ0 A;  1ZLA C;  1F1E A;  3UTA C;  1P3L D;  3MGP D;  3AN2 C;  1ID3 D;  1BH8 B;  5AV5 C;  5JRG B;  3LZ0 B;  3AL0 C;  3AZL A;  3R45 A;  5GT0 A;  3A6N D;  1U35 D;  5BNV B;  4EO5 B;  4UUZ A;  3WKJ A;  3B0D B;  3AZL B;  3R45 B;  5B1L D;  4XUJ C;  2FJ7 C;  3NQJ B;  5B31 C;  5CP6 C;  1F66 D;  4KGC C;  3X1U D;  2Y2P A;  3WTP C;  2G5I C;  3AYW D;  2L5A A;  3UT9 B;  2Y2O A;  3F6T A;  3WKJ B;  4Z5T A;  3AZE C;  3AZG D;  3W98 C;  5DNM B;  5AV8 A;  4H9P A;  3LEL A;  2BYK A;  5B0Y D;  2HUE C;  5AV9 A;  3AZN D;  3B0C T;  3REJ D;  4Z5T B;  1H3O B;  5GSU A;  4J8V A;  1P3O D;  5B0Z D;  1P3K C;  5AV8 B;  4H9P B;  5GXQ A;  3C1B B;  1P3M C;  1KX4 D;  2BYK B;  3X1S A;  4X23 C;  3X1T D;  5B33 D;  5AV9 B;  1P3G B;  3MGR B;  3LJA C;  3W99 D;  3MGQ D;  4Z2M G;  5GSU B;  4J8V B;  1M19 A;  5GXQ B;  1AOI C;  2JSS A;  5B24 A;  3X1S B;  1M1A A;  4H9S A;  5C3I C;  4WU8 D;  4J8W D;  2YFV A;  1HQ3 D;  2RVQ D;  4Z66 D;  5B1M D;  5B24 B;  4R8P B;  5AVB C;  5JRG C;  3LZ0 C;  5AVC B;  1KX5 B;  1TZY A;  4EO5 C;  4ZUX B;  3B0D C;  1BFM A;  4NE3 A;  2CV5 A;  5BO0 A;  4KUD A;  3AZI A;  3AZL C;  3MVD C;  1N1J B;  1TZY B;  3WAA C;  2F8N H;  5GT0 C;  5AV6 A;  3B6G B;  5F99 A;  3MGS A;  3WKJ C;  3H0L C;  4KUD B;  4YM6 A;  4UPK A;  3AZI B;  3REL D;  4QLC A;  4NFT A;  4J8U D;  3KWQ D;  1P3A D;  4DRB A;  2IO5 B;  4WU9 A;  5F99 B;  3MGS B;  4Z5T C;  1P3B A;  4H9O A;  4QLC B;  5AV8 C;  3LEL C;  5DNN A;  3AZM D;  3AFA A;  3KUY D;  5B32 A;  3AZF D;  1P3L A;  1P3B B;  2NZD D;  5GSU C;  2FFF B;  4J8V C;  1ID3 A;  5GXQ C;  5CPK D;  3X1S C;  1P3L B;  3MGP B;  5JA4 A;  5GT3 D;  3AZK D;  1M19 C;  1ID3 B;  3A6N A;  1M1A C;  5KDM A;  5B40 D;  1JFI B;  4H9S C;  3EG5 B;  4DQY B;  5B1L A;  3REK D;  1F66 A;  3KSY A;  3A6N B;  1U35 B;  5CPJ D;  4WV4 B;  2PYO A;  5KDM B;  3C1C A;  1M18 D;  3AZG A;  5B2J D;  1TZY C;  5B1L B;  5B32 G;  1F66 B;  3X1U B;  4Z2M H;  3AZH D;  3W97 D;  3AYW B;  3AZN A;  1P3P D;  4J8X A;  3REJ A;  2CV5 C;  4KUD C;  3AZI C;  3AZG B;  1P3I A;  3A1I A;  5B0Z A;  3X1V C;  1KX4 A;  2IO5 C;  5AV6 C;  5B0Y B;  5B33 A;  5F99 C;  3AZN B;  3MGS C;  3AV1 D;  1P34 D;  4WJ3 C;  3REJ B;  3W99 A;  4YM6 C;  3TU4 D;  4QLC C;  1P3O B;  1KX3 D;  5B0Z B;  4YS3 D;  1KX4 B;  2YFW A;  1B67 A;  2HIO D;  3B0C W;  5B33 B;  4WU9 C;  4XZQ D;  4WU8 A;  3MGQ B;  1P3B C;  4J8W A;  3W99 B;  5BNV A;  3KXB D;  5DNN C;  2YFW B;  3AFA C;  4LD9 D;  1S32 D;  5B32 C;  3NQJ A;  1P3L C;  4WU8 B;  1ZLA D;  4J8W B;  1HQ3 B;  4Z66 B;  1ID3 C;  3UT9 A;  2LY8 A;  4E44 A;  1WWS A;  5DNM A;  2Y2H A;  4KHA A;  4NE6 A;  2ARO D;  3A6N C;  5E5A D;  5B2I C;  3V9R A;  2CWE A;  2Y2N A;  3WA9 D;  1H3O A;  5AY8 D;  5B1L C;  3C1B A;  4KHA B;  4J8U A;  3KWQ A;  1P3A A;  1F66 C;  1P3G A;  4G91 C;  3MGR A;  5CP6 D;  4KGC D;  3V9R B;  3WTP D;  2PYO C;  2DQN C;  4CSR B;  2F8N D;  3C1C C;  4H9Q B;  3B6F A;  3AZG C;  4J8U B;  3KWQ B;  1P3A B;  3AZE D;  3W98 D;  3AZM A;  3KUY A;  3AZN C;  4J8X C;  3REJ C;  3B6F B;  1P3I C;  5B0Z C;  3REI D;  4R8P A;  1KX4 C;  5CPK A;  3AZM B;  5AVC A;  3KUY B;  1P3K D;  5B33 C;  1P3M D;  1KX5 A;  3AZF B;  3W99 C;  1EQZ D;  5GT3 A;  3LZ1 D;  2NZD B;  3AZK A;  3LJA D;  4ZUX A;  2ZY4 A;  5CPK B;  4DRA A;  3W96 D;  5B40 A;  1N1J A;  4WU8 C;  4J8W C;  3AZJ D;  5GT3 B;  3AZK B;  4AWL B;  3B6G A;  1B6W A;  3VH6 A;  5B40 B;  3VH6 W;  1M18 A;  5B2J A;  5AVB D;  3REK B;  3EPJ A;  2ZY3 A;  2J8P A;  4JJN D;  3UT9 C;  3W97 A;  5CPJ B;  5BT1 D;  1P3F D;  1P3P A;  1M18 B;  5DNM C;  3VH5 A;  5B2J B;  3O62 D;  3VH5 W;  4CAY B;  3P5J B;  3MVD D;  3AZH B;  3WAA D;  3EPL A;  3W97 B;  1P34 A;  3AV1 A;  5GT0 D;  1P3P B;  3TU4 A; 
#chains in the Genus database with same CATH homology
 3C1B C;  2NQB D;  1KX3 A;  2F8N K;  3KWQ C;  4YS3 A;  1P3A C;  5AV9 C;  1P3G C;  4H9R A;  3MGR C;  4G92 B;  2HIO A;  3MGP A;  5CPI D;  1P34 B;  3AV1 B;  3B6F C;  4XZQ A;  2Y2K A;  3TU4 B;  1KX3 B;  4YS3 B;  1JFI A;  4H9R B;  3LEL D;  2HIO B;  3VH6 T;  5BS7 A;  4XZQ B;  1U35 A;  5B24 C;  4R8P C;  2G5H C;  5CPK C;  5FUG A;  2JCH A;  5AVC C;  1KX5 C;  4LD9 B;  3X1S D;  1S32 B;  2W8S A;  3MNN D;  3VH5 T;  3X1U A;  5GT3 C;  1ZLA B;  2Y2I A;  3AZK C;  2ZY2 A;  4ZUX C;  4AWL C;  3AYW A;  2ARO A;  5FUG B;  5E5A A;  1M19 D;  5B40 C;  3WA9 A;  5AY8 A;  1M1A D;  5B0Y A;  3B6G C;  2ARO B;  3UTB D;  5E5A B;  4NE5 A;  3WA9 B;  5AY8 B;  1M18 C;  1P3O A;  2RIQ A;  5B2J C;  3X1T A;  3W97 C;  4KGC B;  5CP6 B;  4WZS B;  3MGQ A;  3WTP B;  1P3P C;  3REH D;  2F8N B;  3EPK A;  3REI A;  2CV5 D;  3AZE B;  3AZI D;  1Z2C B;  3X1T B;  3W98 B;  3X1V D;  4G92 C;  1P34 C;  3AV1 C;  5AV6 D;  2HUE B;  2BYM B;  1HQ3 A;  1EQZ A;  3LZ1 A;  4Z66 A;  3TU4 C;  3AV2 D;  3LJA A;  1KX3 C;  5B1M A;  4YS3 C;  3REI B;  4WNN A;  4YM6 D;  2VQR A;  3W96 A;  1P3K B;  3MGP C;  1P3M B;  4XZQ C;  4M6B A;  4WU9 D;  3UTA D;  3AZJ A;  1EQZ B;  3LZ1 B;  3LJA B;  1P3B D;  5B1M B;  3AN2 D;  4WNN B;  3W96 B;  5AV5 D;  3B0B A;  5BS7 C;  5DNN D;  1R4V A;  3AFA D;  3AZJ B;  2ZY5 A;  5B32 D;  1U35 C;  5C3I B;  4JJN A;  1WWI A;  4CSR A;  2DF4 C;  4H9Q A;  2XD1 A;  1P3F A;  1HTA A;  4E45 A;  3REL A;  3O62 A;  2JE5 A;  5AVB B;  3X1U C;  2FJ7 D;  4XUJ D;  5B31 D;  3AYW C;  2UWX A;  4JJN B;  3MVD A;  2ARO C;  1BH9 A;  3WAA A;  5E5A C;  3A1K A;  3WA9 C;  1P3F B;  5AY8 C;  5B2I D;  3REL B;  3O62 B;  2NQB A;  5B0Y C;  3MVD B;  1BH9 B;  3H0M C;  3WAA B;  3AZF A;  5CPI A;  5GT0 B;  2NZD A;  5G49 A;  1P3O C;  4UUZ B;  2PYO D;  5BNX A;  1Q9C A;  3C1C D;  2NQB B;  3X1T C;  4X23 D;  1ULY A;  3MGQ C;  5CPI B;  5G49 B;  5BNX B;  4J8X D;  3REI C;  1AOI D;  1P3I D;  3LEL B;  3REK A;  2BG1 A;  5CHL B;  3MNN A;  4H9N A;  1HQ3 C;  2RVQ C;  3LZ1 C;  4Z66 C;  1EQZ C;  5B1M C;  5CPJ A;  3W96 C;  5JRG D;  2Y2Q A;  4ZBJ B;  4CAY A;  3LZ0 D;  3MNN B;  4H9N B;  3AZJ C;  2Y2L A;  3AZH A;  3KFU G;  1TAF A;  3UTB A;  1M19 B;  1M1A B;  3AZL D;  4JJN C;  1T3U A;  2YFV B;  1TAF B;  3UTB B;  5BT1 C;  1P3F C;  3UT9 D;  3REH A;  3WKJ D;  4HGA B;  1KU5 A;  3REL C;  4J8U C;  3O62 C;  2XD5 A;  5DNM D;  3X1V A;  3REH B;  4Z5T D;  3AV2 A;  2NQB C;  3KXB A;  2CV5 B;  3AZM C;  5BO0 B;  3KUY C;  5AV8 D;  4LD9 A;  3C1B D;  1S32 A;  3X1V B;  3AZF C;  5CPI C;  5AV9 D;  1P3G D;  5AV6 B;  1ZLA A;  2NZD C;  3MGR D;  3UTA A;  2Y2M A;  3AV2 B;  3B6F D;  5GSU D;  3KXB B;  4J8V D;  3AN2 A;  4YM6 B;  5GXQ D;  2Y2J A;  5AV5 A;  3NQU A;  3UTA B;  4WU9 B;  2ZM5 A;  3AN2 B;  4H9O B;  5B24 D;  4R8P D;  5AV5 B;  3REK C;  4ZBJ C;  3NQU B;  5DNN B;  5AVC D;  3MNN C;  3AFA B;  1KX5 D;  2FJ7 A;  4XUJ A;  5B32 B;  5B31 A;  4KGC A;  5CP6 A;  5CPJ C;  3WTP A;  2F8N A;  4ZUX D;  5B2I A;  3AZE A;  3W98 A;  3AZH C;  1TZY D;  4XUJ B;  2FJ7 B;  5B31 B;  5JA4 B;  3WTP E;  3UTB C;  2BYM A;  3B6G D;  4HGA C;  5B2I B;  4KUD D;  1P3K A;  1P3M A;  4X23 A;  3FDD A;  5F99 D;  4G91 B;  3MGS D;  3REH C;  3EPH A;  2PYO B;  2F2A C;  3C1C B;  4QLC D;  2HIO C;  3H0R C;  1AOI A;  1W2E A;  4X23 B;  1A7W A;  5B31 G;  2Y2G A;  2F8N G;  3AV2 C;  4J8X B;  3KXB C;  1PZR A;  4LD9 C;  1BH8 A;  1AOI B;  1S32 C;  1P3I B;  3IP4 C;  5AVB A;  5JRG A;  3LZ0 A;  1ZLA C;  1F1E A;  3UTA C;  1P3L D;  3MGP D;  3AN2 C;  1ID3 D;  1BH8 B;  5AV5 C;  5JRG B;  3LZ0 B;  3AL0 C;  3AZL A;  3R45 A;  5GT0 A;  3A6N D;  1U35 D;  5BNV B;  4EO5 B;  4UUZ A;  3WKJ A;  3B0D B;  3AZL B;  3R45 B;  5B1L D;  4XUJ C;  2FJ7 C;  3NQJ B;  5B31 C;  5CP6 C;  1F66 D;  4KGC C;  3X1U D;  2Y2P A;  3WTP C;  2G5I C;  3AYW D;  2L5A A;  3UT9 B;  2Y2O A;  3F6T A;  3WKJ B;  4Z5T A;  3AZE C;  3AZG D;  3W98 C;  5DNM B;  5AV8 A;  4H9P A;  3LEL A;  2BYK A;  5B0Y D;  2HUE C;  5AV9 A;  3AZN D;  3B0C T;  3REJ D;  4Z5T B;  1H3O B;  5GSU A;  4J8V A;  1P3O D;  5B0Z D;  1P3K C;  5AV8 B;  4H9P B;  5GXQ A;  3C1B B;  1P3M C;  1KX4 D;  2BYK B;  3X1S A;  4X23 C;  3X1T D;  5B33 D;  5AV9 B;  1P3G B;  3MGR B;  3LJA C;  3W99 D;  3MGQ D;  4Z2M G;  5GSU B;  4J8V B;  1M19 A;  5GXQ B;  1AOI C;  2JSS A;  5B24 A;  3X1S B;  1M1A A;  4H9S A;  5C3I C;  4WU8 D;  4J8W D;  2YFV A;  1HQ3 D;  2RVQ D;  4Z66 D;  5B1M D;  5B24 B;  4R8P B;  5AVB C;  5JRG C;  3LZ0 C;  5AVC B;  1KX5 B;  1TZY A;  4EO5 C;  4ZUX B;  3B0D C;  1BFM A;  4NE3 A;  2CV5 A;  5BO0 A;  4KUD A;  3AZI A;  3AZL C;  3MVD C;  1N1J B;  1TZY B;  3WAA C;  2F8N H;  5GT0 C;  5AV6 A;  3B6G B;  5F99 A;  3MGS A;  3WKJ C;  3H0L C;  4KUD B;  4YM6 A;  4UPK A;  3AZI B;  3REL D;  4QLC A;  4NFT A;  4J8U D;  3KWQ D;  1P3A D;  4DRB A;  2IO5 B;  4WU9 A;  5F99 B;  3MGS B;  4Z5T C;  1P3B A;  4H9O A;  4QLC B;  5AV8 C;  3LEL C;  5DNN A;  3AZM D;  3AFA A;  3KUY D;  5B32 A;  3AZF D;  1P3L A;  1P3B B;  2NZD D;  5GSU C;  2FFF B;  4J8V C;  1ID3 A;  5GXQ C;  5CPK D;  3X1S C;  1P3L B;  3MGP B;  5JA4 A;  5GT3 D;  3AZK D;  1M19 C;  1ID3 B;  3A6N A;  1M1A C;  5KDM A;  5B40 D;  1JFI B;  4H9S C;  3EG5 B;  4DQY B;  5B1L A;  3REK D;  1F66 A;  3KSY A;  3A6N B;  1U35 B;  5CPJ D;  4WV4 B;  2PYO A;  5KDM B;  3C1C A;  1M18 D;  3AZG A;  5B2J D;  1TZY C;  5B1L B;  5B32 G;  1F66 B;  3X1U B;  4Z2M H;  3AZH D;  3W97 D;  3AYW B;  3AZN A;  1P3P D;  4J8X A;  3REJ A;  2CV5 C;  4KUD C;  3AZI C;  3AZG B;  1P3I A;  3A1I A;  5B0Z A;  3X1V C;  1KX4 A;  2IO5 C;  5AV6 C;  5B0Y B;  5B33 A;  5F99 C;  3AZN B;  3MGS C;  3AV1 D;  1P34 D;  4WJ3 C;  3REJ B;  3W99 A;  4YM6 C;  3TU4 D;  4QLC C;  1P3O B;  1KX3 D;  5B0Z B;  4YS3 D;  1KX4 B;  2YFW A;  1B67 A;  2HIO D;  3B0C W;  5B33 B;  4WU9 C;  4XZQ D;  4WU8 A;  3MGQ B;  1P3B C;  4J8W A;  3W99 B;  5BNV A;  3KXB D;  5DNN C;  2YFW B;  3AFA C;  4LD9 D;  1S32 D;  5B32 C;  3NQJ A;  1P3L C;  4WU8 B;  1ZLA D;  4J8W B;  1HQ3 B;  4Z66 B;  1ID3 C;  3UT9 A;  2LY8 A;  4E44 A;  1WWS A;  5DNM A;  2Y2H A;  4KHA A;  4NE6 A;  2ARO D;  3A6N C;  5E5A D;  5B2I C;  3V9R A;  2CWE A;  2Y2N A;  3WA9 D;  1H3O A;  5AY8 D;  5B1L C;  3C1B A;  4KHA B;  4J8U A;  3KWQ A;  1P3A A;  1F66 C;  1P3G A;  4G91 C;  3MGR A;  5CP6 D;  4KGC D;  3V9R B;  3WTP D;  2PYO C;  2DQN C;  4CSR B;  2F8N D;  3C1C C;  4H9Q B;  3B6F A;  3AZG C;  4J8U B;  3KWQ B;  1P3A B;  3AZE D;  3W98 D;  3AZM A;  3KUY A;  3AZN C;  4J8X C;  3REJ C;  3B6F B;  1P3I C;  5B0Z C;  3REI D;  4R8P A;  1KX4 C;  5CPK A;  3AZM B;  5AVC A;  3KUY B;  1P3K D;  5B33 C;  1P3M D;  1KX5 A;  3AZF B;  3W99 C;  1EQZ D;  5GT3 A;  3LZ1 D;  2NZD B;  3AZK A;  3LJA D;  4ZUX A;  2ZY4 A;  5CPK B;  4DRA A;  3W96 D;  5B40 A;  1N1J A;  4WU8 C;  4J8W C;  3AZJ D;  5GT3 B;  3AZK B;  4AWL B;  3B6G A;  1B6W A;  3VH6 A;  5B40 B;  3VH6 W;  1M18 A;  5B2J A;  5AVB D;  3REK B;  3EPJ A;  2ZY3 A;  2J8P A;  4JJN D;  3UT9 C;  3W97 A;  5CPJ B;  5BT1 D;  1P3F D;  1P3P A;  1M18 B;  5DNM C;  3VH5 A;  5B2J B;  3O62 D;  3VH5 W;  4CAY B;  3P5J B;  3MVD D;  3AZH B;  3WAA D;  3EPL A;  3W97 B;  1P34 A;  3AV1 A;  5GT0 D;  1P3P B;  3TU4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...