3AZFC

Crystal structure of human nucleosome core particle containing h3k79q mutation
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
108
structure length
108
Chain Sequence
b'RAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 32
structure length 108
sequence length 108
chains with identical sequence G
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3azfC00
3VH5A 2NQBC 4H9QA 2PYOC 3MGRA 4G91B 5B1LB 5B31A 3AZFB 2CV5C 3W99A 5B1MD 4WZSB 3WA9C 1Q9CA 1BFMA 5CP6A 2AROA 1P3AD 1F1EA 5JRGC 3LZ0D 4YS3A 1N1JB 3REHD 3MVDA 3B6FC 3LJAD 1M1AA 3REJD 3AZMB 1KX4C 4Z66B 2IO5C 4WU9A 5F99A 5AV6B 5B0YC 3KXBB 3AZGB 4YM6C 4KGCC 4ZUXD 5G49A 3TU4B 4M6BA 3KWQD 5B1MA 2JSSA 5DNND 2NZDB 5GT0B 1S32D 5GSUD 3B0BA 3UTAB 2HIOC 5B40A 5B33B 1KX3A 5E5AD 3MGPC 4WU8B 3LZ0A 3AZJD 3W96D 3A6NA 3REHA 5DNMD 3AFAD 3W97C 5GT3A 3REJA 3X1UD 4Z2MG 3WAAC 5CPJB 1M18C 4HGAB 1P3OC 1P3PD 2NQBB 4R8PD 2PYOB 5C3IC 3X1SC 4XUJA 1P3MB 5B2IC 4ZUXA 4H9PB 5BO0B 5CPIB 2CV5D 3UT9C 5CPKC 1P3KD 3KWQA 1TZYD 3RELB 3UTBC 3AZHB 5BS7C 1S32A 5AV8D 3B6FB 5CHLB 4G92C 3W96A 5B2JD 4J8WC 4X23B 3AZJA 4Z5TA 5DNMA 3AV2C 1EQZB 4KUDC 1P3BC 5B0YB 1P3ID 3AZIB 1F66B 3REKB 3LELC 3R45B 1KX5B 4H9RA 4YM6B 3MGSC 3AN2C 2YFWB 4NFTA 5BT1C 1H3OB 3KUYB 5KDMB 4UUZB 5B32B 3X1VD 4R8PA 3AZKD 1HTAA 4KHAA 3MNND 2CV5A 3WA9A 4G91C 5B1LC 3KSYA 5JRGA 3MGPD 3W97B 3AV1B 3B6FA 3VH6T 1P34D 3C1BC 1M18B 1P3OB 1KX4A 3B6GD 5B0YA 4EO5C 3LZ1D 5C3IB 3AZMC 5AV6C 2FJ7B 3X1SD 4KGCA 3KXBC 3MGRD 4J8VD 5B31D 5CPKB 1BH9B 3UTBB 4H9SC 3MNNA 5AVBB 1P3FB 3TU4C 4H9NB 1P3LC 5BNVA 4YS3D 2NZDC 2HIOA 5JA4A 5GT0C 3MGPA 4J8WD 3MVDD 3AZNB 3UTAC 1P3BB 5B33C 3AV2D 1M1AD 3W97A 1P3GB 1U35C 5AV5C 3AN2B 3C1CC 1P34A 5F99D 3WAAA 3MGSD 2BYKA 4JJNC 3B6GA 1P3OA 4HGAC 3X1SA 2RVQD 4WNNB 5B2IA 5B24C 4J8XB 3WKJC 5AY8C 4J8VA 3UT9A 1P3MC 4WV4B 5CPIC 1BH8A 3AZFD 1ZLAC 3NQJB 4XZQB 1KX3D 5B40D 3WTPC 1HQ3C 3RELC 3A6ND 4E45A 3AZHC 4J8WA 3C1BB 3AV2A 5GT3D 4KUDA 2F8NB 4X23C 3AZEB 4EO5B 3O62B 1EQZC 3AYWB 3LELA 4CSRA 3AZIC 3MGSA 4Z66D 3REKC 1F66C 2YFVA 4ZBJC 5AV6D 1KX5C 4XUJD 3AZGD 1P3AB 3KUYC 5B32C 3WTPE 4DRBA 1P3LB 3MGQB 5B1LA 5AV9B 3LJAB 2L5AA 3AZFA 5GXQC 4AWLC 5GT0D 3VH6W 3UTAD 4Z5TD 5B33D 1U35B 5AV5B 4WU8D 1JFIB 1N1JA 3C1CB 3AV1C 3VH6A 3C1BA 4JJNB 3W98B 3AZMA 4Z66A 5CPJD 5AV6A 5B24B 5DNNB 3WKJB 5AY8B 2HUEB 2NQBD 3KXBA 2PYOD 3AZGA 2FJ7C 4J8UC 1ZLAB 2F8NG 5E5AB 3V9RB 3WA9D 4H9SA 4LD9B 3WTPB 3AFAB 1HQ3B 3TU4A 1P3FC 5AVBC 5JRGD 1P3LA 2NZDA 5GT0A 3UTAA 3B6FD 5B33A 4Z2MH 4WU8A 4X23D 3AZNC 3REIC 1P3PB 1AOIC 5AV5A 1P3GC 1KX4D 4ZBJB 1M19B 5B0YD 3X1TC 5BNXB 4YM6D 4KGCD 5CPJA 1TZYB 3KUYD 2NQBA 2PYOA 3WKJA 5CP6C 2AROC 5GXQB 4J8XC 5B2JB 4AWLB 4H9PA 1P3MA 5BO0A 5CPIA 1ZLAA 3AZLC 1TAFB 2HIOD 3RELA 1P3IB 4XZQC 5B0ZB 3AZHA 3W97D 4NE3A 3AV1D 4X23A 4H9OB 3NQUB 3WAAD 1EQZA 3X1VB 1M18D 3AZEC 3O62C 3AZIA 1P3OD 3REKA 3AYWC 1F66A 3R45A 1KX5A 4YM6A 4J8UB 2YFWA 5AVCB 5B2ID 2FJ7D 1WWIA 3UT9D 1H3OA 3KUYA 5KDMA 5B32A 4UUZA 1ID3B 5CPKD 1P3AC 2BYMB 3UTBD 1P3FD 4CAYB 5GXQA 3MGQC 5AV9C 3LJAC 1TAFA 3REIB 1AOIB 4KUDD 3LZ1B 3AZND 1P3BD 4QLCB 3AV1A 3X1TB 3LELD 3B0CT 4H9QB 3MGRB 3AN2D 4H9OA 5BT1D 1M18A 3W99B 3W98C 5CP6B 2AROB 1WWSA 3KWQC 5DNNC 4YS3B 2FJ7A 4J8UA 2HUEC 3AZLB 5GSUC 3MVDB 5B1LD 5CPKA 1BH9A 1M1AB 3W96C 5E5AC 3UTBA 4LD9C 4E44A 1P3FA 5AVBA 3AFAC 2LY8A 5BS7A 4H9NA 4WU9B 5F99B 3X1UC 3AZNA 3C1BD 1P3BA 1AOIA 1P3GA 5G49B 3AZED 1P3PC 3X1TA 3AZMD 3AN2A 1M19C 5B1MB 3KXBD 4NE6A 1KX3B 1A7WA 5B40B 1P3KC 4NE5A 3LZ0B 1TZYC 3A6NB 3REHB 3TU4D 4WNNA 4J8XA 5AV8C 1P3LD 5B31G 3MGQD 5GT3B 3AZLA 3REJB 5B2JC 2NZDD 5AV9D 3NQJA 4XZQA 1P3IC 5B0ZC 1U35D 5AV5D 3B0DC 3C1CD 4XUJB 4ZUXB 2F8NA 3AZEA 4JJND 3O62A 3W98D 3X1VC 3AYWA 3AZKC 3KWQB 3MNNC 5B24D 1S32B 5GSUB 3WKJD 5AY8D 5AVCC 1P3MD 3W96B 3AZJB 4Z5TB 5CPID 1ZLAD 1P3AA 1ID3C 5DNMB 4LD9D 3WTPD 1HQ3D 4DRAA 3MGQA 3RELD 5AV9A 3LJAA 3X1UB 3AZHD 3B0CW 4H9RB 1P34C 1U35A 3B6GC 1EQZD 4R8PB 3LZ1C 1JFIA 3C1CA 4QLCC 3AZID 1F66D 3REKD 4KHAB 3VH5T 2CV5B 4JJNA 1M19D 1KX5D 1B6WA 3W98A 3WA9B 3MGRC 2F8NH 4J8VC 5B31C 1P3KB 2CWEA 3W99C 5B32D 5JRGB 5B24A 5DNNA 5AV8B 5AY8A 3AYWD 5GSUA 4YS3C 5GXQD 5E5AA 3V9RA 3MVDC 4LD9A 3WTPA 3AFAA 1HQ3A 1M1AC 1R4VA 1KX4B 2IO5B 3B0DB 5B0ZD 3X1UA 4WU9C 5F99C 4KGCB 3AZKB 1P3PA 5FUGB 1B67A 3MNNB 1M19A 2RVQC 5B1MC 5BNXA 5BNVB 4J8UD 2HIOB 5AVCD 1P3KA 3AZFC 5JA4B 3MGPB 1TZYA 1KX3C 1ID3D 5B40C 3LZ0C 5AV8A 3A6NC 3REHC 5AVBD 5B2JA 1P34B 3WAAB 5GT3C 3REJC 2BYKB 3B6GB 1P3IA 3REID 5B0ZA 1AOID 2F8NK 1P3GD 4QLCD 4Z66C 3X1SB 3X1TD 5B2IB 4J8VB 5B31B 3UT9B 3NQUA 4XUJC 3AZGC 3X1VA 4ZUXC 1KU5A 3AZKA 1BH8B 3W99D 5FUGA 5CP6D 2AROD 5AVCA 4G92B 4J8XD 4J8WB 1S32C 1ID3A 3AV2B 3AZLD 4KUDB 5B32G 3AZJC 4Z5TC 5DNMC 2BYMA 4XZQD 4WU8C 3LELB 4CSRB 4CAYA 3MGSB 4WU9D 2YFVB 1ULYA 3VH5W 3REIA 3LZ1A 2F8ND 4QLCA 5CPJC 3O62D 4R8PC
chains in the Genus database with same CATH superfamily
3VH5A 2NQBC 4H9QA 2PYOC 3MGRA 4G91B 5B1LB 5B31A 3AZFB 2CV5C 3W99A 5B1MD 4WZSB 3WA9C 1Q9CA 1BFMA 5CP6A 2AROA 1P3AD 1F1EA 5JRGC 3LZ0D 4YS3A 1N1JB 3REHD 3EPKA 3MVDA 3B6FC 3LJAD 1M1AA 3REJD 3AZMB 1KX4C 4Z66B 2IO5C 4WU9A 5F99A 5AV6B 5B0YC 3H0RC 3KXBB 3AZGB 4YM6C 4KGCC 4ZUXD 5G49A 3TU4B 4M6BA 2DQNC 3KWQD 5B1MA 2JSSA 5DNND 2NZDB 5GT0B 1S32D 5GSUD 3B0BA 3UTAB 2HIOC 5B40A 5B33B 1KX3A 2DF4C 5E5AD 3MGPC 4WU8B 3LZ0A 3AZJD 3W96D 3A6NA 3REHA 5DNMD 3AFAD 3W97C 2J8PA 5GT3A 3REJA 3X1UD 4Z2MG 3WAAC 5CPJB 1M18C 4HGAB 1P3OC 1P3PD 2NQBB 4R8PD 2PYOB 5C3IC 3X1SC 1W2EA 4XUJA 1P3MB 5B2IC 4ZUXA 4H9PB 5BO0B 5CPIB 3FDDA 2CV5D 2Y2PA 3UT9C 5CPKC 3IP4C 1P3KD 3KWQA 1TZYD 3RELB 3UTBC 3AZHB 5BS7C 1S32A 5AV8D 3B6FB 5CHLB 4G92C 3W96A 5B2JD 2FFFB 4X23B 4J8WC 4Z5TA 3AZJA 5DNMA 3AV2C 1EQZB 4KUDC 1P3BC 5B0YB 1P3ID 3AZIB 1F66B 3REKB 3LELC 3R45B 2ZY4A 1KX5B 4H9RA 4YM6B 3MGSC 3AN2C 2YFWB 4NFTA 5BT1C 4DQYB 1H3OB 3KUYB 5KDMB 4UUZB 5B32B 3X1VD 4R8PA 3AZKD 1HTAA 4KHAA 3MNND 2CV5A 3WA9A 4G91C 5B1LC 3A1IA 3EG5B 3KSYA 5JRGA 3MGPD 3W97B 3AV1B 3B6FA 3VH6T 1P34D 3C1BC 1M18B 2Y2KA 1P3OB 1KX4A 3AL0C 3B6GD 5B0YA 4EO5C 3LZ1D 5C3IB 3AZMC 5AV6C 2FJ7B 3X1SD 4KGCA 3KXBC 3MGRD 4J8VD 5B31D 5CPKB 1BH9B 3UTBB 4H9SC 3MNNA 5AVBB 1P3FB 3TU4C 4H9NB 1P3LC 5BNVA 4YS3D 2NZDC 2HIOA 5JA4A 5GT0C 3MGPA 4J8WD 3MVDD 3AZNB 3UTAC 1P3BB 5B33C 3AV2D 1M1AD 3W97A 1P3GB 1U35C 5AV5C 3AN2B 3C1CC 1P34A 5F99D 3WAAA 3MGSD 2BYKA 4JJNC 2ZY5A 3B6GA 1P3OA 4HGAC 3X1SA 2RVQD 4WNNB 5B2IA 5B24C 4J8XB 3WKJC 5AY8C 4J8VA 3H0MC 3UT9A 2W8SA 1P3MC 4WV4B 5CPIC 1BH8A 3AZFD 1ZLAC 3NQJB 4XZQB 1KX3D 5B40D 3WTPC 1HQ3C 3RELC 3A6ND 4E45A 3AZHC 4J8WA 3C1BB 3AV2A 5GT3D 4KUDA 2F8NB 4X23C 3AZEB 4EO5B 3O62B 1EQZC 1Z2CB 3A1KA 3LELA 4CSRA 3AYWB 3AZIC 3MGSA 4Z66D 3REKC 1F66C 2YFVA 4ZBJC 5AV6D 1KX5C 4XUJD 3AZGD 2Y2IA 1P3AB 3KUYC 5B32C 4UPKA 3WTPE 4DRBA 1P3LB 3EPHA 3MGQB 5B1LA 5AV9B 3LJAB 2L5AA 3AZFA 5GXQC 4AWLC 2JE5A 3VH6W 5GT0D 2F2AC 3UTAD 4Z5TD 5B33D 1U35B 5AV5B 4WU8D 1JFIB 1N1JA 3C1CB 3AV1C 3VH6A 3C1BA 4JJNB 3W98B 3AZMA 4Z66A 5CPJD 5AV6A 5B24B 5DNNB 3WKJB 5AY8B 2HUEB 2NQBD 3KXBA 2PYOD 3AZGA 2FJ7C 4J8UC 1ZLAB 2F8NG 5E5AB 3V9RB 3EPLA 4H9SA 3WA9D 4LD9B 3WTPB 3AFAB 1HQ3B 3TU4A 1P3FC 5AVBC 5JRGD 1P3LA 2NZDA 5GT0A 3UTAA 3B6FD 5B33A 4Z2MH 3KFUG 2ZY3A 4WU8A 4X23D 3AZNC 3REIC 1P3PB 1AOIC 5AV5A 1P3GC 1KX4D 4ZBJB 1M19B 5B0YD 3X1TC 2Y2GA 5BNXB 4YM6D 4KGCD 5CPJA 1TZYB 2Y2NA 3KUYD 2RIQA 2NQBA 2PYOA 3WKJA 5CP6C 2AROC 5GXQB 4J8XC 5B2JB 4AWLB 4H9PA 1P3MA 5BO0A 5CPIA 1ZLAA 3AZLC 1TAFB 2HIOD 3RELA 1P3IB 4XZQC 5B0ZB 3AZHA 3W97D 4NE3A 3AV1D 4X23A 4H9OB 3NQUB 3WAAD 1EQZA 3X1VB 1M18D 3AZEC 3O62C 3AZIA 3H0LC 3REKA 3AYWC 1P3OD 1F66A 3R45A 1KX5A 2Y2MA 4YM6A 4J8UB 2YFWA 5AVCB 5B2ID 2FJ7D 1WWIA 3UT9D 1H3OA 3P5JB 5KDMA 5B32A 4UUZA 3KUYA 1ID3B 5CPKD 1P3AC 2BYMB 3UTBD 1P3FD 4CAYB 5GXQA 3MGQC 5AV9C 3LJAC 1TAFA 3REIB 1AOIB 4KUDD 3LZ1B 3AZND 1P3BD 4QLCB 3AV1A 3X1TB 3LELD 3B0CT 4H9QB 3MGRB 3AN2D 4H9OA 5BT1D 1M18A 3W99B 3W98C 4WJ3C 5CP6B 2AROB 1WWSA 3KWQC 5DNNC 4YS3B 2FJ7A 4J8UA 2HUEC 3AZLB 5GSUC 3MVDB 5B1LD 5CPKA 1BH9A 1M1AB 3W96C 5E5AC 3UTBA 4LD9C 4E44A 1P3FA 5AVBA 3AFAC 2LY8A 5BS7A 4H9NA 4WU9B 5F99B 2Y2LA 3X1UC 2Y2HA 3AZNA 3C1BD 1P3BA 1AOIA 1P3GA 5G49B 3AZED 1P3PC 3X1TA 3AZMD 3AN2A 2VQRA 2ZM5A 1M19C 5B1MB 2Y2QA 3KXBD 4NE6A 1KX3B 1A7WA 5B40B 1P3KC 4NE5A 3LZ0B 1TZYC 3A6NB 3REHB 1PZRA 4WNNA 4J8XA 3TU4D 5AV8C 1P3LD 5B31G 3MGQD 5GT3B 3AZLA 2XD1A 5B2JC 3REJB 2NZDD 5AV9D 3NQJA 4XZQA 1P3IC 5B0ZC 1U35D 5AV5D 3B0DC 3C1CD 4XUJB 4ZUXB 2F8NA 3AZEA 4JJND 3O62A 2BG1A 3W98D 3X1VC 3AYWA 2ZY2A 3AZKC 3KWQB 3MNNC 5B24D 1S32B 5GSUB 3WKJD 5AY8D 5AVCC 1P3MD 3W96B 3AZJB 4Z5TB 5CPID 1ZLAD 1P3AA 1ID3C 5DNMB 2JCHA 4LD9D 3WTPD 1HQ3D 4DRAA 3MGQA 3RELD 5AV9A 3LJAA 3X1UB 3AZHD 2XD5A 3B0CW 4H9RB 1P34C 1U35A 3B6GC 1EQZD 4R8PB 2Y2OA 3LZ1C 1JFIA 3C1CA 4QLCC 2G5HC 3AZID 1T3UA 3REKD 1F66D 4KHAB 3VH5T 2CV5B 4JJNA 1M19D 1KX5D 1B6WA 3W98A 3WA9B 3MGRC 2F8NH 4J8VC 3F6TA 5B31C 2CWEA 3W99C 1P3KB 5B32D 5JRGB 5B24A 5DNNA 5AV8B 5AY8A 3AYWD 5GSUA 4YS3C 5GXQD 5E5AA 3V9RA 3MVDC 4LD9A 3WTPA 3AFAA 1HQ3A 1M1AC 1R4VA 1KX4B 2IO5B 3B0DB 5B0ZD 3X1UA 4WU9C 5F99C 4KGCB 3AZKB 1P3PA 2UWXA 5FUGB 1B67A 3MNNB 1M19A 2RVQC 5B1MC 5BNXA 5BNVB 3EPJA 4J8UD 2HIOB 5AVCD 1P3KA 3AZFC 5JA4B 3MGPB 1TZYA 1KX3C 1ID3D 5B40C 3LZ0C 5AV8A 3A6NC 3REHC 5AVBD 5B2JA 1P34B 3WAAB 5GT3C 3REJC 2BYKB 3B6GB 1P3IA 3REID 5B0ZA 1AOID 2F8NK 1P3GD 2Y2JA 4QLCD 4Z66C 3X1SB 3X1TD 5B2IB 4J8VB 5B31B 3UT9B 3NQUA 4XUJC 3AZGC 3X1VA 4ZUXC 1KU5A 3AZKA 1BH8B 3W99D 5FUGA 5CP6D 2AROD 5AVCA 4G92B 4J8XD 4J8WB 1S32C 1ID3A 3AV2B 3AZLD 4KUDB 5B32G 3AZJC 4Z5TC 5DNMC 2BYMA 4XZQD 4WU8C 3LELB 4CSRB 4CAYA 3MGSB 4WU9D 2YFVB 2G5IC 1ULYA 3VH5W 3REIA 3LZ1A 2F8ND 4QLCA 5CPJC 3O62D 4R8PC
chains in the Genus database with same CATH topology
3VH5A 2NQBC 4H9QA 2PYOC 3MGRA 4G91B 5B1LB 5B31A 3AZFB 2CV5C 3W99A 5B1MD 4WZSB 3WA9C 1Q9CA 1BFMA 5CP6A 2AROA 1P3AD 1F1EA 5JRGC 3LZ0D 4YS3A 1N1JB 3REHD 3EPKA 3MVDA 3B6FC 3LJAD 1M1AA 3REJD 3AZMB 1KX4C 4Z66B 2IO5C 4WU9A 5F99A 5AV6B 5B0YC 3H0RC 3KXBB 3AZGB 4YM6C 4KGCC 4ZUXD 5G49A 3TU4B 4M6BA 2DQNC 3KWQD 5B1MA 2JSSA 5DNND 2NZDB 5GT0B 1S32D 5GSUD 3B0BA 3UTAB 2HIOC 5B40A 5B33B 1KX3A 2DF4C 5E5AD 3MGPC 4WU8B 3LZ0A 3AZJD 3W96D 3A6NA 3REHA 5DNMD 3AFAD 3W97C 2J8PA 5GT3A 3REJA 3X1UD 4Z2MG 3WAAC 5CPJB 1M18C 4HGAB 1P3OC 1P3PD 2NQBB 4R8PD 2PYOB 5C3IC 3X1SC 1W2EA 4XUJA 1P3MB 5B2IC 4ZUXA 4H9PB 5BO0B 5CPIB 3FDDA 2CV5D 2Y2PA 3UT9C 5CPKC 3IP4C 1P3KD 3KWQA 1TZYD 3RELB 3UTBC 3AZHB 5BS7C 1S32A 5AV8D 3B6FB 5CHLB 4G92C 3W96A 5B2JD 2FFFB 4X23B 4J8WC 4Z5TA 3AZJA 5DNMA 3AV2C 1EQZB 4KUDC 1P3BC 5B0YB 1P3ID 3AZIB 1F66B 3REKB 3LELC 3R45B 2ZY4A 1KX5B 4H9RA 4YM6B 3MGSC 3AN2C 2YFWB 4NFTA 5BT1C 4DQYB 1H3OB 3KUYB 5KDMB 4UUZB 5B32B 3X1VD 4R8PA 3AZKD 1HTAA 4KHAA 3MNND 2CV5A 3WA9A 4G91C 5B1LC 3A1IA 3EG5B 3KSYA 5JRGA 3MGPD 3W97B 3AV1B 3B6FA 3VH6T 1P34D 3C1BC 1M18B 2Y2KA 1P3OB 1KX4A 3AL0C 3B6GD 5B0YA 4EO5C 3LZ1D 5C3IB 3AZMC 5AV6C 2FJ7B 3X1SD 4KGCA 3KXBC 3MGRD 4J8VD 5B31D 5CPKB 1BH9B 3UTBB 4H9SC 3MNNA 5AVBB 1P3FB 3TU4C 4H9NB 1P3LC 5BNVA 4YS3D 2NZDC 2HIOA 5JA4A 5GT0C 3MGPA 4J8WD 3MVDD 3AZNB 3UTAC 1P3BB 5B33C 3AV2D 1M1AD 3W97A 1P3GB 1U35C 5AV5C 3AN2B 3C1CC 1P34A 5F99D 3WAAA 3MGSD 2BYKA 4JJNC 2ZY5A 3B6GA 1P3OA 4HGAC 3X1SA 2RVQD 4WNNB 5B2IA 5B24C 4J8XB 3WKJC 5AY8C 4J8VA 3H0MC 3UT9A 2W8SA 1P3MC 4WV4B 5CPIC 1BH8A 3AZFD 1ZLAC 3NQJB 4XZQB 1KX3D 5B40D 3WTPC 1HQ3C 3RELC 3A6ND 4E45A 3AZHC 4J8WA 3C1BB 3AV2A 5GT3D 4KUDA 2F8NB 4X23C 3AZEB 4EO5B 3O62B 1EQZC 1Z2CB 3A1KA 3LELA 4CSRA 3AYWB 3AZIC 3MGSA 4Z66D 3REKC 1F66C 2YFVA 4ZBJC 5AV6D 1KX5C 4XUJD 3AZGD 2Y2IA 1P3AB 3KUYC 5B32C 4UPKA 3WTPE 4DRBA 1P3LB 3EPHA 3MGQB 5B1LA 5AV9B 3LJAB 2L5AA 3AZFA 5GXQC 4AWLC 2JE5A 3VH6W 5GT0D 2F2AC 3UTAD 4Z5TD 5B33D 1U35B 5AV5B 4WU8D 1JFIB 1N1JA 3C1CB 3AV1C 3VH6A 3C1BA 4JJNB 3W98B 3AZMA 4Z66A 5CPJD 5AV6A 5B24B 5DNNB 3WKJB 5AY8B 2HUEB 2NQBD 3KXBA 2PYOD 3AZGA 2FJ7C 4J8UC 1ZLAB 2F8NG 5E5AB 3V9RB 3EPLA 4H9SA 3WA9D 4LD9B 3WTPB 3AFAB 1HQ3B 3TU4A 1P3FC 5AVBC 5JRGD 1P3LA 2NZDA 5GT0A 3UTAA 3B6FD 5B33A 4Z2MH 3KFUG 2ZY3A 4WU8A 4X23D 3AZNC 3REIC 1P3PB 1AOIC 5AV5A 1P3GC 1KX4D 4ZBJB 1M19B 5B0YD 3X1TC 2Y2GA 5BNXB 4YM6D 4KGCD 5CPJA 1TZYB 2Y2NA 3KUYD 2RIQA 2NQBA 2PYOA 3WKJA 5CP6C 2AROC 5GXQB 4J8XC 5B2JB 4AWLB 4H9PA 1P3MA 5BO0A 5CPIA 1ZLAA 3AZLC 1TAFB 2HIOD 3RELA 1P3IB 4XZQC 5B0ZB 3AZHA 3W97D 4NE3A 3AV1D 4X23A 4H9OB 3NQUB 3WAAD 1EQZA 3X1VB 1M18D 3AZEC 3O62C 3AZIA 3H0LC 3REKA 3AYWC 1P3OD 1F66A 3R45A 1KX5A 2Y2MA 4YM6A 4J8UB 2YFWA 5AVCB 5B2ID 2FJ7D 1WWIA 3UT9D 1H3OA 3P5JB 5KDMA 5B32A 4UUZA 3KUYA 1ID3B 5CPKD 1P3AC 2BYMB 3UTBD 1P3FD 4CAYB 5GXQA 3MGQC 5AV9C 3LJAC 1TAFA 3REIB 1AOIB 4KUDD 3LZ1B 3AZND 1P3BD 4QLCB 3AV1A 3X1TB 3LELD 3B0CT 4H9QB 3MGRB 3AN2D 4H9OA 5BT1D 1M18A 3W99B 3W98C 4WJ3C 5CP6B 2AROB 1WWSA 3KWQC 5DNNC 4YS3B 2FJ7A 4J8UA 2HUEC 3AZLB 5GSUC 3MVDB 5B1LD 5CPKA 1BH9A 1M1AB 3W96C 5E5AC 3UTBA 4LD9C 4E44A 1P3FA 5AVBA 3AFAC 2LY8A 5BS7A 4H9NA 4WU9B 5F99B 2Y2LA 3X1UC 2Y2HA 3AZNA 3C1BD 1P3BA 1AOIA 1P3GA 5G49B 3AZED 1P3PC 3X1TA 3AZMD 3AN2A 2VQRA 2ZM5A 1M19C 5B1MB 2Y2QA 3KXBD 4NE6A 1KX3B 1A7WA 5B40B 1P3KC 4NE5A 3LZ0B 1TZYC 3A6NB 3REHB 1PZRA 4WNNA 4J8XA 3TU4D 5AV8C 1P3LD 5B31G 3MGQD 5GT3B 3AZLA 2XD1A 5B2JC 3REJB 2NZDD 5AV9D 3NQJA 4XZQA 1P3IC 5B0ZC 1U35D 5AV5D 3B0DC 3C1CD 4XUJB 4ZUXB 2F8NA 3AZEA 4JJND 3O62A 2BG1A 3W98D 3X1VC 3AYWA 2ZY2A 3AZKC 3KWQB 3MNNC 5B24D 1S32B 5GSUB 3WKJD 5AY8D 5AVCC 1P3MD 3W96B 3AZJB 4Z5TB 5CPID 1ZLAD 1P3AA 1ID3C 5DNMB 2JCHA 4LD9D 3WTPD 1HQ3D 4DRAA 3MGQA 3RELD 5AV9A 3LJAA 3X1UB 3AZHD 2XD5A 3B0CW 4H9RB 1P34C 1U35A 3B6GC 1EQZD 4R8PB 2Y2OA 3LZ1C 1JFIA 3C1CA 4QLCC 2G5HC 3AZID 1T3UA 3REKD 1F66D 4KHAB 3VH5T 2CV5B 4JJNA 1M19D 1KX5D 1B6WA 3W98A 3WA9B 3MGRC 2F8NH 4J8VC 3F6TA 5B31C 2CWEA 3W99C 1P3KB 5B32D 5JRGB 5B24A 5DNNA 5AV8B 5AY8A 3AYWD 5GSUA 4YS3C 5GXQD 5E5AA 3V9RA 3MVDC 4LD9A 3WTPA 3AFAA 1HQ3A 1M1AC 1R4VA 1KX4B 2IO5B 3B0DB 5B0ZD 3X1UA 4WU9C 5F99C 4KGCB 3AZKB 1P3PA 2UWXA 5FUGB 1B67A 3MNNB 1M19A 2RVQC 5B1MC 5BNXA 5BNVB 3EPJA 4J8UD 2HIOB 5AVCD 1P3KA 3AZFC 5JA4B 3MGPB 1TZYA 1KX3C 1ID3D 5B40C 3LZ0C 5AV8A 3A6NC 3REHC 5AVBD 5B2JA 1P34B 3WAAB 5GT3C 3REJC 2BYKB 3B6GB 1P3IA 3REID 5B0ZA 1AOID 2F8NK 1P3GD 2Y2JA 4QLCD 4Z66C 3X1SB 3X1TD 5B2IB 4J8VB 5B31B 3UT9B 3NQUA 4XUJC 3AZGC 3X1VA 4ZUXC 1KU5A 3AZKA 1BH8B 3W99D 5FUGA 5CP6D 2AROD 5AVCA 4G92B 4J8XD 4J8WB 1S32C 1ID3A 3AV2B 3AZLD 4KUDB 5B32G 3AZJC 4Z5TC 5DNMC 2BYMA 4XZQD 4WU8C 3LELB 4CSRB 4CAYA 3MGSB 4WU9D 2YFVB 2G5IC 1ULYA 3VH5W 3REIA 3LZ1A 2F8ND 4QLCA 5CPJC 3O62D 4R8PC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VH5 A;  2NQB C;  4H9Q A;  2PYO C;  3MGR A;  4G91 B;  5B1L B;  5B31 A;  3AZF B;  2CV5 C;  3W99 A;  5B1M D;  4WZS B;  3WA9 C;  1Q9C A;  1BFM A;  5CP6 A;  2ARO A;  1P3A D;  1F1E A;  5JRG C;  3LZ0 D;  4YS3 A;  1N1J B;  3REH D;  3MVD A;  3B6F C;  3LJA D;  1M1A A;  3REJ D;  3AZM B;  1KX4 C;  4Z66 B;  2IO5 C;  4WU9 A;  5F99 A;  5AV6 B;  5B0Y C;  3KXB B;  3AZG B;  4YM6 C;  4KGC C;  4ZUX D;  5G49 A;  3TU4 B;  4M6B A;  3KWQ D;  5B1M A;  2JSS A;  5DNN D;  2NZD B;  5GT0 B;  1S32 D;  5GSU D;  3B0B A;  3UTA B;  2HIO C;  5B40 A;  5B33 B;  1KX3 A;  5E5A D;  3MGP C;  4WU8 B;  3LZ0 A;  3AZJ D;  3W96 D;  3A6N A;  3REH A;  5DNM D;  3AFA D;  3W97 C;  5GT3 A;  3REJ A;  3X1U D;  4Z2M G;  3WAA C;  5CPJ B;  1M18 C;  4HGA B;  1P3O C;  1P3P D;  2NQB B;  4R8P D;  2PYO B;  5C3I C;  3X1S C;  4XUJ A;  1P3M B;  5B2I C;  4ZUX A;  4H9P B;  5BO0 B;  5CPI B;  2CV5 D;  3UT9 C;  5CPK C;  1P3K D;  3KWQ A;  1TZY D;  3REL B;  3UTB C;  3AZH B;  5BS7 C;  1S32 A;  5AV8 D;  3B6F B;  5CHL B;  4G92 C;  3W96 A;  5B2J D;  4J8W C;  4X23 B;  3AZJ A;  4Z5T A;  5DNM A;  3AV2 C;  1EQZ B;  4KUD C;  1P3B C;  5B0Y B;  1P3I D;  3AZI B;  1F66 B;  3REK B;  3LEL C;  3R45 B;  1KX5 B;  4H9R A;  4YM6 B;  3MGS C;  3AN2 C;  2YFW B;  4NFT A;  5BT1 C;  1H3O B;  3KUY B;  5KDM B;  4UUZ B;  5B32 B;  3X1V D;  4R8P A;  3AZK D;  1HTA A;  4KHA A;  3MNN D;  2CV5 A;  3WA9 A;  4G91 C;  5B1L C;  3KSY A;  5JRG A;  3MGP D;  3W97 B;  3AV1 B;  3B6F A;  3VH6 T;  1P34 D;  3C1B C;  1M18 B;  1P3O B;  1KX4 A;  3B6G D;  5B0Y A;  4EO5 C;  3LZ1 D;  5C3I B;  3AZM C;  5AV6 C;  2FJ7 B;  3X1S D;  4KGC A;  3KXB C;  3MGR D;  4J8V D;  5B31 D;  5CPK B;  1BH9 B;  3UTB B;  4H9S C;  3MNN A;  5AVB B;  1P3F B;  3TU4 C;  4H9N B;  1P3L C;  5BNV A;  4YS3 D;  2NZD C;  2HIO A;  5JA4 A;  5GT0 C;  3MGP A;  4J8W D;  3MVD D;  3AZN B;  3UTA C;  1P3B B;  5B33 C;  3AV2 D;  1M1A D;  3W97 A;  1P3G B;  1U35 C;  5AV5 C;  3AN2 B;  3C1C C;  1P34 A;  5F99 D;  3WAA A;  3MGS D;  2BYK A;  4JJN C;  3B6G A;  1P3O A;  4HGA C;  3X1S A;  2RVQ D;  4WNN B;  5B2I A;  5B24 C;  4J8X B;  3WKJ C;  5AY8 C;  4J8V A;  3UT9 A;  1P3M C;  4WV4 B;  5CPI C;  1BH8 A;  3AZF D;  1ZLA C;  3NQJ B;  4XZQ B;  1KX3 D;  5B40 D;  3WTP C;  1HQ3 C;  3REL C;  3A6N D;  4E45 A;  3AZH C;  4J8W A;  3C1B B;  3AV2 A;  5GT3 D;  4KUD A;  2F8N B;  4X23 C;  3AZE B;  4EO5 B;  3O62 B;  1EQZ C;  3AYW B;  3LEL A;  4CSR A;  3AZI C;  3MGS A;  4Z66 D;  3REK C;  1F66 C;  2YFV A;  4ZBJ C;  5AV6 D;  1KX5 C;  4XUJ D;  3AZG D;  1P3A B;  3KUY C;  5B32 C;  3WTP E;  4DRB A;  1P3L B;  3MGQ B;  5B1L A;  5AV9 B;  3LJA B;  2L5A A;  3AZF A;  5GXQ C;  4AWL C;  5GT0 D;  3VH6 W;  3UTA D;  4Z5T D;  5B33 D;  1U35 B;  5AV5 B;  4WU8 D;  1JFI B;  1N1J A;  3C1C B;  3AV1 C;  3VH6 A;  3C1B A;  4JJN B;  3W98 B;  3AZM A;  4Z66 A;  5CPJ D;  5AV6 A;  5B24 B;  5DNN B;  3WKJ B;  5AY8 B;  2HUE B;  2NQB D;  3KXB A;  2PYO D;  3AZG A;  2FJ7 C;  4J8U C;  1ZLA B;  2F8N G;  5E5A B;  3V9R B;  3WA9 D;  4H9S A;  4LD9 B;  3WTP B;  3AFA B;  1HQ3 B;  3TU4 A;  1P3F C;  5AVB C;  5JRG D;  1P3L A;  2NZD A;  5GT0 A;  3UTA A;  3B6F D;  5B33 A;  4Z2M H;  4WU8 A;  4X23 D;  3AZN C;  3REI C;  1P3P B;  1AOI C;  5AV5 A;  1P3G C;  1KX4 D;  4ZBJ B;  1M19 B;  5B0Y D;  3X1T C;  5BNX B;  4YM6 D;  4KGC D;  5CPJ A;  1TZY B;  3KUY D;  2NQB A;  2PYO A;  3WKJ A;  5CP6 C;  2ARO C;  5GXQ B;  4J8X C;  5B2J B;  4AWL B;  4H9P A;  1P3M A;  5BO0 A;  5CPI A;  1ZLA A;  3AZL C;  1TAF B;  2HIO D;  3REL A;  1P3I B;  4XZQ C;  5B0Z B;  3AZH A;  3W97 D;  4NE3 A;  3AV1 D;  4X23 A;  4H9O B;  3NQU B;  3WAA D;  1EQZ A;  3X1V B;  1M18 D;  3AZE C;  3O62 C;  3AZI A;  1P3O D;  3REK A;  3AYW C;  1F66 A;  3R45 A;  1KX5 A;  4YM6 A;  4J8U B;  2YFW A;  5AVC B;  5B2I D;  2FJ7 D;  1WWI A;  3UT9 D;  1H3O A;  3KUY A;  5KDM A;  5B32 A;  4UUZ A;  1ID3 B;  5CPK D;  1P3A C;  2BYM B;  3UTB D;  1P3F D;  4CAY B;  5GXQ A;  3MGQ C;  5AV9 C;  3LJA C;  1TAF A;  3REI B;  1AOI B;  4KUD D;  3LZ1 B;  3AZN D;  1P3B D;  4QLC B;  3AV1 A;  3X1T B;  3LEL D;  3B0C T;  4H9Q B;  3MGR B;  3AN2 D;  4H9O A;  5BT1 D;  1M18 A;  3W99 B;  3W98 C;  5CP6 B;  2ARO B;  1WWS A;  3KWQ C;  5DNN C;  4YS3 B;  2FJ7 A;  4J8U A;  2HUE C;  3AZL B;  5GSU C;  3MVD B;  5B1L D;  5CPK A;  1BH9 A;  1M1A B;  3W96 C;  5E5A C;  3UTB A;  4LD9 C;  4E44 A;  1P3F A;  5AVB A;  3AFA C;  2LY8 A;  5BS7 A;  4H9N A;  4WU9 B;  5F99 B;  3X1U C;  3AZN A;  3C1B D;  1P3B A;  1AOI A;  1P3G A;  5G49 B;  3AZE D;  1P3P C;  3X1T A;  3AZM D;  3AN2 A;  1M19 C;  5B1M B;  3KXB D;  4NE6 A;  1KX3 B;  1A7W A;  5B40 B;  1P3K C;  4NE5 A;  3LZ0 B;  1TZY C;  3A6N B;  3REH B;  3TU4 D;  4WNN A;  4J8X A;  5AV8 C;  1P3L D;  5B31 G;  3MGQ D;  5GT3 B;  3AZL A;  3REJ B;  5B2J C;  2NZD D;  5AV9 D;  3NQJ A;  4XZQ A;  1P3I C;  5B0Z C;  1U35 D;  5AV5 D;  3B0D C;  3C1C D;  4XUJ B;  4ZUX B;  2F8N A;  3AZE A;  4JJN D;  3O62 A;  3W98 D;  3X1V C;  3AYW A;  3AZK C;  3KWQ B;  3MNN C;  5B24 D;  1S32 B;  5GSU B;  3WKJ D;  5AY8 D;  5AVC C;  1P3M D;  3W96 B;  3AZJ B;  4Z5T B;  5CPI D;  1ZLA D;  1P3A A;  1ID3 C;  5DNM B;  4LD9 D;  3WTP D;  1HQ3 D;  4DRA A;  3MGQ A;  3REL D;  5AV9 A;  3LJA A;  3X1U B;  3AZH D;  3B0C W;  4H9R B;  1P34 C;  1U35 A;  3B6G C;  1EQZ D;  4R8P B;  3LZ1 C;  1JFI A;  3C1C A;  4QLC C;  3AZI D;  1F66 D;  3REK D;  4KHA B;  3VH5 T;  2CV5 B;  4JJN A;  1M19 D;  1KX5 D;  1B6W A;  3W98 A;  3WA9 B;  3MGR C;  2F8N H;  4J8V C;  5B31 C;  1P3K B;  2CWE A;  3W99 C;  5B32 D;  5JRG B;  5B24 A;  5DNN A;  5AV8 B;  5AY8 A;  3AYW D;  5GSU A;  4YS3 C;  5GXQ D;  5E5A A;  3V9R A;  3MVD C;  4LD9 A;  3WTP A;  3AFA A;  1HQ3 A;  1M1A C;  1R4V A;  1KX4 B;  2IO5 B;  3B0D B;  5B0Z D;  3X1U A;  4WU9 C;  5F99 C;  4KGC B;  3AZK B;  1P3P A;  5FUG B;  1B67 A;  3MNN B;  1M19 A;  2RVQ C;  5B1M C;  5BNX A;  5BNV B;  4J8U D;  2HIO B;  5AVC D;  1P3K A;  3AZF C;  5JA4 B;  3MGP B;  1TZY A;  1KX3 C;  1ID3 D;  5B40 C;  3LZ0 C;  5AV8 A;  3A6N C;  3REH C;  5AVB D;  5B2J A;  1P34 B;  3WAA B;  5GT3 C;  3REJ C;  2BYK B;  3B6G B;  1P3I A;  3REI D;  5B0Z A;  1AOI D;  2F8N K;  1P3G D;  4QLC D;  4Z66 C;  3X1S B;  3X1T D;  5B2I B;  4J8V B;  5B31 B;  3UT9 B;  3NQU A;  4XUJ C;  3AZG C;  3X1V A;  4ZUX C;  1KU5 A;  3AZK A;  1BH8 B;  3W99 D;  5FUG A;  5CP6 D;  2ARO D;  5AVC A;  4G92 B;  4J8X D;  4J8W B;  1S32 C;  1ID3 A;  3AV2 B;  3AZL D;  4KUD B;  5B32 G;  3AZJ C;  4Z5T C;  5DNM C;  2BYM A;  4XZQ D;  4WU8 C;  3LEL B;  4CSR B;  4CAY A;  3MGS B;  4WU9 D;  2YFV B;  1ULY A;  3VH5 W;  3REI A;  3LZ1 A;  2F8N D;  4QLC A;  5CPJ C;  3O62 D;  4R8P C; 
#chains in the Genus database with same CATH topology
 3VH5 A;  2NQB C;  4H9Q A;  2PYO C;  3MGR A;  4G91 B;  5B1L B;  5B31 A;  3AZF B;  2CV5 C;  3W99 A;  5B1M D;  4WZS B;  3WA9 C;  1Q9C A;  1BFM A;  5CP6 A;  2ARO A;  1P3A D;  1F1E A;  5JRG C;  3LZ0 D;  4YS3 A;  1N1J B;  3REH D;  3EPK A;  3MVD A;  3B6F C;  3LJA D;  1M1A A;  3REJ D;  3AZM B;  1KX4 C;  4Z66 B;  2IO5 C;  4WU9 A;  5F99 A;  5AV6 B;  5B0Y C;  3H0R C;  3KXB B;  3AZG B;  4YM6 C;  4KGC C;  4ZUX D;  5G49 A;  3TU4 B;  4M6B A;  2DQN C;  3KWQ D;  5B1M A;  2JSS A;  5DNN D;  2NZD B;  5GT0 B;  1S32 D;  5GSU D;  3B0B A;  3UTA B;  2HIO C;  5B40 A;  5B33 B;  1KX3 A;  2DF4 C;  5E5A D;  3MGP C;  4WU8 B;  3LZ0 A;  3AZJ D;  3W96 D;  3A6N A;  3REH A;  5DNM D;  3AFA D;  3W97 C;  2J8P A;  5GT3 A;  3REJ A;  3X1U D;  4Z2M G;  3WAA C;  5CPJ B;  1M18 C;  4HGA B;  1P3O C;  1P3P D;  2NQB B;  4R8P D;  2PYO B;  5C3I C;  3X1S C;  1W2E A;  4XUJ A;  1P3M B;  5B2I C;  4ZUX A;  4H9P B;  5BO0 B;  5CPI B;  3FDD A;  2CV5 D;  2Y2P A;  3UT9 C;  5CPK C;  3IP4 C;  1P3K D;  3KWQ A;  1TZY D;  3REL B;  3UTB C;  3AZH B;  5BS7 C;  1S32 A;  5AV8 D;  3B6F B;  5CHL B;  4G92 C;  3W96 A;  5B2J D;  2FFF B;  4X23 B;  4J8W C;  4Z5T A;  3AZJ A;  5DNM A;  3AV2 C;  1EQZ B;  4KUD C;  1P3B C;  5B0Y B;  1P3I D;  3AZI B;  1F66 B;  3REK B;  3LEL C;  3R45 B;  2ZY4 A;  1KX5 B;  4H9R A;  4YM6 B;  3MGS C;  3AN2 C;  2YFW B;  4NFT A;  5BT1 C;  4DQY B;  1H3O B;  3KUY B;  5KDM B;  4UUZ B;  5B32 B;  3X1V D;  4R8P A;  3AZK D;  1HTA A;  4KHA A;  3MNN D;  2CV5 A;  3WA9 A;  4G91 C;  5B1L C;  3A1I A;  3EG5 B;  3KSY A;  5JRG A;  3MGP D;  3W97 B;  3AV1 B;  3B6F A;  3VH6 T;  1P34 D;  3C1B C;  1M18 B;  2Y2K A;  1P3O B;  1KX4 A;  3AL0 C;  3B6G D;  5B0Y A;  4EO5 C;  3LZ1 D;  5C3I B;  3AZM C;  5AV6 C;  2FJ7 B;  3X1S D;  4KGC A;  3KXB C;  3MGR D;  4J8V D;  5B31 D;  5CPK B;  1BH9 B;  3UTB B;  4H9S C;  3MNN A;  5AVB B;  1P3F B;  3TU4 C;  4H9N B;  1P3L C;  5BNV A;  4YS3 D;  2NZD C;  2HIO A;  5JA4 A;  5GT0 C;  3MGP A;  4J8W D;  3MVD D;  3AZN B;  3UTA C;  1P3B B;  5B33 C;  3AV2 D;  1M1A D;  3W97 A;  1P3G B;  1U35 C;  5AV5 C;  3AN2 B;  3C1C C;  1P34 A;  5F99 D;  3WAA A;  3MGS D;  2BYK A;  4JJN C;  2ZY5 A;  3B6G A;  1P3O A;  4HGA C;  3X1S A;  2RVQ D;  4WNN B;  5B2I A;  5B24 C;  4J8X B;  3WKJ C;  5AY8 C;  4J8V A;  3H0M C;  3UT9 A;  2W8S A;  1P3M C;  4WV4 B;  5CPI C;  1BH8 A;  3AZF D;  1ZLA C;  3NQJ B;  4XZQ B;  1KX3 D;  5B40 D;  3WTP C;  1HQ3 C;  3REL C;  3A6N D;  4E45 A;  3AZH C;  4J8W A;  3C1B B;  3AV2 A;  5GT3 D;  4KUD A;  2F8N B;  4X23 C;  3AZE B;  4EO5 B;  3O62 B;  1EQZ C;  1Z2C B;  3A1K A;  3LEL A;  4CSR A;  3AYW B;  3AZI C;  3MGS A;  4Z66 D;  3REK C;  1F66 C;  2YFV A;  4ZBJ C;  5AV6 D;  1KX5 C;  4XUJ D;  3AZG D;  2Y2I A;  1P3A B;  3KUY C;  5B32 C;  4UPK A;  3WTP E;  4DRB A;  1P3L B;  3EPH A;  3MGQ B;  5B1L A;  5AV9 B;  3LJA B;  2L5A A;  3AZF A;  5GXQ C;  4AWL C;  2JE5 A;  3VH6 W;  5GT0 D;  2F2A C;  3UTA D;  4Z5T D;  5B33 D;  1U35 B;  5AV5 B;  4WU8 D;  1JFI B;  1N1J A;  3C1C B;  3AV1 C;  3VH6 A;  3C1B A;  4JJN B;  3W98 B;  3AZM A;  4Z66 A;  5CPJ D;  5AV6 A;  5B24 B;  5DNN B;  3WKJ B;  5AY8 B;  2HUE B;  2NQB D;  3KXB A;  2PYO D;  3AZG A;  2FJ7 C;  4J8U C;  1ZLA B;  2F8N G;  5E5A B;  3V9R B;  3EPL A;  4H9S A;  3WA9 D;  4LD9 B;  3WTP B;  3AFA B;  1HQ3 B;  3TU4 A;  1P3F C;  5AVB C;  5JRG D;  1P3L A;  2NZD A;  5GT0 A;  3UTA A;  3B6F D;  5B33 A;  4Z2M H;  3KFU G;  2ZY3 A;  4WU8 A;  4X23 D;  3AZN C;  3REI C;  1P3P B;  1AOI C;  5AV5 A;  1P3G C;  1KX4 D;  4ZBJ B;  1M19 B;  5B0Y D;  3X1T C;  2Y2G A;  5BNX B;  4YM6 D;  4KGC D;  5CPJ A;  1TZY B;  2Y2N A;  3KUY D;  2RIQ A;  2NQB A;  2PYO A;  3WKJ A;  5CP6 C;  2ARO C;  5GXQ B;  4J8X C;  5B2J B;  4AWL B;  4H9P A;  1P3M A;  5BO0 A;  5CPI A;  1ZLA A;  3AZL C;  1TAF B;  2HIO D;  3REL A;  1P3I B;  4XZQ C;  5B0Z B;  3AZH A;  3W97 D;  4NE3 A;  3AV1 D;  4X23 A;  4H9O B;  3NQU B;  3WAA D;  1EQZ A;  3X1V B;  1M18 D;  3AZE C;  3O62 C;  3AZI A;  3H0L C;  3REK A;  3AYW C;  1P3O D;  1F66 A;  3R45 A;  1KX5 A;  2Y2M A;  4YM6 A;  4J8U B;  2YFW A;  5AVC B;  5B2I D;  2FJ7 D;  1WWI A;  3UT9 D;  1H3O A;  3P5J B;  5KDM A;  5B32 A;  4UUZ A;  3KUY A;  1ID3 B;  5CPK D;  1P3A C;  2BYM B;  3UTB D;  1P3F D;  4CAY B;  5GXQ A;  3MGQ C;  5AV9 C;  3LJA C;  1TAF A;  3REI B;  1AOI B;  4KUD D;  3LZ1 B;  3AZN D;  1P3B D;  4QLC B;  3AV1 A;  3X1T B;  3LEL D;  3B0C T;  4H9Q B;  3MGR B;  3AN2 D;  4H9O A;  5BT1 D;  1M18 A;  3W99 B;  3W98 C;  4WJ3 C;  5CP6 B;  2ARO B;  1WWS A;  3KWQ C;  5DNN C;  4YS3 B;  2FJ7 A;  4J8U A;  2HUE C;  3AZL B;  5GSU C;  3MVD B;  5B1L D;  5CPK A;  1BH9 A;  1M1A B;  3W96 C;  5E5A C;  3UTB A;  4LD9 C;  4E44 A;  1P3F A;  5AVB A;  3AFA C;  2LY8 A;  5BS7 A;  4H9N A;  4WU9 B;  5F99 B;  2Y2L A;  3X1U C;  2Y2H A;  3AZN A;  3C1B D;  1P3B A;  1AOI A;  1P3G A;  5G49 B;  3AZE D;  1P3P C;  3X1T A;  3AZM D;  3AN2 A;  2VQR A;  2ZM5 A;  1M19 C;  5B1M B;  2Y2Q A;  3KXB D;  4NE6 A;  1KX3 B;  1A7W A;  5B40 B;  1P3K C;  4NE5 A;  3LZ0 B;  1TZY C;  3A6N B;  3REH B;  1PZR A;  4WNN A;  4J8X A;  3TU4 D;  5AV8 C;  1P3L D;  5B31 G;  3MGQ D;  5GT3 B;  3AZL A;  2XD1 A;  5B2J C;  3REJ B;  2NZD D;  5AV9 D;  3NQJ A;  4XZQ A;  1P3I C;  5B0Z C;  1U35 D;  5AV5 D;  3B0D C;  3C1C D;  4XUJ B;  4ZUX B;  2F8N A;  3AZE A;  4JJN D;  3O62 A;  2BG1 A;  3W98 D;  3X1V C;  3AYW A;  2ZY2 A;  3AZK C;  3KWQ B;  3MNN C;  5B24 D;  1S32 B;  5GSU B;  3WKJ D;  5AY8 D;  5AVC C;  1P3M D;  3W96 B;  3AZJ B;  4Z5T B;  5CPI D;  1ZLA D;  1P3A A;  1ID3 C;  5DNM B;  2JCH A;  4LD9 D;  3WTP D;  1HQ3 D;  4DRA A;  3MGQ A;  3REL D;  5AV9 A;  3LJA A;  3X1U B;  3AZH D;  2XD5 A;  3B0C W;  4H9R B;  1P34 C;  1U35 A;  3B6G C;  1EQZ D;  4R8P B;  2Y2O A;  3LZ1 C;  1JFI A;  3C1C A;  4QLC C;  2G5H C;  3AZI D;  1T3U A;  3REK D;  1F66 D;  4KHA B;  3VH5 T;  2CV5 B;  4JJN A;  1M19 D;  1KX5 D;  1B6W A;  3W98 A;  3WA9 B;  3MGR C;  2F8N H;  4J8V C;  3F6T A;  5B31 C;  2CWE A;  3W99 C;  1P3K B;  5B32 D;  5JRG B;  5B24 A;  5DNN A;  5AV8 B;  5AY8 A;  3AYW D;  5GSU A;  4YS3 C;  5GXQ D;  5E5A A;  3V9R A;  3MVD C;  4LD9 A;  3WTP A;  3AFA A;  1HQ3 A;  1M1A C;  1R4V A;  1KX4 B;  2IO5 B;  3B0D B;  5B0Z D;  3X1U A;  4WU9 C;  5F99 C;  4KGC B;  3AZK B;  1P3P A;  2UWX A;  5FUG B;  1B67 A;  3MNN B;  1M19 A;  2RVQ C;  5B1M C;  5BNX A;  5BNV B;  3EPJ A;  4J8U D;  2HIO B;  5AVC D;  1P3K A;  3AZF C;  5JA4 B;  3MGP B;  1TZY A;  1KX3 C;  1ID3 D;  5B40 C;  3LZ0 C;  5AV8 A;  3A6N C;  3REH C;  5AVB D;  5B2J A;  1P34 B;  3WAA B;  5GT3 C;  3REJ C;  2BYK B;  3B6G B;  1P3I A;  3REI D;  5B0Z A;  1AOI D;  2F8N K;  1P3G D;  2Y2J A;  4QLC D;  4Z66 C;  3X1S B;  3X1T D;  5B2I B;  4J8V B;  5B31 B;  3UT9 B;  3NQU A;  4XUJ C;  3AZG C;  3X1V A;  4ZUX C;  1KU5 A;  3AZK A;  1BH8 B;  3W99 D;  5FUG A;  5CP6 D;  2ARO D;  5AVC A;  4G92 B;  4J8X D;  4J8W B;  1S32 C;  1ID3 A;  3AV2 B;  3AZL D;  4KUD B;  5B32 G;  3AZJ C;  4Z5T C;  5DNM C;  2BYM A;  4XZQ D;  4WU8 C;  3LEL B;  4CSR B;  4CAY A;  3MGS B;  4WU9 D;  2YFV B;  2G5I C;  1ULY A;  3VH5 W;  3REI A;  3LZ1 A;  2F8N D;  4QLC A;  5CPJ C;  3O62 D;  4R8P C; 
#chains in the Genus database with same CATH homology
 3VH5 A;  2NQB C;  4H9Q A;  2PYO C;  3MGR A;  4G91 B;  5B1L B;  5B31 A;  3AZF B;  2CV5 C;  3W99 A;  5B1M D;  4WZS B;  3WA9 C;  1Q9C A;  1BFM A;  5CP6 A;  2ARO A;  1P3A D;  1F1E A;  5JRG C;  3LZ0 D;  4YS3 A;  1N1J B;  3REH D;  3EPK A;  3MVD A;  3B6F C;  3LJA D;  1M1A A;  3REJ D;  3AZM B;  1KX4 C;  4Z66 B;  2IO5 C;  4WU9 A;  5F99 A;  5AV6 B;  5B0Y C;  3H0R C;  3KXB B;  3AZG B;  4YM6 C;  4KGC C;  4ZUX D;  5G49 A;  3TU4 B;  4M6B A;  2DQN C;  3KWQ D;  5B1M A;  2JSS A;  5DNN D;  2NZD B;  5GT0 B;  1S32 D;  5GSU D;  3B0B A;  3UTA B;  2HIO C;  5B40 A;  5B33 B;  1KX3 A;  2DF4 C;  5E5A D;  3MGP C;  4WU8 B;  3LZ0 A;  3AZJ D;  3W96 D;  3A6N A;  3REH A;  5DNM D;  3AFA D;  3W97 C;  2J8P A;  5GT3 A;  3REJ A;  3X1U D;  4Z2M G;  3WAA C;  5CPJ B;  1M18 C;  4HGA B;  1P3O C;  1P3P D;  2NQB B;  4R8P D;  2PYO B;  5C3I C;  3X1S C;  1W2E A;  4XUJ A;  1P3M B;  5B2I C;  4ZUX A;  4H9P B;  5BO0 B;  5CPI B;  3FDD A;  2CV5 D;  2Y2P A;  3UT9 C;  5CPK C;  3IP4 C;  1P3K D;  3KWQ A;  1TZY D;  3REL B;  3UTB C;  3AZH B;  5BS7 C;  1S32 A;  5AV8 D;  3B6F B;  5CHL B;  4G92 C;  3W96 A;  5B2J D;  2FFF B;  4X23 B;  4J8W C;  4Z5T A;  3AZJ A;  5DNM A;  3AV2 C;  1EQZ B;  4KUD C;  1P3B C;  5B0Y B;  1P3I D;  3AZI B;  1F66 B;  3REK B;  3LEL C;  3R45 B;  2ZY4 A;  1KX5 B;  4H9R A;  4YM6 B;  3MGS C;  3AN2 C;  2YFW B;  4NFT A;  5BT1 C;  4DQY B;  1H3O B;  3KUY B;  5KDM B;  4UUZ B;  5B32 B;  3X1V D;  4R8P A;  3AZK D;  1HTA A;  4KHA A;  3MNN D;  2CV5 A;  3WA9 A;  4G91 C;  5B1L C;  3A1I A;  3EG5 B;  3KSY A;  5JRG A;  3MGP D;  3W97 B;  3AV1 B;  3B6F A;  3VH6 T;  1P34 D;  3C1B C;  1M18 B;  2Y2K A;  1P3O B;  1KX4 A;  3AL0 C;  3B6G D;  5B0Y A;  4EO5 C;  3LZ1 D;  5C3I B;  3AZM C;  5AV6 C;  2FJ7 B;  3X1S D;  4KGC A;  3KXB C;  3MGR D;  4J8V D;  5B31 D;  5CPK B;  1BH9 B;  3UTB B;  4H9S C;  3MNN A;  5AVB B;  1P3F B;  3TU4 C;  4H9N B;  1P3L C;  5BNV A;  4YS3 D;  2NZD C;  2HIO A;  5JA4 A;  5GT0 C;  3MGP A;  4J8W D;  3MVD D;  3AZN B;  3UTA C;  1P3B B;  5B33 C;  3AV2 D;  1M1A D;  3W97 A;  1P3G B;  1U35 C;  5AV5 C;  3AN2 B;  3C1C C;  1P34 A;  5F99 D;  3WAA A;  3MGS D;  2BYK A;  4JJN C;  2ZY5 A;  3B6G A;  1P3O A;  4HGA C;  3X1S A;  2RVQ D;  4WNN B;  5B2I A;  5B24 C;  4J8X B;  3WKJ C;  5AY8 C;  4J8V A;  3H0M C;  3UT9 A;  2W8S A;  1P3M C;  4WV4 B;  5CPI C;  1BH8 A;  3AZF D;  1ZLA C;  3NQJ B;  4XZQ B;  1KX3 D;  5B40 D;  3WTP C;  1HQ3 C;  3REL C;  3A6N D;  4E45 A;  3AZH C;  4J8W A;  3C1B B;  3AV2 A;  5GT3 D;  4KUD A;  2F8N B;  4X23 C;  3AZE B;  4EO5 B;  3O62 B;  1EQZ C;  1Z2C B;  3A1K A;  3LEL A;  4CSR A;  3AYW B;  3AZI C;  3MGS A;  4Z66 D;  3REK C;  1F66 C;  2YFV A;  4ZBJ C;  5AV6 D;  1KX5 C;  4XUJ D;  3AZG D;  2Y2I A;  1P3A B;  3KUY C;  5B32 C;  4UPK A;  3WTP E;  4DRB A;  1P3L B;  3EPH A;  3MGQ B;  5B1L A;  5AV9 B;  3LJA B;  2L5A A;  3AZF A;  5GXQ C;  4AWL C;  2JE5 A;  3VH6 W;  5GT0 D;  2F2A C;  3UTA D;  4Z5T D;  5B33 D;  1U35 B;  5AV5 B;  4WU8 D;  1JFI B;  1N1J A;  3C1C B;  3AV1 C;  3VH6 A;  3C1B A;  4JJN B;  3W98 B;  3AZM A;  4Z66 A;  5CPJ D;  5AV6 A;  5B24 B;  5DNN B;  3WKJ B;  5AY8 B;  2HUE B;  2NQB D;  3KXB A;  2PYO D;  3AZG A;  2FJ7 C;  4J8U C;  1ZLA B;  2F8N G;  5E5A B;  3V9R B;  3EPL A;  4H9S A;  3WA9 D;  4LD9 B;  3WTP B;  3AFA B;  1HQ3 B;  3TU4 A;  1P3F C;  5AVB C;  5JRG D;  1P3L A;  2NZD A;  5GT0 A;  3UTA A;  3B6F D;  5B33 A;  4Z2M H;  3KFU G;  2ZY3 A;  4WU8 A;  4X23 D;  3AZN C;  3REI C;  1P3P B;  1AOI C;  5AV5 A;  1P3G C;  1KX4 D;  4ZBJ B;  1M19 B;  5B0Y D;  3X1T C;  2Y2G A;  5BNX B;  4YM6 D;  4KGC D;  5CPJ A;  1TZY B;  2Y2N A;  3KUY D;  2RIQ A;  2NQB A;  2PYO A;  3WKJ A;  5CP6 C;  2ARO C;  5GXQ B;  4J8X C;  5B2J B;  4AWL B;  4H9P A;  1P3M A;  5BO0 A;  5CPI A;  1ZLA A;  3AZL C;  1TAF B;  2HIO D;  3REL A;  1P3I B;  4XZQ C;  5B0Z B;  3AZH A;  3W97 D;  4NE3 A;  3AV1 D;  4X23 A;  4H9O B;  3NQU B;  3WAA D;  1EQZ A;  3X1V B;  1M18 D;  3AZE C;  3O62 C;  3AZI A;  3H0L C;  3REK A;  3AYW C;  1P3O D;  1F66 A;  3R45 A;  1KX5 A;  2Y2M A;  4YM6 A;  4J8U B;  2YFW A;  5AVC B;  5B2I D;  2FJ7 D;  1WWI A;  3UT9 D;  1H3O A;  3P5J B;  5KDM A;  5B32 A;  4UUZ A;  3KUY A;  1ID3 B;  5CPK D;  1P3A C;  2BYM B;  3UTB D;  1P3F D;  4CAY B;  5GXQ A;  3MGQ C;  5AV9 C;  3LJA C;  1TAF A;  3REI B;  1AOI B;  4KUD D;  3LZ1 B;  3AZN D;  1P3B D;  4QLC B;  3AV1 A;  3X1T B;  3LEL D;  3B0C T;  4H9Q B;  3MGR B;  3AN2 D;  4H9O A;  5BT1 D;  1M18 A;  3W99 B;  3W98 C;  4WJ3 C;  5CP6 B;  2ARO B;  1WWS A;  3KWQ C;  5DNN C;  4YS3 B;  2FJ7 A;  4J8U A;  2HUE C;  3AZL B;  5GSU C;  3MVD B;  5B1L D;  5CPK A;  1BH9 A;  1M1A B;  3W96 C;  5E5A C;  3UTB A;  4LD9 C;  4E44 A;  1P3F A;  5AVB A;  3AFA C;  2LY8 A;  5BS7 A;  4H9N A;  4WU9 B;  5F99 B;  2Y2L A;  3X1U C;  2Y2H A;  3AZN A;  3C1B D;  1P3B A;  1AOI A;  1P3G A;  5G49 B;  3AZE D;  1P3P C;  3X1T A;  3AZM D;  3AN2 A;  2VQR A;  2ZM5 A;  1M19 C;  5B1M B;  2Y2Q A;  3KXB D;  4NE6 A;  1KX3 B;  1A7W A;  5B40 B;  1P3K C;  4NE5 A;  3LZ0 B;  1TZY C;  3A6N B;  3REH B;  1PZR A;  4WNN A;  4J8X A;  3TU4 D;  5AV8 C;  1P3L D;  5B31 G;  3MGQ D;  5GT3 B;  3AZL A;  2XD1 A;  5B2J C;  3REJ B;  2NZD D;  5AV9 D;  3NQJ A;  4XZQ A;  1P3I C;  5B0Z C;  1U35 D;  5AV5 D;  3B0D C;  3C1C D;  4XUJ B;  4ZUX B;  2F8N A;  3AZE A;  4JJN D;  3O62 A;  2BG1 A;  3W98 D;  3X1V C;  3AYW A;  2ZY2 A;  3AZK C;  3KWQ B;  3MNN C;  5B24 D;  1S32 B;  5GSU B;  3WKJ D;  5AY8 D;  5AVC C;  1P3M D;  3W96 B;  3AZJ B;  4Z5T B;  5CPI D;  1ZLA D;  1P3A A;  1ID3 C;  5DNM B;  2JCH A;  4LD9 D;  3WTP D;  1HQ3 D;  4DRA A;  3MGQ A;  3REL D;  5AV9 A;  3LJA A;  3X1U B;  3AZH D;  2XD5 A;  3B0C W;  4H9R B;  1P34 C;  1U35 A;  3B6G C;  1EQZ D;  4R8P B;  2Y2O A;  3LZ1 C;  1JFI A;  3C1C A;  4QLC C;  2G5H C;  3AZI D;  1T3U A;  3REK D;  1F66 D;  4KHA B;  3VH5 T;  2CV5 B;  4JJN A;  1M19 D;  1KX5 D;  1B6W A;  3W98 A;  3WA9 B;  3MGR C;  2F8N H;  4J8V C;  3F6T A;  5B31 C;  2CWE A;  3W99 C;  1P3K B;  5B32 D;  5JRG B;  5B24 A;  5DNN A;  5AV8 B;  5AY8 A;  3AYW D;  5GSU A;  4YS3 C;  5GXQ D;  5E5A A;  3V9R A;  3MVD C;  4LD9 A;  3WTP A;  3AFA A;  1HQ3 A;  1M1A C;  1R4V A;  1KX4 B;  2IO5 B;  3B0D B;  5B0Z D;  3X1U A;  4WU9 C;  5F99 C;  4KGC B;  3AZK B;  1P3P A;  2UWX A;  5FUG B;  1B67 A;  3MNN B;  1M19 A;  2RVQ C;  5B1M C;  5BNX A;  5BNV B;  3EPJ A;  4J8U D;  2HIO B;  5AVC D;  1P3K A;  3AZF C;  5JA4 B;  3MGP B;  1TZY A;  1KX3 C;  1ID3 D;  5B40 C;  3LZ0 C;  5AV8 A;  3A6N C;  3REH C;  5AVB D;  5B2J A;  1P34 B;  3WAA B;  5GT3 C;  3REJ C;  2BYK B;  3B6G B;  1P3I A;  3REI D;  5B0Z A;  1AOI D;  2F8N K;  1P3G D;  2Y2J A;  4QLC D;  4Z66 C;  3X1S B;  3X1T D;  5B2I B;  4J8V B;  5B31 B;  3UT9 B;  3NQU A;  4XUJ C;  3AZG C;  3X1V A;  4ZUX C;  1KU5 A;  3AZK A;  1BH8 B;  3W99 D;  5FUG A;  5CP6 D;  2ARO D;  5AVC A;  4G92 B;  4J8X D;  4J8W B;  1S32 C;  1ID3 A;  3AV2 B;  3AZL D;  4KUD B;  5B32 G;  3AZJ C;  4Z5T C;  5DNM C;  2BYM A;  4XZQ D;  4WU8 C;  3LEL B;  4CSR B;  4CAY A;  3MGS B;  4WU9 D;  2YFV B;  2G5I C;  1ULY A;  3VH5 W;  3REI A;  3LZ1 A;  2F8N D;  4QLC A;  5CPJ C;  3O62 D;  4R8P C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...