3AZFC

Crystal structure of human nucleosome core particle containing h3k79q mutation
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
108
structure length
108
Chain Sequence
RAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 32
structure length 108
sequence length 108
chains with identical sequence G
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3azfC00
4ZUXD 4X23A 4HGAB 5B2JC 4ZUXA 3AZEA 3AZGA 5CPIB 4WU8B 1F1EA 3AZLA 3WAAA 3AN2D 3MVDC 3WKJB 2HUEC 3AN2A 3WA9C 4KGCC 4E45A 2PYOB 2BYKA 4J8WB 1R4VA 3R45B 1P3LD 5DNNA 1F66C 4WZSB 4XUJC 1P3KB 3X1SD 2F8ND 3UTAA 5BNVB 2F8NA 4H9RB 5AV5B 3B6GC 5B32D 3MNND 4KUDD 4KUDA 5DNMB 3VH6A 1P34B 4XZQD 5CPJC 5BT1D 5BO0A 5GT0C 3UTBB 4NFTA 3V9RA 1P3FD 1S32C 3LZ0A 1P3GB 1BFMA 3W96C 3VH6T 3AZMA 4WV4B 5FUGA 3AZID 5JA4A 3REHD 1M19D 3AZHA 3REHA 1KX5C 1M19A 4WU9B 1U35D 1H3OA 5F99D 3WTPD 1U35A 5B24C 5F99A 5B0ZB 4H9QB 4YS3C 3MGPD 1JFIA 3MGPA 1KX4C 5AY8B 3C1BD 3KUYC 4H9SA 2FJ7B 5E5AC 1ID3C 1AOIB 3AFAA 3X1UD 3AV2C 4QLCA 3AZFD 5B33D 2NZDA 4YM6A 4G91C 2AROC 1BH9B 5B2JD 3LJAD 5B2JA 1ULYA 3AZGC 1P3PB 2YFWA 4Z2MG 1P3AC 1TZYC 5AV6B 5B1LB 3AZLC 2CV5D 3UT9B 3WAAC 1N1JA 4H9NA 3B0CW 3MVDD 4G92B 3LZ1D 3WA9D 4LD9C 4KGCA 4EO5C 3LELD 5B1MC 1P3LB 1M1AB 1F66D 3W98D 5GSUD 1F66A 3A6NB 4XUJD 3UTAC 3X1SB 4XUJA 4R8PD 3AYWB 1KX3C 3B6GD 5AVCC 5B32B 3MNNB 3MGSC 5B31G 3REIC 3B6GA 4J8UD 3KSYA 5B0YB 4XZQB 5BNXB 3TU4D 3AV1C 1P3ID 5CPJD 4ZBJB 5CPJA 5GT0A 4NE3A 2YFVA 4M6BA 5C3IB 5B40B 1P3FB 1S32D 1S32A 1HQ3C 3C1CC 3W96A 2NQBC 3RELB 3X1VC 3AZIB 3AZJC 1ZLAD 1KX5D 1KX5A 4KHAA 5CP6D 3MGRC 3WTPB 1A7WA 1WWSA 5B24D 4JJNB 5B24A 4J8XB 4YS3D 1B6WA 2F8NG 4YS3A 5GT3B 1KX4A 3KUYD 3KUYA 2RVQC 5B32G 5E5AA 3B6FD 3AFAC 1ID3D 4H9OB 4QLCC 3X1UB 3AV2A 2NZDC 3AZFB 5B33B 1P3BD 1P3OC 1M18B 3LJAB 2AROA 3AZED 3AZGD 3KXBC 1P3AD 4E44A 3W99C 1P3AA 4CAYB 3W97B 1TZYA 2CV5B 4Z66C 3AZLD 5AV8B 3WAAD 4CSRA 3MVDB 3LZ1B 4AWLB 3NQJB 3WA9B 5AV9B 4LD9D 1TAFA 4LD9A 3LELB 5DNND 1AOIA 5B1MA 3AZKB 3W98B 5GSUB 1P3MC 3O62A 3B0DB 3UTAD 4Z5TC 4R8PB 3AZNB 1KX3D 4HGAC 1BH8B 1KX3A 5AVCD 3MGSD 5AVCA 4J8UB 3MGSA 3REIA 2BYMA 5CPIC 4WU8C 3TU4B 5JRGB 3KWQB 3AV1D 1P3IB 3AV1A 1EQZB 3WKJC 2PYOC 3X1TB 2HIOB 3LZ0D 5KDMB 5BS7C 2L5AA 1HQ3D 1HQ3A 3C1CD 3AZMD 3C1CA 1P3KC 2NQBA 3X1VD 3AZHD 1ZLAB 3X1VA 3AZJA 5AV5C 5G49A 5CPKB 5CP6B 5DNMC 4H9PB 3VH5W 3MGRA 1P34C 3UTBC 4UUZB 5AVBB 5GXQB 2RVQD 5B31B 3NQUB 1P3GC 4J8VB 3REJB 3B6FB 3AFAD 1ID3B 4QLCD 2NZDD 1P3BB 4YM6D 5CHLB 4X23B 1P3OD 4ZUXB 4Z2MH 1P3OA 4WU9C 3AZEB 3KXBD 5B0ZC 3KXBA 3W99A 3WAAB 4Z66A 3AN2B 5AY8C 5B2IA 4KGCD 2FJ7C 2BYKB 3MGQA 1AOIC 5DNNB 3O62C 1P3MD 3REKA 1P3MA 2F8NB 4Z5TD 4Z5TA 3B0CT 1P3PC 4KUDB 5CPID 4WU8D 5AV6C 5CPIA 5B1LC 4WU8A 3UT9C 5BO0B 5GT0D 4G92C 3WKJD 3V9RB 2PYOD 3WKJA 2PYOA 3LZ0B 2IO5B 4NE5A 5BS7A 1P3LC 4J8WA 1M1AC 3R45A 3AZMB 3W96D 3WTPE 3A6NC 1P3KD 5FUGB 3X1SC 5JA4B 1P3KA 3AYWC 3AZHB 3REHB 5BNVA 3AZNA 1M19B 5AV5D 4H9RA 5B32C 5AV5A 3MNNC 1H3OB 1U35B 5B0YC 5DNMD 5F99B 5DNMA 1P34D 2F8NH 1P34A 5BT1C 4ZBJC 1JFIB 4WNNB 3MGPB 3UTBD 1KX4D 3C1BB 3UTBA 5B40C 5C3IC 5E5AD 1P3GA 3AV2D 2NZDB 4NE6A 4YM6B 3RELC 3AZIC 2AROD 5B2JB 4WU9D 1B67A 4WU9A 2YFWB 5CPKA 3WTPC 1TZYD 4JJNC 5B0ZA 4J8XC 1N1JB 4H9NB 5B2IC 4H9QA 5GT3C 2HUEB 5AY8A 4KGCB 3MGQC 2LY8A 2FJ7A 1AOID 5B1MD 4J8VA 1F66B 3REKC 3O62D 3AZFC 4XUJB 1M18C 3B0BA 3LJAC 3B6GB 1BH9A 3REID 1P3PD 1P3PA 5AV6D 3W97C 5B1LD 5AV6A 2CV5C 5B1LA 5AV8C 3UT9D 5CPJB 3UT9A 5GT0B 3LZ1C 4AWLC 2YFVB 5AV9C 1S32B 4J8WC 3LELC 1P3LA 1M1AD 3W96B 3AZKC 3W98C 5GSUC 1M1AA 2NQBD 3B0DC 3A6ND 3A6NA 4R8PC 3X1SA 3AZNC 3AYWD 3AZJD 3AYWA 1KX5B 4KHAB 4J8UC 5B32A 3MNNA 3MGRD 5B0YD 3VH6W 3VH5A 1Q9CA 5B0YA 5B24B 3TU4C 5JRGC 4XZQA 3KWQC 1P3IC 5BNXA 1EQZC 4YS3B 1KX4B 3X1TC 3KUYB 2HIOC 5B40D 5B40A 1P3FA 5E5AB 4DRAA 3AV2B 3VH5T 3RELD 3RELA 1ZLAC 3AZIA 4G91B 2AROB 5CPKC 3AZGB 5CP6C 2JSSA 1P3AB 1TZYB 3WTPA 3W99D 4JJND 4JJNA 3AZLB 4J8XD 4Z66D 4CSRB 4J8XA 5B2ID 4WNNA 5GT3D 5GT3A 3C1BA 1TAFB 5AVBC 3MGQD 4LD9B 5GXQC 5B31C 4J8VC 3REJC 4EO5B 3B6FC 1KU5A 5B1MB 4H9OA 3X1UA 3O62B 3REKD 1P3BC 3UTAB 3AZFA 5B33A 4X23C 4ZUXC 1M18D 1KX3B 1M18A 3AZEC 5AVCB 3LJAA 3MGSB 3REIB 2BYMB 3W97D 4CAYA 3W97A 3AV1B 5AV8D 2CV5A 5AV8A 3AN2C 3MVDA 5AV9D 3LZ1A 3NQJA 3WA9A 5AV9A 2CWEA 4J8WD 2F8NK 1HQ3B 5DNNC 3LELA 3C1CB 3AZKD 2NQBB 3AZKA 3W98A 5GSUA 1HTAA 3X1VB 3AZND 3AZJB 4R8PA 1BH8A 5G49B 4KUDC 3MGRB 4J8UA 4DRBA 4XZQC 5JRGD 3KWQD 3TU4A 5JRGA 3KWQA 1P3IA 1EQZD 1EQZA 3X1TD 1WWIA 2HIOD 3LZ0C 3X1TA 2IO5C 1P3FC 2HIOA 1P3GD 5KDMA 3AFAB 3AZMC 4QLCB 3AZHC 3REHC 1P3OB 1M19C 1ZLAA 5CPKD 1U35C 5F99C 5CP6A 3KXBB 4H9PA 5B0ZD 3W99B 4Z66B 3MGPC 5B2IB 5AY8D 3C1BC 4H9SC 3MGQB 5AVBD 2FJ7D 5GXQD 4UUZA 5AVBA 5B31D 5GXQA 5B31A 3NQUA 4J8VD 3REJD 3REJA 3B6FA 3X1UC 1ID3A 3REKB 1P3MB 5B33C 4YM6C 1P3BA 4X23D 4Z5TB
chains in the Genus database with same CATH superfamily
4ZUXD 4X23A 4HGAB 5B2JC 2ZY4A 4ZUXA 3AZEA 3AZGA 3H0LC 5CPIB 4WU8B 3A1KA 2DF4C 1F1EA 3AZLA 3WAAA 3AN2D 3MVDC 3WKJB 2HUEC 3AN2A 3WA9C 2Y2PA 4E45A 2PYOB 4KGCC 2BYKA 4J8WB 1R4VA 2ZY5A 3R45B 1P3LD 5DNNA 1F66C 4WZSB 4XUJC 1P3KB 3H0MC 3X1SD 2F8ND 3UTAA 5BNVB 2F8NA 4H9RB 5AV5B 3B6GC 5B32D 3MNND 4KUDD 4KUDA 5DNMB 3H0RC 3VH6A 1P34B 4XZQD 5CPJC 5BT1D 5BO0A 5GT0C 3UTBB 3F6TA 2JE5A 4NFTA 3V9RA 1P3FD 2Y2QA 1S32C 3LZ0A 1P3GB 1BFMA 3W96C 3VH6T 3AZMA 4WV4B 5FUGA 3AZID 5JA4A 3REHD 1M19D 3AZHA 3REHA 1KX5C 1M19A 4WU9B 1U35D 1H3OA 5F99D 3WTPD 1U35A 5B24C 5F99A 5B0ZB 4H9QB 4YS3C 3MGPD 1JFIA 3MGPA 1KX4C 5AY8B 3C1BD 3KFUG 3KUYC 4H9SA 2FJ7B 2DQNC 5E5AC 2G5IC 1ID3C 1AOIB 3AFAA 3X1UD 3AV2C 4QLCA 3AZFD 5B33D 2NZDA 4YM6A 4G91C 2AROC 3EPKA 1BH9B 5B2JD 3LJAD 5B2JA 1ULYA 3AZGC 1P3PB 2YFWA 4Z2MG 1P3AC 1TZYC 2ZY2A 5AV6B 5B1LB 3AZLC 2CV5D 3UT9B 3WAAC 1N1JA 4H9NA 3B0CW 3MVDD 4G92B 3LZ1D 3WA9D 4LD9C 4KGCA 4EO5C 3LELD 5B1MC 1P3LB 1M1AB 1F66D 3W98D 5GSUD 1F66A 2UWXA 3A6NB 4XUJD 3UTAC 3X1SB 4XUJA 4R8PD 3AYWB 1KX3C 4WJ3C 4UPKA 3B6GD 5AVCC 5B32B 3MNNB 3MGSC 5B31G 3REIC 3B6GA 4J8UD 3KSYA 5B0YB 4XZQB 5BNXB 3TU4D 3AV1C 1P3ID 5CPJD 4ZBJB 5CPJA 5GT0A 4NE3A 2YFVA 4M6BA 5C3IB 5B40B 1P3FB 1S32D 1S32A 1HQ3C 3C1CC 2JCHA 3W96A 2NQBC 3RELB 3X1VC 3AZIB 3AZJC 1ZLAD 1KX5D 1KX5A 4KHAA 5CP6D 3MGRC 3WTPB 1A7WA 1WWSA 5B24D 4JJNB 5B24A 4J8XB 4YS3D 1B6WA 2F8NG 4YS3A 5GT3B 1KX4A 3KUYD 3KUYA 2RVQC 5B32G 4DQYB 5E5AA 3B6FD 3AFAC 1ID3D 4H9OB 4QLCC 3X1UB 3AV2A 2NZDC 3AZFB 5B33B 1P3BD 1P3OC 1M18B 3LJAB 2AROA 3AZED 3AZGD 3KXBC 1P3AD 4E44A 3W99C 1P3AA 4CAYB 3W97B 1TZYA 2CV5B 4Z66C 3AZLD 5AV8B 3WAAD 4CSRA 3MVDB 2XD5A 3LZ1B 4AWLB 3NQJB 3WA9B 5AV9B 4LD9D 1TAFA 4LD9A 2Y2LA 3LELB 5DNND 1AOIA 5B1MA 3AZKB 3W98B 5GSUB 1P3MC 3O62A 3B0DB 3UTAD 4Z5TC 4R8PB 3AZNB 1KX3D 4HGAC 1BH8B 1KX3A 5AVCD 3MGSD 5AVCA 4J8UB 3MGSA 3REIA 2BYMA 5CPIC 4WU8C 3TU4B 5JRGB 3KWQB 3AV1D 1P3IB 3AV1A 1EQZB 3WKJC 2PYOC 3X1TB 2HIOB 3LZ0D 2Y2KA 5KDMB 5BS7C 2L5AA 1HQ3D 1HQ3A 3C1CD 3AZMD 3C1CA 1P3KC 2NQBA 3X1VD 3AZHD 1ZLAB 3X1VA 3AZJA 5AV5C 5G49A 5CPKB 2XD1A 5CP6B 1T3UA 5DNMC 4H9PB 3VH5W 3MGRA 1P34C 2RIQA 3UTBC 4UUZB 5AVBB 5GXQB 2RVQD 5B31B 3NQUB 1P3GC 4J8VB 3REJB 3B6FB 3AFAD 1ID3B 4QLCD 2NZDD 1P3BB 4YM6D 5CHLB 4X23B 1P3OD 4ZUXB 4Z2MH 1P3OA 4WU9C 3AZEB 2Y2JA 3KXBD 5B0ZC 3KXBA 3W99A 3WAAB 4Z66A 3AN2B 5AY8C 5B2IA 4KGCD 2FFFB 2FJ7C 2BYKB 3MGQA 1AOIC 5DNNB 3O62C 1P3MD 3REKA 1P3MA 2F8NB 3EPLA 4Z5TD 4Z5TA 2ZM5A 3B0CT 1P3PC 4KUDB 5CPID 4WU8D 5AV6C 2Y2HA 5CPIA 5B1LC 4WU8A 3UT9C 5BO0B 5GT0D 4G92C 3WKJD 3V9RB 2PYOD 3WKJA 2PYOA 2Y2OA 3LZ0B 2IO5B 2F2AC 4NE5A 5BS7A 1P3LC 4J8WA 1M1AC 3R45A 3AZMB 3W96D 3WTPE 3A6NC 1P3KD 5FUGB 3X1SC 5JA4B 1P3KA 3AYWC 3AZHB 3REHB 5BNVA 3AZNA 1M19B 5AV5D 4H9RA 5B32C 5AV5A 3MNNC 1H3OB 1U35B 5B0YC 5DNMD 5F99B 5DNMA 1P34D 2F8NH 1P34A 5BT1C 4ZBJC 1JFIB 4WNNB 3MGPB 3UTBD 1KX4D 2Y2NA 3C1BB 3UTBA 2W8SA 5B40C 5C3IC 5E5AD 1P3GA 3AV2D 2NZDB 4NE6A 4YM6B 3RELC 3AZIC 2AROD 5B2JB 4WU9D 2G5HC 1B67A 1W2EA 4WU9A 2YFWB 5CPKA 3WTPC 1TZYD 4JJNC 3EPHA 5B0ZA 4J8XC 1N1JB 4H9NB 5B2IC 2Y2MA 4H9QA 3EPJA 5GT3C 2HUEB 5AY8A 4KGCB 3MGQC 2LY8A 2ZY3A 2FJ7A 2Y2GA 1AOID 5B1MD 4J8VA 1F66B 3REKC 3O62D 3AZFC 2VQRA 4XUJB 1M18C 3B0BA 3LJAC 3B6GB 1BH9A 3REID 1P3PD 1P3PA 5AV6D 3W97C 5B1LD 5AV6A 2CV5C 5B1LA 5AV8C 3UT9D 5CPJB 3UT9A 5GT0B 3LZ1C 4AWLC 2YFVB 5AV9C 1Z2CB 3EG5B 1S32B 4J8WC 3LELC 1P3LA 1M1AD 3W96B 3AZKC 3W98C 5GSUC 1M1AA 2NQBD 3B0DC 3A6ND 3A6NA 4R8PC 3X1SA 3AZNC 3AYWD 3AZJD 3AYWA 1KX5B 2Y2IA 4KHAB 4J8UC 5B32A 3MNNA 3MGRD 5B0YD 3VH6W 3VH5A 1Q9CA 5B0YA 5B24B 3TU4C 5JRGC 4XZQA 3KWQC 1P3IC 5BNXA 1EQZC 4YS3B 1KX4B 3X1TC 3KUYB 2HIOC 5B40D 5B40A 1P3FA 5E5AB 3P5JB 4DRAA 3IP4C 3AV2B 3VH5T 3RELD 3RELA 1ZLAC 3AZIA 4G91B 2AROB 5CPKC 3AZGB 5CP6C 2JSSA 1P3AB 1TZYB 3WTPA 3W99D 4JJND 4JJNA 3AZLB 4J8XD 4Z66D 4CSRB 4J8XA 5B2ID 4WNNA 1PZRA 5GT3D 5GT3A 3C1BA 1TAFB 5AVBC 3MGQD 4LD9B 5GXQC 5B31C 4J8VC 3REJC 4EO5B 3B6FC 1KU5A 5B1MB 4H9OA 3X1UA 3O62B 3REKD 1P3BC 3UTAB 3AZFA 5B33A 4X23C 4ZUXC 1M18D 1KX3B 1M18A 3A1IA 3AZEC 5AVCB 3LJAA 3MGSB 3REIB 2BYMB 3W97D 4CAYA 3W97A 3AV1B 5AV8D 2CV5A 5AV8A 3AN2C 3MVDA 5AV9D 3LZ1A 3NQJA 3WA9A 5AV9A 2CWEA 4J8WD 2F8NK 1HQ3B 5DNNC 3LELA 3C1CB 3AZKD 2NQBB 3AZKA 3W98A 5GSUA 1HTAA 3X1VB 3AZND 3AZJB 4R8PA 1BH8A 5G49B 4KUDC 3MGRB 4J8UA 4DRBA 4XZQC 5JRGD 3KWQD 3TU4A 5JRGA 3KWQA 1P3IA 1EQZD 1EQZA 3X1TD 1WWIA 2HIOD 3LZ0C 3X1TA 2IO5C 1P3FC 2HIOA 2BG1A 1P3GD 5KDMA 3AFAB 3AZMC 4QLCB 2J8PA 3AZHC 3REHC 1P3OB 1M19C 3AL0C 1ZLAA 5CPKD 1U35C 5F99C 5CP6A 3KXBB 4H9PA 5B0ZD 3W99B 4Z66B 3MGPC 5B2IB 5AY8D 3C1BC 3FDDA 4H9SC 3MGQB 5AVBD 2FJ7D 5GXQD 4UUZA 5AVBA 5B31D 5GXQA 5B31A 3NQUA 4J8VD 3REJD 3REJA 3B6FA 3X1UC 1ID3A 3REKB 1P3MB 5B33C 4YM6C 1P3BA 4X23D 4Z5TB
chains in the Genus database with same CATH topology
4ZUXD 4X23A 4HGAB 5B2JC 2ZY4A 4ZUXA 3AZEA 3AZGA 3H0LC 5CPIB 4WU8B 3A1KA 2DF4C 1F1EA 3AZLA 3WAAA 3AN2D 3MVDC 3WKJB 2HUEC 3AN2A 3WA9C 2Y2PA 4E45A 2PYOB 4KGCC 2BYKA 4J8WB 1R4VA 2ZY5A 3R45B 1P3LD 5DNNA 1F66C 4WZSB 4XUJC 1P3KB 3H0MC 3X1SD 2F8ND 3UTAA 5BNVB 2F8NA 4H9RB 5AV5B 3B6GC 5B32D 3MNND 4KUDD 4KUDA 5DNMB 3H0RC 3VH6A 1P34B 4XZQD 5CPJC 5BT1D 5BO0A 5GT0C 3UTBB 3F6TA 2JE5A 4NFTA 3V9RA 1P3FD 2Y2QA 1S32C 3LZ0A 1P3GB 1BFMA 3W96C 3VH6T 3AZMA 4WV4B 5FUGA 3AZID 5JA4A 3REHD 1M19D 3AZHA 3REHA 1KX5C 1M19A 4WU9B 1U35D 1H3OA 5F99D 3WTPD 1U35A 5B24C 5F99A 5B0ZB 4H9QB 4YS3C 3MGPD 1JFIA 3MGPA 1KX4C 5AY8B 3C1BD 3KFUG 3KUYC 4H9SA 2FJ7B 2DQNC 5E5AC 2G5IC 1ID3C 1AOIB 3AFAA 3X1UD 3AV2C 4QLCA 3AZFD 5B33D 2NZDA 4YM6A 4G91C 2AROC 3EPKA 1BH9B 5B2JD 3LJAD 5B2JA 1ULYA 3AZGC 1P3PB 2YFWA 4Z2MG 1P3AC 1TZYC 2ZY2A 5AV6B 5B1LB 3AZLC 2CV5D 3UT9B 3WAAC 1N1JA 4H9NA 3B0CW 3MVDD 4G92B 3LZ1D 3WA9D 4LD9C 4KGCA 4EO5C 3LELD 5B1MC 1P3LB 1M1AB 1F66D 3W98D 5GSUD 1F66A 2UWXA 3A6NB 4XUJD 3UTAC 3X1SB 4XUJA 4R8PD 3AYWB 1KX3C 4WJ3C 4UPKA 3B6GD 5AVCC 5B32B 3MNNB 3MGSC 5B31G 3REIC 3B6GA 4J8UD 3KSYA 5B0YB 4XZQB 5BNXB 3TU4D 3AV1C 1P3ID 5CPJD 4ZBJB 5CPJA 5GT0A 4NE3A 2YFVA 4M6BA 5C3IB 5B40B 1P3FB 1S32D 1S32A 1HQ3C 3C1CC 2JCHA 3W96A 2NQBC 3RELB 3X1VC 3AZIB 3AZJC 1ZLAD 1KX5D 1KX5A 4KHAA 5CP6D 3MGRC 3WTPB 1A7WA 1WWSA 5B24D 4JJNB 5B24A 4J8XB 4YS3D 1B6WA 2F8NG 4YS3A 5GT3B 1KX4A 3KUYD 3KUYA 2RVQC 5B32G 4DQYB 5E5AA 3B6FD 3AFAC 1ID3D 4H9OB 4QLCC 3X1UB 3AV2A 2NZDC 3AZFB 5B33B 1P3BD 1P3OC 1M18B 3LJAB 2AROA 3AZED 3AZGD 3KXBC 1P3AD 4E44A 3W99C 1P3AA 4CAYB 3W97B 1TZYA 2CV5B 4Z66C 3AZLD 5AV8B 3WAAD 4CSRA 3MVDB 2XD5A 3LZ1B 4AWLB 3NQJB 3WA9B 5AV9B 4LD9D 1TAFA 4LD9A 2Y2LA 3LELB 5DNND 1AOIA 5B1MA 3AZKB 3W98B 5GSUB 1P3MC 3O62A 3B0DB 3UTAD 4Z5TC 4R8PB 3AZNB 1KX3D 4HGAC 1BH8B 1KX3A 5AVCD 3MGSD 5AVCA 4J8UB 3MGSA 3REIA 2BYMA 5CPIC 4WU8C 3TU4B 5JRGB 3KWQB 3AV1D 1P3IB 3AV1A 1EQZB 3WKJC 2PYOC 3X1TB 2HIOB 3LZ0D 2Y2KA 5KDMB 5BS7C 2L5AA 1HQ3D 1HQ3A 3C1CD 3AZMD 3C1CA 1P3KC 2NQBA 3X1VD 3AZHD 1ZLAB 3X1VA 3AZJA 5AV5C 5G49A 5CPKB 2XD1A 5CP6B 1T3UA 5DNMC 4H9PB 3VH5W 3MGRA 1P34C 2RIQA 3UTBC 4UUZB 5AVBB 5GXQB 2RVQD 5B31B 3NQUB 1P3GC 4J8VB 3REJB 3B6FB 3AFAD 1ID3B 4QLCD 2NZDD 1P3BB 4YM6D 5CHLB 4X23B 1P3OD 4ZUXB 4Z2MH 1P3OA 4WU9C 3AZEB 2Y2JA 3KXBD 5B0ZC 3KXBA 3W99A 3WAAB 4Z66A 3AN2B 5AY8C 5B2IA 4KGCD 2FFFB 2FJ7C 2BYKB 3MGQA 1AOIC 5DNNB 3O62C 1P3MD 3REKA 1P3MA 2F8NB 3EPLA 4Z5TD 4Z5TA 2ZM5A 3B0CT 1P3PC 4KUDB 5CPID 4WU8D 5AV6C 2Y2HA 5CPIA 5B1LC 4WU8A 3UT9C 5BO0B 5GT0D 4G92C 3WKJD 3V9RB 2PYOD 3WKJA 2PYOA 2Y2OA 3LZ0B 2IO5B 2F2AC 4NE5A 5BS7A 1P3LC 4J8WA 1M1AC 3R45A 3AZMB 3W96D 3WTPE 3A6NC 1P3KD 5FUGB 3X1SC 5JA4B 1P3KA 3AYWC 3AZHB 3REHB 5BNVA 3AZNA 1M19B 5AV5D 4H9RA 5B32C 5AV5A 3MNNC 1H3OB 1U35B 5B0YC 5DNMD 5F99B 5DNMA 1P34D 2F8NH 1P34A 5BT1C 4ZBJC 1JFIB 4WNNB 3MGPB 3UTBD 1KX4D 2Y2NA 3C1BB 3UTBA 2W8SA 5B40C 5C3IC 5E5AD 1P3GA 3AV2D 2NZDB 4NE6A 4YM6B 3RELC 3AZIC 2AROD 5B2JB 4WU9D 2G5HC 1B67A 1W2EA 4WU9A 2YFWB 5CPKA 3WTPC 1TZYD 4JJNC 3EPHA 5B0ZA 4J8XC 1N1JB 4H9NB 5B2IC 2Y2MA 4H9QA 3EPJA 5GT3C 2HUEB 5AY8A 4KGCB 3MGQC 2LY8A 2ZY3A 2FJ7A 2Y2GA 1AOID 5B1MD 4J8VA 1F66B 3REKC 3O62D 3AZFC 2VQRA 4XUJB 1M18C 3B0BA 3LJAC 3B6GB 1BH9A 3REID 1P3PD 1P3PA 5AV6D 3W97C 5B1LD 5AV6A 2CV5C 5B1LA 5AV8C 3UT9D 5CPJB 3UT9A 5GT0B 3LZ1C 4AWLC 2YFVB 5AV9C 1Z2CB 3EG5B 1S32B 4J8WC 3LELC 1P3LA 1M1AD 3W96B 3AZKC 3W98C 5GSUC 1M1AA 2NQBD 3B0DC 3A6ND 3A6NA 4R8PC 3X1SA 3AZNC 3AYWD 3AZJD 3AYWA 1KX5B 2Y2IA 4KHAB 4J8UC 5B32A 3MNNA 3MGRD 5B0YD 3VH6W 3VH5A 1Q9CA 5B0YA 5B24B 3TU4C 5JRGC 4XZQA 3KWQC 1P3IC 5BNXA 1EQZC 4YS3B 1KX4B 3X1TC 3KUYB 2HIOC 5B40D 5B40A 1P3FA 5E5AB 3P5JB 4DRAA 3IP4C 3AV2B 3VH5T 3RELD 3RELA 1ZLAC 3AZIA 4G91B 2AROB 5CPKC 3AZGB 5CP6C 2JSSA 1P3AB 1TZYB 3WTPA 3W99D 4JJND 4JJNA 3AZLB 4J8XD 4Z66D 4CSRB 4J8XA 5B2ID 4WNNA 1PZRA 5GT3D 5GT3A 3C1BA 1TAFB 5AVBC 3MGQD 4LD9B 5GXQC 5B31C 4J8VC 3REJC 4EO5B 3B6FC 1KU5A 5B1MB 4H9OA 3X1UA 3O62B 3REKD 1P3BC 3UTAB 3AZFA 5B33A 4X23C 4ZUXC 1M18D 1KX3B 1M18A 3A1IA 3AZEC 5AVCB 3LJAA 3MGSB 3REIB 2BYMB 3W97D 4CAYA 3W97A 3AV1B 5AV8D 2CV5A 5AV8A 3AN2C 3MVDA 5AV9D 3LZ1A 3NQJA 3WA9A 5AV9A 2CWEA 4J8WD 2F8NK 1HQ3B 5DNNC 3LELA 3C1CB 3AZKD 2NQBB 3AZKA 3W98A 5GSUA 1HTAA 3X1VB 3AZND 3AZJB 4R8PA 1BH8A 5G49B 4KUDC 3MGRB 4J8UA 4DRBA 4XZQC 5JRGD 3KWQD 3TU4A 5JRGA 3KWQA 1P3IA 1EQZD 1EQZA 3X1TD 1WWIA 2HIOD 3LZ0C 3X1TA 2IO5C 1P3FC 2HIOA 2BG1A 1P3GD 5KDMA 3AFAB 3AZMC 4QLCB 2J8PA 3AZHC 3REHC 1P3OB 1M19C 3AL0C 1ZLAA 5CPKD 1U35C 5F99C 5CP6A 3KXBB 4H9PA 5B0ZD 3W99B 4Z66B 3MGPC 5B2IB 5AY8D 3C1BC 3FDDA 4H9SC 3MGQB 5AVBD 2FJ7D 5GXQD 4UUZA 5AVBA 5B31D 5GXQA 5B31A 3NQUA 4J8VD 3REJD 3REJA 3B6FA 3X1UC 1ID3A 3REKB 1P3MB 5B33C 4YM6C 1P3BA 4X23D 4Z5TB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZUX D;  4X23 A;  4HGA B;  5B2J C;  4ZUX A;  3AZE A;  3AZG A;  5CPI B;  4WU8 B;  1F1E A;  3AZL A;  3WAA A;  3AN2 D;  3MVD C;  3WKJ B;  2HUE C;  3AN2 A;  3WA9 C;  4KGC C;  4E45 A;  2PYO B;  2BYK A;  4J8W B;  1R4V A;  3R45 B;  1P3L D;  5DNN A;  1F66 C;  4WZS B;  4XUJ C;  1P3K B;  3X1S D;  2F8N D;  3UTA A;  5BNV B;  2F8N A;  4H9R B;  5AV5 B;  3B6G C;  5B32 D;  3MNN D;  4KUD D;  4KUD A;  5DNM B;  3VH6 A;  1P34 B;  4XZQ D;  5CPJ C;  5BT1 D;  5BO0 A;  5GT0 C;  3UTB B;  4NFT A;  3V9R A;  1P3F D;  1S32 C;  3LZ0 A;  1P3G B;  1BFM A;  3W96 C;  3VH6 T;  3AZM A;  4WV4 B;  5FUG A;  3AZI D;  5JA4 A;  3REH D;  1M19 D;  3AZH A;  3REH A;  1KX5 C;  1M19 A;  4WU9 B;  1U35 D;  1H3O A;  5F99 D;  3WTP D;  1U35 A;  5B24 C;  5F99 A;  5B0Z B;  4H9Q B;  4YS3 C;  3MGP D;  1JFI A;  3MGP A;  1KX4 C;  5AY8 B;  3C1B D;  3KUY C;  4H9S A;  2FJ7 B;  5E5A C;  1ID3 C;  1AOI B;  3AFA A;  3X1U D;  3AV2 C;  4QLC A;  3AZF D;  5B33 D;  2NZD A;  4YM6 A;  4G91 C;  2ARO C;  1BH9 B;  5B2J D;  3LJA D;  5B2J A;  1ULY A;  3AZG C;  1P3P B;  2YFW A;  4Z2M G;  1P3A C;  1TZY C;  5AV6 B;  5B1L B;  3AZL C;  2CV5 D;  3UT9 B;  3WAA C;  1N1J A;  4H9N A;  3B0C W;  3MVD D;  4G92 B;  3LZ1 D;  3WA9 D;  4LD9 C;  4KGC A;  4EO5 C;  3LEL D;  5B1M C;  1P3L B;  1M1A B;  1F66 D;  3W98 D;  5GSU D;  1F66 A;  3A6N B;  4XUJ D;  3UTA C;  3X1S B;  4XUJ A;  4R8P D;  3AYW B;  1KX3 C;  3B6G D;  5AVC C;  5B32 B;  3MNN B;  3MGS C;  5B31 G;  3REI C;  3B6G A;  4J8U D;  3KSY A;  5B0Y B;  4XZQ B;  5BNX B;  3TU4 D;  3AV1 C;  1P3I D;  5CPJ D;  4ZBJ B;  5CPJ A;  5GT0 A;  4NE3 A;  2YFV A;  4M6B A;  5C3I B;  5B40 B;  1P3F B;  1S32 D;  1S32 A;  1HQ3 C;  3C1C C;  3W96 A;  2NQB C;  3REL B;  3X1V C;  3AZI B;  3AZJ C;  1ZLA D;  1KX5 D;  1KX5 A;  4KHA A;  5CP6 D;  3MGR C;  3WTP B;  1A7W A;  1WWS A;  5B24 D;  4JJN B;  5B24 A;  4J8X B;  4YS3 D;  1B6W A;  2F8N G;  4YS3 A;  5GT3 B;  1KX4 A;  3KUY D;  3KUY A;  2RVQ C;  5B32 G;  5E5A A;  3B6F D;  3AFA C;  1ID3 D;  4H9O B;  4QLC C;  3X1U B;  3AV2 A;  2NZD C;  3AZF B;  5B33 B;  1P3B D;  1P3O C;  1M18 B;  3LJA B;  2ARO A;  3AZE D;  3AZG D;  3KXB C;  1P3A D;  4E44 A;  3W99 C;  1P3A A;  4CAY B;  3W97 B;  1TZY A;  2CV5 B;  4Z66 C;  3AZL D;  5AV8 B;  3WAA D;  4CSR A;  3MVD B;  3LZ1 B;  4AWL B;  3NQJ B;  3WA9 B;  5AV9 B;  4LD9 D;  1TAF A;  4LD9 A;  3LEL B;  5DNN D;  1AOI A;  5B1M A;  3AZK B;  3W98 B;  5GSU B;  1P3M C;  3O62 A;  3B0D B;  3UTA D;  4Z5T C;  4R8P B;  3AZN B;  1KX3 D;  4HGA C;  1BH8 B;  1KX3 A;  5AVC D;  3MGS D;  5AVC A;  4J8U B;  3MGS A;  3REI A;  2BYM A;  5CPI C;  4WU8 C;  3TU4 B;  5JRG B;  3KWQ B;  3AV1 D;  1P3I B;  3AV1 A;  1EQZ B;  3WKJ C;  2PYO C;  3X1T B;  2HIO B;  3LZ0 D;  5KDM B;  5BS7 C;  2L5A A;  1HQ3 D;  1HQ3 A;  3C1C D;  3AZM D;  3C1C A;  1P3K C;  2NQB A;  3X1V D;  3AZH D;  1ZLA B;  3X1V A;  3AZJ A;  5AV5 C;  5G49 A;  5CPK B;  5CP6 B;  5DNM C;  4H9P B;  3VH5 W;  3MGR A;  1P34 C;  3UTB C;  4UUZ B;  5AVB B;  5GXQ B;  2RVQ D;  5B31 B;  3NQU B;  1P3G C;  4J8V B;  3REJ B;  3B6F B;  3AFA D;  1ID3 B;  4QLC D;  2NZD D;  1P3B B;  4YM6 D;  5CHL B;  4X23 B;  1P3O D;  4ZUX B;  4Z2M H;  1P3O A;  4WU9 C;  3AZE B;  3KXB D;  5B0Z C;  3KXB A;  3W99 A;  3WAA B;  4Z66 A;  3AN2 B;  5AY8 C;  5B2I A;  4KGC D;  2FJ7 C;  2BYK B;  3MGQ A;  1AOI C;  5DNN B;  3O62 C;  1P3M D;  3REK A;  1P3M A;  2F8N B;  4Z5T D;  4Z5T A;  3B0C T;  1P3P C;  4KUD B;  5CPI D;  4WU8 D;  5AV6 C;  5CPI A;  5B1L C;  4WU8 A;  3UT9 C;  5BO0 B;  5GT0 D;  4G92 C;  3WKJ D;  3V9R B;  2PYO D;  3WKJ A;  2PYO A;  3LZ0 B;  2IO5 B;  4NE5 A;  5BS7 A;  1P3L C;  4J8W A;  1M1A C;  3R45 A;  3AZM B;  3W96 D;  3WTP E;  3A6N C;  1P3K D;  5FUG B;  3X1S C;  5JA4 B;  1P3K A;  3AYW C;  3AZH B;  3REH B;  5BNV A;  3AZN A;  1M19 B;  5AV5 D;  4H9R A;  5B32 C;  5AV5 A;  3MNN C;  1H3O B;  1U35 B;  5B0Y C;  5DNM D;  5F99 B;  5DNM A;  1P34 D;  2F8N H;  1P34 A;  5BT1 C;  4ZBJ C;  1JFI B;  4WNN B;  3MGP B;  3UTB D;  1KX4 D;  3C1B B;  3UTB A;  5B40 C;  5C3I C;  5E5A D;  1P3G A;  3AV2 D;  2NZD B;  4NE6 A;  4YM6 B;  3REL C;  3AZI C;  2ARO D;  5B2J B;  4WU9 D;  1B67 A;  4WU9 A;  2YFW B;  5CPK A;  3WTP C;  1TZY D;  4JJN C;  5B0Z A;  4J8X C;  1N1J B;  4H9N B;  5B2I C;  4H9Q A;  5GT3 C;  2HUE B;  5AY8 A;  4KGC B;  3MGQ C;  2LY8 A;  2FJ7 A;  1AOI D;  5B1M D;  4J8V A;  1F66 B;  3REK C;  3O62 D;  3AZF C;  4XUJ B;  1M18 C;  3B0B A;  3LJA C;  3B6G B;  1BH9 A;  3REI D;  1P3P D;  1P3P A;  5AV6 D;  3W97 C;  5B1L D;  5AV6 A;  2CV5 C;  5B1L A;  5AV8 C;  3UT9 D;  5CPJ B;  3UT9 A;  5GT0 B;  3LZ1 C;  4AWL C;  2YFV B;  5AV9 C;  1S32 B;  4J8W C;  3LEL C;  1P3L A;  1M1A D;  3W96 B;  3AZK C;  3W98 C;  5GSU C;  1M1A A;  2NQB D;  3B0D C;  3A6N D;  3A6N A;  4R8P C;  3X1S A;  3AZN C;  3AYW D;  3AZJ D;  3AYW A;  1KX5 B;  4KHA B;  4J8U C;  5B32 A;  3MNN A;  3MGR D;  5B0Y D;  3VH6 W;  3VH5 A;  1Q9C A;  5B0Y A;  5B24 B;  3TU4 C;  5JRG C;  4XZQ A;  3KWQ C;  1P3I C;  5BNX A;  1EQZ C;  4YS3 B;  1KX4 B;  3X1T C;  3KUY B;  2HIO C;  5B40 D;  5B40 A;  1P3F A;  5E5A B;  4DRA A;  3AV2 B;  3VH5 T;  3REL D;  3REL A;  1ZLA C;  3AZI A;  4G91 B;  2ARO B;  5CPK C;  3AZG B;  5CP6 C;  2JSS A;  1P3A B;  1TZY B;  3WTP A;  3W99 D;  4JJN D;  4JJN A;  3AZL B;  4J8X D;  4Z66 D;  4CSR B;  4J8X A;  5B2I D;  4WNN A;  5GT3 D;  5GT3 A;  3C1B A;  1TAF B;  5AVB C;  3MGQ D;  4LD9 B;  5GXQ C;  5B31 C;  4J8V C;  3REJ C;  4EO5 B;  3B6F C;  1KU5 A;  5B1M B;  4H9O A;  3X1U A;  3O62 B;  3REK D;  1P3B C;  3UTA B;  3AZF A;  5B33 A;  4X23 C;  4ZUX C;  1M18 D;  1KX3 B;  1M18 A;  3AZE C;  5AVC B;  3LJA A;  3MGS B;  3REI B;  2BYM B;  3W97 D;  4CAY A;  3W97 A;  3AV1 B;  5AV8 D;  2CV5 A;  5AV8 A;  3AN2 C;  3MVD A;  5AV9 D;  3LZ1 A;  3NQJ A;  3WA9 A;  5AV9 A;  2CWE A;  4J8W D;  2F8N K;  1HQ3 B;  5DNN C;  3LEL A;  3C1C B;  3AZK D;  2NQB B;  3AZK A;  3W98 A;  5GSU A;  1HTA A;  3X1V B;  3AZN D;  3AZJ B;  4R8P A;  1BH8 A;  5G49 B;  4KUD C;  3MGR B;  4J8U A;  4DRB A;  4XZQ C;  5JRG D;  3KWQ D;  3TU4 A;  5JRG A;  3KWQ A;  1P3I A;  1EQZ D;  1EQZ A;  3X1T D;  1WWI A;  2HIO D;  3LZ0 C;  3X1T A;  2IO5 C;  1P3F C;  2HIO A;  1P3G D;  5KDM A;  3AFA B;  3AZM C;  4QLC B;  3AZH C;  3REH C;  1P3O B;  1M19 C;  1ZLA A;  5CPK D;  1U35 C;  5F99 C;  5CP6 A;  3KXB B;  4H9P A;  5B0Z D;  3W99 B;  4Z66 B;  3MGP C;  5B2I B;  5AY8 D;  3C1B C;  4H9S C;  3MGQ B;  5AVB D;  2FJ7 D;  5GXQ D;  4UUZ A;  5AVB A;  5B31 D;  5GXQ A;  5B31 A;  3NQU A;  4J8V D;  3REJ D;  3REJ A;  3B6F A;  3X1U C;  1ID3 A;  3REK B;  1P3M B;  5B33 C;  4YM6 C;  1P3B A;  4X23 D;  4Z5T B; 
#chains in the Genus database with same CATH topology
 4ZUX D;  4X23 A;  4HGA B;  5B2J C;  2ZY4 A;  4ZUX A;  3AZE A;  3AZG A;  3H0L C;  5CPI B;  4WU8 B;  3A1K A;  2DF4 C;  1F1E A;  3AZL A;  3WAA A;  3AN2 D;  3MVD C;  3WKJ B;  2HUE C;  3AN2 A;  3WA9 C;  2Y2P A;  4E45 A;  2PYO B;  4KGC C;  2BYK A;  4J8W B;  1R4V A;  2ZY5 A;  3R45 B;  1P3L D;  5DNN A;  1F66 C;  4WZS B;  4XUJ C;  1P3K B;  3H0M C;  3X1S D;  2F8N D;  3UTA A;  5BNV B;  2F8N A;  4H9R B;  5AV5 B;  3B6G C;  5B32 D;  3MNN D;  4KUD D;  4KUD A;  5DNM B;  3H0R C;  3VH6 A;  1P34 B;  4XZQ D;  5CPJ C;  5BT1 D;  5BO0 A;  5GT0 C;  3UTB B;  3F6T A;  2JE5 A;  4NFT A;  3V9R A;  1P3F D;  2Y2Q A;  1S32 C;  3LZ0 A;  1P3G B;  1BFM A;  3W96 C;  3VH6 T;  3AZM A;  4WV4 B;  5FUG A;  3AZI D;  5JA4 A;  3REH D;  1M19 D;  3AZH A;  3REH A;  1KX5 C;  1M19 A;  4WU9 B;  1U35 D;  1H3O A;  5F99 D;  3WTP D;  1U35 A;  5B24 C;  5F99 A;  5B0Z B;  4H9Q B;  4YS3 C;  3MGP D;  1JFI A;  3MGP A;  1KX4 C;  5AY8 B;  3C1B D;  3KFU G;  3KUY C;  4H9S A;  2FJ7 B;  2DQN C;  5E5A C;  2G5I C;  1ID3 C;  1AOI B;  3AFA A;  3X1U D;  3AV2 C;  4QLC A;  3AZF D;  5B33 D;  2NZD A;  4YM6 A;  4G91 C;  2ARO C;  3EPK A;  1BH9 B;  5B2J D;  3LJA D;  5B2J A;  1ULY A;  3AZG C;  1P3P B;  2YFW A;  4Z2M G;  1P3A C;  1TZY C;  2ZY2 A;  5AV6 B;  5B1L B;  3AZL C;  2CV5 D;  3UT9 B;  3WAA C;  1N1J A;  4H9N A;  3B0C W;  3MVD D;  4G92 B;  3LZ1 D;  3WA9 D;  4LD9 C;  4KGC A;  4EO5 C;  3LEL D;  5B1M C;  1P3L B;  1M1A B;  1F66 D;  3W98 D;  5GSU D;  1F66 A;  2UWX A;  3A6N B;  4XUJ D;  3UTA C;  3X1S B;  4XUJ A;  4R8P D;  3AYW B;  1KX3 C;  4WJ3 C;  4UPK A;  3B6G D;  5AVC C;  5B32 B;  3MNN B;  3MGS C;  5B31 G;  3REI C;  3B6G A;  4J8U D;  3KSY A;  5B0Y B;  4XZQ B;  5BNX B;  3TU4 D;  3AV1 C;  1P3I D;  5CPJ D;  4ZBJ B;  5CPJ A;  5GT0 A;  4NE3 A;  2YFV A;  4M6B A;  5C3I B;  5B40 B;  1P3F B;  1S32 D;  1S32 A;  1HQ3 C;  3C1C C;  2JCH A;  3W96 A;  2NQB C;  3REL B;  3X1V C;  3AZI B;  3AZJ C;  1ZLA D;  1KX5 D;  1KX5 A;  4KHA A;  5CP6 D;  3MGR C;  3WTP B;  1A7W A;  1WWS A;  5B24 D;  4JJN B;  5B24 A;  4J8X B;  4YS3 D;  1B6W A;  2F8N G;  4YS3 A;  5GT3 B;  1KX4 A;  3KUY D;  3KUY A;  2RVQ C;  5B32 G;  4DQY B;  5E5A A;  3B6F D;  3AFA C;  1ID3 D;  4H9O B;  4QLC C;  3X1U B;  3AV2 A;  2NZD C;  3AZF B;  5B33 B;  1P3B D;  1P3O C;  1M18 B;  3LJA B;  2ARO A;  3AZE D;  3AZG D;  3KXB C;  1P3A D;  4E44 A;  3W99 C;  1P3A A;  4CAY B;  3W97 B;  1TZY A;  2CV5 B;  4Z66 C;  3AZL D;  5AV8 B;  3WAA D;  4CSR A;  3MVD B;  2XD5 A;  3LZ1 B;  4AWL B;  3NQJ B;  3WA9 B;  5AV9 B;  4LD9 D;  1TAF A;  4LD9 A;  2Y2L A;  3LEL B;  5DNN D;  1AOI A;  5B1M A;  3AZK B;  3W98 B;  5GSU B;  1P3M C;  3O62 A;  3B0D B;  3UTA D;  4Z5T C;  4R8P B;  3AZN B;  1KX3 D;  4HGA C;  1BH8 B;  1KX3 A;  5AVC D;  3MGS D;  5AVC A;  4J8U B;  3MGS A;  3REI A;  2BYM A;  5CPI C;  4WU8 C;  3TU4 B;  5JRG B;  3KWQ B;  3AV1 D;  1P3I B;  3AV1 A;  1EQZ B;  3WKJ C;  2PYO C;  3X1T B;  2HIO B;  3LZ0 D;  2Y2K A;  5KDM B;  5BS7 C;  2L5A A;  1HQ3 D;  1HQ3 A;  3C1C D;  3AZM D;  3C1C A;  1P3K C;  2NQB A;  3X1V D;  3AZH D;  1ZLA B;  3X1V A;  3AZJ A;  5AV5 C;  5G49 A;  5CPK B;  2XD1 A;  5CP6 B;  1T3U A;  5DNM C;  4H9P B;  3VH5 W;  3MGR A;  1P34 C;  2RIQ A;  3UTB C;  4UUZ B;  5AVB B;  5GXQ B;  2RVQ D;  5B31 B;  3NQU B;  1P3G C;  4J8V B;  3REJ B;  3B6F B;  3AFA D;  1ID3 B;  4QLC D;  2NZD D;  1P3B B;  4YM6 D;  5CHL B;  4X23 B;  1P3O D;  4ZUX B;  4Z2M H;  1P3O A;  4WU9 C;  3AZE B;  2Y2J A;  3KXB D;  5B0Z C;  3KXB A;  3W99 A;  3WAA B;  4Z66 A;  3AN2 B;  5AY8 C;  5B2I A;  4KGC D;  2FFF B;  2FJ7 C;  2BYK B;  3MGQ A;  1AOI C;  5DNN B;  3O62 C;  1P3M D;  3REK A;  1P3M A;  2F8N B;  3EPL A;  4Z5T D;  4Z5T A;  2ZM5 A;  3B0C T;  1P3P C;  4KUD B;  5CPI D;  4WU8 D;  5AV6 C;  2Y2H A;  5CPI A;  5B1L C;  4WU8 A;  3UT9 C;  5BO0 B;  5GT0 D;  4G92 C;  3WKJ D;  3V9R B;  2PYO D;  3WKJ A;  2PYO A;  2Y2O A;  3LZ0 B;  2IO5 B;  2F2A C;  4NE5 A;  5BS7 A;  1P3L C;  4J8W A;  1M1A C;  3R45 A;  3AZM B;  3W96 D;  3WTP E;  3A6N C;  1P3K D;  5FUG B;  3X1S C;  5JA4 B;  1P3K A;  3AYW C;  3AZH B;  3REH B;  5BNV A;  3AZN A;  1M19 B;  5AV5 D;  4H9R A;  5B32 C;  5AV5 A;  3MNN C;  1H3O B;  1U35 B;  5B0Y C;  5DNM D;  5F99 B;  5DNM A;  1P34 D;  2F8N H;  1P34 A;  5BT1 C;  4ZBJ C;  1JFI B;  4WNN B;  3MGP B;  3UTB D;  1KX4 D;  2Y2N A;  3C1B B;  3UTB A;  2W8S A;  5B40 C;  5C3I C;  5E5A D;  1P3G A;  3AV2 D;  2NZD B;  4NE6 A;  4YM6 B;  3REL C;  3AZI C;  2ARO D;  5B2J B;  4WU9 D;  2G5H C;  1B67 A;  1W2E A;  4WU9 A;  2YFW B;  5CPK A;  3WTP C;  1TZY D;  4JJN C;  3EPH A;  5B0Z A;  4J8X C;  1N1J B;  4H9N B;  5B2I C;  2Y2M A;  4H9Q A;  3EPJ A;  5GT3 C;  2HUE B;  5AY8 A;  4KGC B;  3MGQ C;  2LY8 A;  2ZY3 A;  2FJ7 A;  2Y2G A;  1AOI D;  5B1M D;  4J8V A;  1F66 B;  3REK C;  3O62 D;  3AZF C;  2VQR A;  4XUJ B;  1M18 C;  3B0B A;  3LJA C;  3B6G B;  1BH9 A;  3REI D;  1P3P D;  1P3P A;  5AV6 D;  3W97 C;  5B1L D;  5AV6 A;  2CV5 C;  5B1L A;  5AV8 C;  3UT9 D;  5CPJ B;  3UT9 A;  5GT0 B;  3LZ1 C;  4AWL C;  2YFV B;  5AV9 C;  1Z2C B;  3EG5 B;  1S32 B;  4J8W C;  3LEL C;  1P3L A;  1M1A D;  3W96 B;  3AZK C;  3W98 C;  5GSU C;  1M1A A;  2NQB D;  3B0D C;  3A6N D;  3A6N A;  4R8P C;  3X1S A;  3AZN C;  3AYW D;  3AZJ D;  3AYW A;  1KX5 B;  2Y2I A;  4KHA B;  4J8U C;  5B32 A;  3MNN A;  3MGR D;  5B0Y D;  3VH6 W;  3VH5 A;  1Q9C A;  5B0Y A;  5B24 B;  3TU4 C;  5JRG C;  4XZQ A;  3KWQ C;  1P3I C;  5BNX A;  1EQZ C;  4YS3 B;  1KX4 B;  3X1T C;  3KUY B;  2HIO C;  5B40 D;  5B40 A;  1P3F A;  5E5A B;  3P5J B;  4DRA A;  3IP4 C;  3AV2 B;  3VH5 T;  3REL D;  3REL A;  1ZLA C;  3AZI A;  4G91 B;  2ARO B;  5CPK C;  3AZG B;  5CP6 C;  2JSS A;  1P3A B;  1TZY B;  3WTP A;  3W99 D;  4JJN D;  4JJN A;  3AZL B;  4J8X D;  4Z66 D;  4CSR B;  4J8X A;  5B2I D;  4WNN A;  1PZR A;  5GT3 D;  5GT3 A;  3C1B A;  1TAF B;  5AVB C;  3MGQ D;  4LD9 B;  5GXQ C;  5B31 C;  4J8V C;  3REJ C;  4EO5 B;  3B6F C;  1KU5 A;  5B1M B;  4H9O A;  3X1U A;  3O62 B;  3REK D;  1P3B C;  3UTA B;  3AZF A;  5B33 A;  4X23 C;  4ZUX C;  1M18 D;  1KX3 B;  1M18 A;  3A1I A;  3AZE C;  5AVC B;  3LJA A;  3MGS B;  3REI B;  2BYM B;  3W97 D;  4CAY A;  3W97 A;  3AV1 B;  5AV8 D;  2CV5 A;  5AV8 A;  3AN2 C;  3MVD A;  5AV9 D;  3LZ1 A;  3NQJ A;  3WA9 A;  5AV9 A;  2CWE A;  4J8W D;  2F8N K;  1HQ3 B;  5DNN C;  3LEL A;  3C1C B;  3AZK D;  2NQB B;  3AZK A;  3W98 A;  5GSU A;  1HTA A;  3X1V B;  3AZN D;  3AZJ B;  4R8P A;  1BH8 A;  5G49 B;  4KUD C;  3MGR B;  4J8U A;  4DRB A;  4XZQ C;  5JRG D;  3KWQ D;  3TU4 A;  5JRG A;  3KWQ A;  1P3I A;  1EQZ D;  1EQZ A;  3X1T D;  1WWI A;  2HIO D;  3LZ0 C;  3X1T A;  2IO5 C;  1P3F C;  2HIO A;  2BG1 A;  1P3G D;  5KDM A;  3AFA B;  3AZM C;  4QLC B;  2J8P A;  3AZH C;  3REH C;  1P3O B;  1M19 C;  3AL0 C;  1ZLA A;  5CPK D;  1U35 C;  5F99 C;  5CP6 A;  3KXB B;  4H9P A;  5B0Z D;  3W99 B;  4Z66 B;  3MGP C;  5B2I B;  5AY8 D;  3C1B C;  3FDD A;  4H9S C;  3MGQ B;  5AVB D;  2FJ7 D;  5GXQ D;  4UUZ A;  5AVB A;  5B31 D;  5GXQ A;  5B31 A;  3NQU A;  4J8V D;  3REJ D;  3REJ A;  3B6F A;  3X1U C;  1ID3 A;  3REK B;  1P3M B;  5B33 C;  4YM6 C;  1P3B A;  4X23 D;  4Z5T B; 
#chains in the Genus database with same CATH homology
 4ZUX D;  4X23 A;  4HGA B;  5B2J C;  2ZY4 A;  4ZUX A;  3AZE A;  3AZG A;  3H0L C;  5CPI B;  4WU8 B;  3A1K A;  2DF4 C;  1F1E A;  3AZL A;  3WAA A;  3AN2 D;  3MVD C;  3WKJ B;  2HUE C;  3AN2 A;  3WA9 C;  2Y2P A;  4E45 A;  2PYO B;  4KGC C;  2BYK A;  4J8W B;  1R4V A;  2ZY5 A;  3R45 B;  1P3L D;  5DNN A;  1F66 C;  4WZS B;  4XUJ C;  1P3K B;  3H0M C;  3X1S D;  2F8N D;  3UTA A;  5BNV B;  2F8N A;  4H9R B;  5AV5 B;  3B6G C;  5B32 D;  3MNN D;  4KUD D;  4KUD A;  5DNM B;  3H0R C;  3VH6 A;  1P34 B;  4XZQ D;  5CPJ C;  5BT1 D;  5BO0 A;  5GT0 C;  3UTB B;  3F6T A;  2JE5 A;  4NFT A;  3V9R A;  1P3F D;  2Y2Q A;  1S32 C;  3LZ0 A;  1P3G B;  1BFM A;  3W96 C;  3VH6 T;  3AZM A;  4WV4 B;  5FUG A;  3AZI D;  5JA4 A;  3REH D;  1M19 D;  3AZH A;  3REH A;  1KX5 C;  1M19 A;  4WU9 B;  1U35 D;  1H3O A;  5F99 D;  3WTP D;  1U35 A;  5B24 C;  5F99 A;  5B0Z B;  4H9Q B;  4YS3 C;  3MGP D;  1JFI A;  3MGP A;  1KX4 C;  5AY8 B;  3C1B D;  3KFU G;  3KUY C;  4H9S A;  2FJ7 B;  2DQN C;  5E5A C;  2G5I C;  1ID3 C;  1AOI B;  3AFA A;  3X1U D;  3AV2 C;  4QLC A;  3AZF D;  5B33 D;  2NZD A;  4YM6 A;  4G91 C;  2ARO C;  3EPK A;  1BH9 B;  5B2J D;  3LJA D;  5B2J A;  1ULY A;  3AZG C;  1P3P B;  2YFW A;  4Z2M G;  1P3A C;  1TZY C;  2ZY2 A;  5AV6 B;  5B1L B;  3AZL C;  2CV5 D;  3UT9 B;  3WAA C;  1N1J A;  4H9N A;  3B0C W;  3MVD D;  4G92 B;  3LZ1 D;  3WA9 D;  4LD9 C;  4KGC A;  4EO5 C;  3LEL D;  5B1M C;  1P3L B;  1M1A B;  1F66 D;  3W98 D;  5GSU D;  1F66 A;  2UWX A;  3A6N B;  4XUJ D;  3UTA C;  3X1S B;  4XUJ A;  4R8P D;  3AYW B;  1KX3 C;  4WJ3 C;  4UPK A;  3B6G D;  5AVC C;  5B32 B;  3MNN B;  3MGS C;  5B31 G;  3REI C;  3B6G A;  4J8U D;  3KSY A;  5B0Y B;  4XZQ B;  5BNX B;  3TU4 D;  3AV1 C;  1P3I D;  5CPJ D;  4ZBJ B;  5CPJ A;  5GT0 A;  4NE3 A;  2YFV A;  4M6B A;  5C3I B;  5B40 B;  1P3F B;  1S32 D;  1S32 A;  1HQ3 C;  3C1C C;  2JCH A;  3W96 A;  2NQB C;  3REL B;  3X1V C;  3AZI B;  3AZJ C;  1ZLA D;  1KX5 D;  1KX5 A;  4KHA A;  5CP6 D;  3MGR C;  3WTP B;  1A7W A;  1WWS A;  5B24 D;  4JJN B;  5B24 A;  4J8X B;  4YS3 D;  1B6W A;  2F8N G;  4YS3 A;  5GT3 B;  1KX4 A;  3KUY D;  3KUY A;  2RVQ C;  5B32 G;  4DQY B;  5E5A A;  3B6F D;  3AFA C;  1ID3 D;  4H9O B;  4QLC C;  3X1U B;  3AV2 A;  2NZD C;  3AZF B;  5B33 B;  1P3B D;  1P3O C;  1M18 B;  3LJA B;  2ARO A;  3AZE D;  3AZG D;  3KXB C;  1P3A D;  4E44 A;  3W99 C;  1P3A A;  4CAY B;  3W97 B;  1TZY A;  2CV5 B;  4Z66 C;  3AZL D;  5AV8 B;  3WAA D;  4CSR A;  3MVD B;  2XD5 A;  3LZ1 B;  4AWL B;  3NQJ B;  3WA9 B;  5AV9 B;  4LD9 D;  1TAF A;  4LD9 A;  2Y2L A;  3LEL B;  5DNN D;  1AOI A;  5B1M A;  3AZK B;  3W98 B;  5GSU B;  1P3M C;  3O62 A;  3B0D B;  3UTA D;  4Z5T C;  4R8P B;  3AZN B;  1KX3 D;  4HGA C;  1BH8 B;  1KX3 A;  5AVC D;  3MGS D;  5AVC A;  4J8U B;  3MGS A;  3REI A;  2BYM A;  5CPI C;  4WU8 C;  3TU4 B;  5JRG B;  3KWQ B;  3AV1 D;  1P3I B;  3AV1 A;  1EQZ B;  3WKJ C;  2PYO C;  3X1T B;  2HIO B;  3LZ0 D;  2Y2K A;  5KDM B;  5BS7 C;  2L5A A;  1HQ3 D;  1HQ3 A;  3C1C D;  3AZM D;  3C1C A;  1P3K C;  2NQB A;  3X1V D;  3AZH D;  1ZLA B;  3X1V A;  3AZJ A;  5AV5 C;  5G49 A;  5CPK B;  2XD1 A;  5CP6 B;  1T3U A;  5DNM C;  4H9P B;  3VH5 W;  3MGR A;  1P34 C;  2RIQ A;  3UTB C;  4UUZ B;  5AVB B;  5GXQ B;  2RVQ D;  5B31 B;  3NQU B;  1P3G C;  4J8V B;  3REJ B;  3B6F B;  3AFA D;  1ID3 B;  4QLC D;  2NZD D;  1P3B B;  4YM6 D;  5CHL B;  4X23 B;  1P3O D;  4ZUX B;  4Z2M H;  1P3O A;  4WU9 C;  3AZE B;  2Y2J A;  3KXB D;  5B0Z C;  3KXB A;  3W99 A;  3WAA B;  4Z66 A;  3AN2 B;  5AY8 C;  5B2I A;  4KGC D;  2FFF B;  2FJ7 C;  2BYK B;  3MGQ A;  1AOI C;  5DNN B;  3O62 C;  1P3M D;  3REK A;  1P3M A;  2F8N B;  3EPL A;  4Z5T D;  4Z5T A;  2ZM5 A;  3B0C T;  1P3P C;  4KUD B;  5CPI D;  4WU8 D;  5AV6 C;  2Y2H A;  5CPI A;  5B1L C;  4WU8 A;  3UT9 C;  5BO0 B;  5GT0 D;  4G92 C;  3WKJ D;  3V9R B;  2PYO D;  3WKJ A;  2PYO A;  2Y2O A;  3LZ0 B;  2IO5 B;  2F2A C;  4NE5 A;  5BS7 A;  1P3L C;  4J8W A;  1M1A C;  3R45 A;  3AZM B;  3W96 D;  3WTP E;  3A6N C;  1P3K D;  5FUG B;  3X1S C;  5JA4 B;  1P3K A;  3AYW C;  3AZH B;  3REH B;  5BNV A;  3AZN A;  1M19 B;  5AV5 D;  4H9R A;  5B32 C;  5AV5 A;  3MNN C;  1H3O B;  1U35 B;  5B0Y C;  5DNM D;  5F99 B;  5DNM A;  1P34 D;  2F8N H;  1P34 A;  5BT1 C;  4ZBJ C;  1JFI B;  4WNN B;  3MGP B;  3UTB D;  1KX4 D;  2Y2N A;  3C1B B;  3UTB A;  2W8S A;  5B40 C;  5C3I C;  5E5A D;  1P3G A;  3AV2 D;  2NZD B;  4NE6 A;  4YM6 B;  3REL C;  3AZI C;  2ARO D;  5B2J B;  4WU9 D;  2G5H C;  1B67 A;  1W2E A;  4WU9 A;  2YFW B;  5CPK A;  3WTP C;  1TZY D;  4JJN C;  3EPH A;  5B0Z A;  4J8X C;  1N1J B;  4H9N B;  5B2I C;  2Y2M A;  4H9Q A;  3EPJ A;  5GT3 C;  2HUE B;  5AY8 A;  4KGC B;  3MGQ C;  2LY8 A;  2ZY3 A;  2FJ7 A;  2Y2G A;  1AOI D;  5B1M D;  4J8V A;  1F66 B;  3REK C;  3O62 D;  3AZF C;  2VQR A;  4XUJ B;  1M18 C;  3B0B A;  3LJA C;  3B6G B;  1BH9 A;  3REI D;  1P3P D;  1P3P A;  5AV6 D;  3W97 C;  5B1L D;  5AV6 A;  2CV5 C;  5B1L A;  5AV8 C;  3UT9 D;  5CPJ B;  3UT9 A;  5GT0 B;  3LZ1 C;  4AWL C;  2YFV B;  5AV9 C;  1Z2C B;  3EG5 B;  1S32 B;  4J8W C;  3LEL C;  1P3L A;  1M1A D;  3W96 B;  3AZK C;  3W98 C;  5GSU C;  1M1A A;  2NQB D;  3B0D C;  3A6N D;  3A6N A;  4R8P C;  3X1S A;  3AZN C;  3AYW D;  3AZJ D;  3AYW A;  1KX5 B;  2Y2I A;  4KHA B;  4J8U C;  5B32 A;  3MNN A;  3MGR D;  5B0Y D;  3VH6 W;  3VH5 A;  1Q9C A;  5B0Y A;  5B24 B;  3TU4 C;  5JRG C;  4XZQ A;  3KWQ C;  1P3I C;  5BNX A;  1EQZ C;  4YS3 B;  1KX4 B;  3X1T C;  3KUY B;  2HIO C;  5B40 D;  5B40 A;  1P3F A;  5E5A B;  3P5J B;  4DRA A;  3IP4 C;  3AV2 B;  3VH5 T;  3REL D;  3REL A;  1ZLA C;  3AZI A;  4G91 B;  2ARO B;  5CPK C;  3AZG B;  5CP6 C;  2JSS A;  1P3A B;  1TZY B;  3WTP A;  3W99 D;  4JJN D;  4JJN A;  3AZL B;  4J8X D;  4Z66 D;  4CSR B;  4J8X A;  5B2I D;  4WNN A;  1PZR A;  5GT3 D;  5GT3 A;  3C1B A;  1TAF B;  5AVB C;  3MGQ D;  4LD9 B;  5GXQ C;  5B31 C;  4J8V C;  3REJ C;  4EO5 B;  3B6F C;  1KU5 A;  5B1M B;  4H9O A;  3X1U A;  3O62 B;  3REK D;  1P3B C;  3UTA B;  3AZF A;  5B33 A;  4X23 C;  4ZUX C;  1M18 D;  1KX3 B;  1M18 A;  3A1I A;  3AZE C;  5AVC B;  3LJA A;  3MGS B;  3REI B;  2BYM B;  3W97 D;  4CAY A;  3W97 A;  3AV1 B;  5AV8 D;  2CV5 A;  5AV8 A;  3AN2 C;  3MVD A;  5AV9 D;  3LZ1 A;  3NQJ A;  3WA9 A;  5AV9 A;  2CWE A;  4J8W D;  2F8N K;  1HQ3 B;  5DNN C;  3LEL A;  3C1C B;  3AZK D;  2NQB B;  3AZK A;  3W98 A;  5GSU A;  1HTA A;  3X1V B;  3AZN D;  3AZJ B;  4R8P A;  1BH8 A;  5G49 B;  4KUD C;  3MGR B;  4J8U A;  4DRB A;  4XZQ C;  5JRG D;  3KWQ D;  3TU4 A;  5JRG A;  3KWQ A;  1P3I A;  1EQZ D;  1EQZ A;  3X1T D;  1WWI A;  2HIO D;  3LZ0 C;  3X1T A;  2IO5 C;  1P3F C;  2HIO A;  2BG1 A;  1P3G D;  5KDM A;  3AFA B;  3AZM C;  4QLC B;  2J8P A;  3AZH C;  3REH C;  1P3O B;  1M19 C;  3AL0 C;  1ZLA A;  5CPK D;  1U35 C;  5F99 C;  5CP6 A;  3KXB B;  4H9P A;  5B0Z D;  3W99 B;  4Z66 B;  3MGP C;  5B2I B;  5AY8 D;  3C1B C;  3FDD A;  4H9S C;  3MGQ B;  5AVB D;  2FJ7 D;  5GXQ D;  4UUZ A;  5AVB A;  5B31 D;  5GXQ A;  5B31 A;  3NQU A;  4J8V D;  3REJ D;  3REJ A;  3B6F A;  3X1U C;  1ID3 A;  3REK B;  1P3M B;  5B33 C;  4YM6 C;  1P3B A;  4X23 D;  4Z5T B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...