3AZFC

Crystal structure of human nucleosome core particle containing h3k79q mutation
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
108
structure length
108
Chain Sequence
RAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
molecule keywords Histone H3.1
total genus 32
structure length 108
sequence length 108
chains with identical sequence G
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3azfC00
5AV8C 3LJAC 4KGCC 1HQ3C 5B2JC 1P3MB 3B0BA 1ID3C 5B33B 3MVDA 3C1CD 5DNND 5AV5A 5B0YA 4WU8A 3MNNA 3MGPD 5B1MA 4KGCB 3UT9A 4WZSB 3MGRC 5DNMB 1M1AD 3B6FD 3B6FC 3WAAD 4KGCA 4AWLB 3AZID 5B24B 1AOIA 3RELD 3REIB 3RELC 3W99C 1F66A 3REJC 1P3OB 3B0CW 2L5AA 5B32G 1KX3D 2RVQC 3W96A 4E45A 3MNND 3LELB 3W96C 5B0ZC 1BFMA 4UUZB 1M1AA 4X23C 3W98A 3O62B 3WA9C 3KUYC 5GSUA 3W98B 2NZDC 5AV8D 5CPJB 1AOIC 1KX5C 2FJ7C 5GT0D 3LZ1B 2AROD 1P3GC 5CPKD 4CAYB 3X1UD 3UTBC 2FJ7B 3AZKC 3AZGB 5CPKB 3AN2C 1ZLAA 1S32D 5AY8C 5AVBD 5F99D 4KUDC 5B1MD 5AV8A 5B32D 1P3LB 5AV9A 4YS3B 3A6ND 1P3AB 4H9PA 4H9SC 5AV9B 5B2ID 4YS3A 3AZMD 2NQBC 1KX3C 3AZKA 3KXBD 3MGQA 3LZ0A 4WU9A 3O62D 3MNNC 3KWQB 3AV2A 1U35B 5B2JB 1P3LC 1P3IB 1P3GD 5GSUB 5B33C 5B24A 1P3AD 2YFVB 3X1VA 4J8VB 5B32B 3WAAA 3AZIC 1KX5A 5CPIA 1AOID 2JSSA 3UTAB 3AZGD 5CPIB 3B0DB 3X1UB 1P3BA 2FJ7D 5E5AD 1JFIA 4XZQB 3NQUA 4XUJA 4Z2MG 1P3OC 2CWEA 5GT0A 2AROB 4XUJB 4DRAA 5GXQD 5GXQA 5CPIC 3MGPB 3C1BD 5G49A 5AV6D 4G92C 5B33A 4Z2MH 5B33D 3C1CB 5KDMA 3W98D 4LD9A 2BYMA 5FUGA 2LY8A 4H9PB 3AFAC 5B24C 3AFAD 3AZNA 4WU8C 3AZJA 3WKJA 1KX3A 3LJAD 3AYWB 3MGQC 5GT3C 5B2JA 2NQBA 1AOIB 4NE5A 5E5AC 3W97D 3TU4D 3MGSA 4CAYA 3REIA 4R8PC 3REIC 5CPKA 1ZLAB 1P3OD 3B6GC 3AYWC 3VH5T 1P3ID 4QLCD 4QLCA 5JRGC 3UTBA 3X1UA 1P3BB 5AY8D 5AVBC 3KXBB 3AZGC 3NQUB 5CP6D 4UUZA 5DNMD 1M1AB 4LD9C 5AV9D 1P3PA 3A6NC 3WTPC 3LELA 4ZUXD 4KHAB 2AROA 4YM6D 1Q9CA 5DNNB 5B31A 3KXBC 5JA4A 3O62A 3AV2D 5B1LB 2F8NB 3AZKD 4LD9B 1BH9B 3VH6T 5F99C 5CP6B 4EO5B 4X23D 3WA9A 1WWSA 5AY8B 3KUYD 1WWIA 1JFIB 2BYKA 3LZ1D 4HGAC 5BNXB 1KX5D 2HIOD 3X1SC 3X1TB 5CP6C 5AV8B 5CPJD 2CV5C 1HTAA 1F66C 3MGPA 5BO0A 2YFWB 3AZHD 5BO0B 3LZ0C 3AYWD 3B6GD 5B31C 5KDMB 3WAAC 3W96D 3AZED 2IO5B 5AV6C 5B40A 4J8WA 3MGRA 3AV2B 1P3PC 3WKJC 5B1MC 1EQZD 5DNMC 3MGRB 3LZ0B 4WU9D 2YFVA 2NZDD 4WU9C 5B31B 4J8UC 3AV1C 4YM6C 3REKB 3X1SA 5GXQC 3UTAA 3UT9D 4QLCB 5E5AB 4XUJC 3MGPC 3R45B 5CHLB 4XZQC 1ZLAD 1ZLAC 4Z66B 3R45A 3REKC 1R4VA 4J8VD 4JJNA 4CSRB 4KHAA 2NZDA 4DRBA 3WKJD 4JJNB 3AZNC 3KUYA 3LJAB 3W97C 3KWQD 3LELC 3V9RA 3AFAB 1B6WA 2RVQD 3AZJB 3C1CA 4NE3A 3REHB 4NFTA 2F8NK 3O62C 5B31D 4JJNC 3AZNB 1KX4A 3MGQB 1P3LD 4Z5TC 4XUJD 3AZLA 1M18A 5B0ZB 3AYWA 1EQZC 4ZBJC 3AZFB 1H3OB 1P3PD 5F99B 1M19C 2PYOB 5B40D 4J8WD 4J8UD 3AV1D 3B6GB 3REJB 4H9OA 3AZHB 1N1JA 3X1VC 4HGAB 4J8XC 3REJA 4ZBJB 3AZFC 3AZFD 2CV5D 3UTBB 5CPKC 3KSYA 4H9RA 1P3GA 5C3IB 3WTPB 1P3FA 1P3GB 3B6FA 1P3FB 3AZEC 1P34D 3KUYB 3C1BA 3NQJA 5G49B 4KUDD 5B2IA 1KU5A 3AN2B 5B32C 5GT0C 5B2IB 4LD9D 1TZYD 3AFAA 1TZYC 1ID3A 5AY8A 3REHA 5AVCC 1HQ3A 3AZMC 5CP6A 3AZLB 1M18B 4ZUXB 1P3KC 2NQBB 5B0YB 5AV5B 1H3OA 3REID 2BYKB 3UT9B 4CSRA 2YFWA 1P3BD 2FJ7A 3REKD 3W99A 1P3LA 4WNNB 1P3MC 3W99B 1ULYA 1HQ3D 3VH6A 3UT9C 2AROC 3KWQA 3WTPA 3W96B 3AZFA 4J8VA 4JJND 3AN2A 3VH5W 5B1LA 4J8VC 2F8NA 3B6GA 4Z5TB 5B32A 1HQ3B 3X1TD 4AWLC 1M19A 1KX5B 1M19B 5E5AA 3RELB 5GT3A 3LZ1A 1KX4D 2HIOA 1P3KD 1ID3D 3AZJC 4X23B 3B6FB 5DNNC 4J8XB 2CV5A 5AV5D 3VH6W 5B0YD 3W98C 5B1LD 2F8ND 2NZDB 3AZLD 1M18D 5AV6A 3MGRD 1M1AC 1P3MD 1P3MA 1P34A 2PYOC 3WTPE 5FUGB 3B0CT 3AZMA 1EQZA 5CPJC 4H9NB 5BNVA 1F66D 3VH5A 5B0ZA 1U35A 3AZEA 1N1JB 4J8UA 3AV1A 1P3FC 2F8NH 3TU4B 5AVBB 1S32B 4G91B 3RELA 3REJD 5AVBA 3MVDD 5B2IC 2HIOC 2F8NG 2PYOD 4H9RB 2NQBD 4H9SA 4YS3C 5AVCB 4XZQA 3TU4C 5JA4B 2HUEB 5B0ZD 4YM6B 4R8PA 4R8PD 2IO5C 5GT0B 5AV6B 3NQJB 5AV5C 5B0YC 4KUDA 5GXQB 1TZYB 5BS7C 2BYMB 5B31G 5JRGD 5JRGA 4Z5TA 4QLCC 3AN2D 1ID3B 4WU8B 1KX4B 1P3FD 4Z66C 5DNMA 3X1TA 1M19D 3WTPD 3WKJB 3UTAD 4ZUXA 3MNNB 1B67A 3KWQC 3LELD 4J8WC 5B40C 3W97A 3B0DC 5GT3D 2CV5B 1KX4C 3W97B 1P3OA 4H9OB 3AZHA 4M6BA 3C1CC 5GSUD 5B40B 4J8WB 4WU8D 1P3BC 5B24D 1P3AA 1P3PB 4KGCD 3A6NB 5BNVB 3MGQD 4WU9B 3C1BB 4YS3D 3AZND 4YM6A 3W99D 4R8PB 3REKA 3REHD 3REHC 5CPJA 3AZJD 4H9QA 1TZYA 5DNNA 5AVCD 4G92B 3AZHC 4XZQD 3MVDB 3TU4A 3AZIA 1F1EA 3C1BC 1BH9A 5CPID 3WA9B 1A7WA 5GT3B 4Z66D 4Z66A 3AZGA 3MVDC 5BNXA 1BH8B 1TAFB 4G91C 3LZ1C 4J8XA 4WNNA 5B2JD 1U35D 3V9RB 3X1SD 3LJAA 1F66B 4KUDB 3X1VD 1P34B 5JRGB 3AZMB 3MGSD 3MGSC 1P3AC 3AZKB 3AZLC 3LZ0D 1M18C 5B1LC 5F99A 3UTBD 1KX3B 1EQZB 5B1MB 1P3IA 4EO5C 1P34C 1S32C 2PYOA 4H9NA 3AZEB 4H9QB 3MGSB 5BT1D 4J8XD 5BT1C 4J8UB 3AV1B 4ZUXC 1P3KB 3X1VB 3AZIB 3X1SB 1P3KA 3WAAB 1U35C 4NE6A 1P3IC 3AV2C 1S32A 5C3IC 5GSUC 3X1UC 3KXBA 2HIOB 5AVCA 4Z5TD 4X23A 5BS7A 2HUEC 1BH8A 1TAFA 3A6NA 3WA9D 4E44A 5AV9C 3X1TC 3UTAC 4WV4B
chains in the Genus database with same CATH superfamily
5AV8C 3LJAC 4KGCC 1HQ3C 5B2JC 1P3MB 3B0BA 1ID3C 5B33B 3MVDA 3C1CD 5DNND 5AV5A 5B0YA 4WU8A 3MNNA 3MGPD 5B1MA 4KGCB 3UT9A 4WZSB 3MGRC 5DNMB 1M1AD 3B6FD 3B6FC 3WAAD 4KGCA 4AWLB 3AZID 1PZRA 5B24B 1AOIA 3RELD 3REIB 3RELC 3W99C 1F66A 3REJC 1P3OB 3B0CW 2L5AA 3KFUG 2UWXA 5B32G 1KX3D 2RVQC 3W96A 4E45A 3MNND 3LELB 3W96C 5B0ZC 1BFMA 4UUZB 1M1AA 4X23C 3W98A 3O62B 3EPLA 3WA9C 3KUYC 5GSUA 3W98B 2NZDC 5AV8D 5CPJB 1AOIC 1KX5C 2FJ7C 5GT0D 3LZ1B 2AROD 1P3GC 5CPKD 4CAYB 3X1UD 3UTBC 2FJ7B 3AZKC 3AZGB 5CPKB 3AN2C 1ZLAA 1S32D 5AY8C 5AVBD 5F99D 4KUDC 5B1MD 5AV8A 5B32D 1P3LB 2ZY2A 5AV9A 4YS3B 3A6ND 1P3AB 4H9PA 4H9SC 5AV9B 5B2ID 4YS3A 3AZMD 2NQBC 2JCHA 1KX3C 3AZKA 3KXBD 3MGQA 3LZ0A 4WU9A 3O62D 3MNNC 3KWQB 3AV2A 3AL0C 1U35B 5B2JB 1P3LC 1P3IB 1P3GD 5GSUB 5B33C 5B24A 1P3AD 2Y2OA 2YFVB 3X1VA 4J8VB 5B32B 3WAAA 3AZIC 2Y2IA 1KX5A 5CPIA 1AOID 2JSSA 3UTAB 3AZGD 5CPIB 3B0DB 3X1UB 1P3BA 2FJ7D 5E5AD 1JFIA 4XZQB 3NQUA 2ZY3A 4XUJA 4Z2MG 1P3OC 2CWEA 5GT0A 2AROB 4XUJB 4DRAA 5GXQD 5GXQA 5CPIC 3MGPB 3C1BD 5G49A 5AV6D 4G92C 5B33A 4Z2MH 5B33D 3C1CB 5KDMA 3W98D 4LD9A 2BYMA 5FUGA 2LY8A 4H9PB 5B24C 3AFAC 3AFAD 3AZNA 4WU8C 2ZM5A 3AZJA 3WKJA 1KX3A 3LJAD 3AYWB 3MGQC 3H0RC 5GT3C 2Y2LA 5B2JA 2NQBA 1AOIB 4NE5A 5E5AC 3W97D 3TU4D 3MGSA 4CAYA 3REIA 4R8PC 3REIC 5CPKA 1ZLAB 1P3OD 3B6GC 3AYWC 3VH5T 1P3ID 4QLCD 4QLCA 5JRGC 3UTBA 2ZY4A 3X1UA 1P3BB 5AY8D 5AVBC 3KXBB 3AZGC 3NQUB 5CP6D 4UUZA 5DNMD 1M1AB 4LD9C 5AV9D 1P3PA 3A6NC 3WTPC 3LELA 4ZUXD 4KHAB 2AROA 4YM6D 1Q9CA 5DNNB 5B31A 2F2AC 3KXBC 5JA4A 3O62A 3AV2D 1T3UA 5B1LB 2F8NB 3AZKD 3P5JB 4LD9B 1BH9B 3VH6T 5F99C 5CP6B 4EO5B 4X23D 3WA9A 1WWSA 5AY8B 3KUYD 1WWIA 1JFIB 2BYKA 3LZ1D 4HGAC 2FFFB 5BNXB 1KX5D 2HIOD 3X1SC 3X1TB 5CP6C 5AV8B 5CPJD 2CV5C 1HTAA 1F66C 3MGPA 5BO0A 2YFWB 3AZHD 5BO0B 3LZ0C 3AYWD 2W8SA 3B6GD 5B31C 5KDMB 3WAAC 3W96D 3AZED 2IO5B 5AV6C 5B40A 4J8WA 3MGRA 3AV2B 1P3PC 3WKJC 5B1MC 1EQZD 5DNMC 3MGRB 2Y2QA 3LZ0B 4WU9D 2YFVA 2NZDD 4WU9C 5B31B 4J8UC 3AV1C 4YM6C 3REKB 3X1SA 5GXQC 3UTAA 3UT9D 4QLCB 5E5AB 4XUJC 3MGPC 3R45B 5CHLB 4XZQC 1ZLAD 1ZLAC 4Z66B 3R45A 3REKC 1R4VA 4J8VD 4JJNA 4CSRB 4KHAA 2NZDA 4DRBA 3WKJD 4JJNB 3AZNC 3KUYA 3LJAB 3W97C 4DQYB 3KWQD 3LELC 3V9RA 3AFAB 1B6WA 2RVQD 3AZJB 3C1CA 4NE3A 3REHB 2XD5A 4NFTA 2F8NK 3O62C 5B31D 4JJNC 3AZNB 1KX4A 3MGQB 1P3LD 4Z5TC 4XUJD 3AZLA 1M18A 5B0ZB 3AYWA 1EQZC 4ZBJC 3AZFB 1H3OB 1P3PD 5F99B 2Y2HA 1M19C 2PYOB 5B40D 4J8WD 4J8UD 3AV1D 3B6GB 1Z2CB 3REJB 4H9OA 3AZHB 1N1JA 3X1VC 4HGAB 4J8XC 3REJA 4ZBJB 3AZFC 3AZFD 2CV5D 3UTBB 5CPKC 3KSYA 4H9RA 1P3GA 5C3IB 3WTPB 1P3FA 1P3GB 3B6FA 1P3FB 3AZEC 1P34D 3KUYB 3C1BA 3NQJA 5G49B 4KUDD 5B2IA 2Y2KA 1KU5A 3AN2B 5B32C 5GT0C 5B2IB 4LD9D 1TZYD 3AFAA 1TZYC 1ID3A 5AY8A 3REHA 5AVCC 1HQ3A 3AZMC 3A1IA 5CP6A 3AZLB 1M18B 4ZUXB 1P3KC 2Y2MA 5AV5B 5B0YB 2NQBB 1H3OA 2Y2PA 2ZY5A 3REID 2BYKB 3UT9B 4CSRA 3EPHA 2YFWA 1P3BD 2FJ7A 3REKD 3W99A 1P3LA 4WNNB 1P3MC 3W99B 1ULYA 1HQ3D 2JE5A 3VH6A 3UT9C 2AROC 3KWQA 3WTPA 3W96B 3AZFA 4J8VA 4JJND 3AN2A 3VH5W 5B1LA 4J8VC 2F8NA 2G5IC 3B6GA 4Z5TB 5B32A 1HQ3B 3X1TD 4AWLC 1M19A 3A1KA 1KX5B 2DF4C 3IP4C 1M19B 5E5AA 3RELB 5GT3A 3LZ1A 1KX4D 2HIOA 1P3KD 1ID3D 3AZJC 4X23B 3B6FB 5DNNC 4J8XB 2CV5A 5AV5D 3VH6W 5B0YD 3W98C 5B1LD 2F8ND 2NZDB 3AZLD 1M18D 5AV6A 2VQRA 3MGRD 1M1AC 1P3MD 1P3MA 1P34A 2PYOC 3WTPE 5FUGB 3B0CT 2Y2GA 3AZMA 1EQZA 5CPJC 2Y2JA 4H9NB 5BNVA 1F66D 3VH5A 5B0ZA 1W2EA 1U35A 3AZEA 1N1JB 4J8UA 3AV1A 1P3FC 2F8NH 3EPJA 3TU4B 5AVBB 1S32B 4G91B 4UPKA 2J8PA 3RELA 3REJD 5AVBA 3MVDD 5B2IC 2HIOC 2F8NG 2PYOD 4H9RB 2NQBD 4H9SA 4YS3C 5AVCB 4XZQA 3TU4C 5JA4B 2HUEB 5B0ZD 4YM6B 4R8PA 4R8PD 2IO5C 5GT0B 5AV6B 3NQJB 5AV5C 5B0YC 2G5HC 4KUDA 5GXQB 1TZYB 3F6TA 2BYMB 5BS7C 5B31G 5JRGD 5JRGA 4Z5TA 4QLCC 3AN2D 1ID3B 4WU8B 1KX4B 1P3FD 3EG5B 4Z66C 5DNMA 3X1TA 1M19D 3WTPD 3WKJB 3UTAD 4ZUXA 3MNNB 1B67A 3KWQC 3LELD 4J8WC 5B40C 3W97A 3B0DC 5GT3D 2CV5B 1KX4C 3W97B 1P3OA 4H9OB 3AZHA 4M6BA 3C1CC 5GSUD 2DQNC 5B40B 4J8WB 4WU8D 1P3BC 5B24D 1P3AA 1P3PB 4KGCD 3A6NB 5BNVB 3MGQD 4WU9B 3C1BB 4YS3D 3AZND 4YM6A 3W99D 4R8PB 3REKA 3REHD 3REHC 5CPJA 3AZJD 4H9QA 1TZYA 5DNNA 5AVCD 4G92B 3AZHC 4WJ3C 4XZQD 3MVDB 3TU4A 3AZIA 1F1EA 3C1BC 1BH9A 5CPID 2BG1A 3WA9B 2RIQA 1A7WA 5GT3B 4Z66D 4Z66A 3AZGA 3MVDC 5BNXA 1BH8B 1TAFB 4G91C 3LZ1C 4J8XA 4WNNA 5B2JD 1U35D 3V9RB 3X1SD 3LJAA 1F66B 4KUDB 3X1VD 1P34B 5JRGB 3AZMB 3MGSD 3MGSC 1P3AC 3AZKB 3AZLC 3LZ0D 1M18C 5B1LC 2XD1A 5F99A 3UTBD 1KX3B 1EQZB 5B1MB 1P3IA 4EO5C 1P34C 1S32C 2PYOA 4H9NA 2Y2NA 3AZEB 4H9QB 3MGSB 5BT1D 4J8XD 5BT1C 4J8UB 3AV1B 3FDDA 3EPKA 4ZUXC 1P3KB 3X1VB 3AZIB 3X1SB 1P3KA 3WAAB 1U35C 3H0MC 4NE6A 1P3IC 3AV2C 1S32A 5C3IC 5GSUC 3X1UC 3KXBA 2HIOB 5AVCA 3H0LC 4Z5TD 4X23A 5BS7A 2HUEC 1BH8A 1TAFA 3A6NA 3WA9D 4E44A 5AV9C 3X1TC 3UTAC 4WV4B
chains in the Genus database with same CATH topology
5AV8C 3LJAC 4KGCC 1HQ3C 5B2JC 1P3MB 3B0BA 1ID3C 5B33B 3MVDA 3C1CD 5DNND 5AV5A 5B0YA 4WU8A 3MNNA 3MGPD 5B1MA 4KGCB 3UT9A 4WZSB 3MGRC 5DNMB 1M1AD 3B6FD 3B6FC 3WAAD 4KGCA 4AWLB 3AZID 1PZRA 5B24B 1AOIA 3RELD 3REIB 3RELC 3W99C 1F66A 3REJC 1P3OB 3B0CW 2L5AA 3KFUG 2UWXA 5B32G 1KX3D 2RVQC 3W96A 4E45A 3MNND 3LELB 3W96C 5B0ZC 1BFMA 4UUZB 1M1AA 4X23C 3W98A 3O62B 3EPLA 3WA9C 3KUYC 5GSUA 3W98B 2NZDC 5AV8D 5CPJB 1AOIC 1KX5C 2FJ7C 5GT0D 3LZ1B 2AROD 1P3GC 5CPKD 4CAYB 3X1UD 3UTBC 2FJ7B 3AZKC 3AZGB 5CPKB 3AN2C 1ZLAA 1S32D 5AY8C 5AVBD 5F99D 4KUDC 5B1MD 5AV8A 5B32D 1P3LB 2ZY2A 5AV9A 4YS3B 3A6ND 1P3AB 4H9PA 4H9SC 5AV9B 5B2ID 4YS3A 3AZMD 2NQBC 2JCHA 1KX3C 3AZKA 3KXBD 3MGQA 3LZ0A 4WU9A 3O62D 3MNNC 3KWQB 3AV2A 3AL0C 1U35B 5B2JB 1P3LC 1P3IB 1P3GD 5GSUB 5B33C 5B24A 1P3AD 2Y2OA 2YFVB 3X1VA 4J8VB 5B32B 3WAAA 3AZIC 2Y2IA 1KX5A 5CPIA 1AOID 2JSSA 3UTAB 3AZGD 5CPIB 3B0DB 3X1UB 1P3BA 2FJ7D 5E5AD 1JFIA 4XZQB 3NQUA 2ZY3A 4XUJA 4Z2MG 1P3OC 2CWEA 5GT0A 2AROB 4XUJB 4DRAA 5GXQD 5GXQA 5CPIC 3MGPB 3C1BD 5G49A 5AV6D 4G92C 5B33A 4Z2MH 5B33D 3C1CB 5KDMA 3W98D 4LD9A 2BYMA 5FUGA 2LY8A 4H9PB 5B24C 3AFAC 3AFAD 3AZNA 4WU8C 2ZM5A 3AZJA 3WKJA 1KX3A 3LJAD 3AYWB 3MGQC 3H0RC 5GT3C 2Y2LA 5B2JA 2NQBA 1AOIB 4NE5A 5E5AC 3W97D 3TU4D 3MGSA 4CAYA 3REIA 4R8PC 3REIC 5CPKA 1ZLAB 1P3OD 3B6GC 3AYWC 3VH5T 1P3ID 4QLCD 4QLCA 5JRGC 3UTBA 2ZY4A 3X1UA 1P3BB 5AY8D 5AVBC 3KXBB 3AZGC 3NQUB 5CP6D 4UUZA 5DNMD 1M1AB 4LD9C 5AV9D 1P3PA 3A6NC 3WTPC 3LELA 4ZUXD 4KHAB 2AROA 4YM6D 1Q9CA 5DNNB 5B31A 2F2AC 3KXBC 5JA4A 3O62A 3AV2D 1T3UA 5B1LB 2F8NB 3AZKD 3P5JB 4LD9B 1BH9B 3VH6T 5F99C 5CP6B 4EO5B 4X23D 3WA9A 1WWSA 5AY8B 3KUYD 1WWIA 1JFIB 2BYKA 3LZ1D 4HGAC 2FFFB 5BNXB 1KX5D 2HIOD 3X1SC 3X1TB 5CP6C 5AV8B 5CPJD 2CV5C 1HTAA 1F66C 3MGPA 5BO0A 2YFWB 3AZHD 5BO0B 3LZ0C 3AYWD 2W8SA 3B6GD 5B31C 5KDMB 3WAAC 3W96D 3AZED 2IO5B 5AV6C 5B40A 4J8WA 3MGRA 3AV2B 1P3PC 3WKJC 5B1MC 1EQZD 5DNMC 3MGRB 2Y2QA 3LZ0B 4WU9D 2YFVA 2NZDD 4WU9C 5B31B 4J8UC 3AV1C 4YM6C 3REKB 3X1SA 5GXQC 3UTAA 3UT9D 4QLCB 5E5AB 4XUJC 3MGPC 3R45B 5CHLB 4XZQC 1ZLAD 1ZLAC 4Z66B 3R45A 3REKC 1R4VA 4J8VD 4JJNA 4CSRB 4KHAA 2NZDA 4DRBA 3WKJD 4JJNB 3AZNC 3KUYA 3LJAB 3W97C 4DQYB 3KWQD 3LELC 3V9RA 3AFAB 1B6WA 2RVQD 3AZJB 3C1CA 4NE3A 3REHB 2XD5A 4NFTA 2F8NK 3O62C 5B31D 4JJNC 3AZNB 1KX4A 3MGQB 1P3LD 4Z5TC 4XUJD 3AZLA 1M18A 5B0ZB 3AYWA 1EQZC 4ZBJC 3AZFB 1H3OB 1P3PD 5F99B 2Y2HA 1M19C 2PYOB 5B40D 4J8WD 4J8UD 3AV1D 3B6GB 1Z2CB 3REJB 4H9OA 3AZHB 1N1JA 3X1VC 4HGAB 4J8XC 3REJA 4ZBJB 3AZFC 3AZFD 2CV5D 3UTBB 5CPKC 3KSYA 4H9RA 1P3GA 5C3IB 3WTPB 1P3FA 1P3GB 3B6FA 1P3FB 3AZEC 1P34D 3KUYB 3C1BA 3NQJA 5G49B 4KUDD 5B2IA 2Y2KA 1KU5A 3AN2B 5B32C 5GT0C 5B2IB 4LD9D 1TZYD 3AFAA 1TZYC 1ID3A 5AY8A 3REHA 5AVCC 1HQ3A 3AZMC 3A1IA 5CP6A 3AZLB 1M18B 4ZUXB 1P3KC 2Y2MA 5AV5B 5B0YB 2NQBB 1H3OA 2Y2PA 2ZY5A 3REID 2BYKB 3UT9B 4CSRA 3EPHA 2YFWA 1P3BD 2FJ7A 3REKD 3W99A 1P3LA 4WNNB 1P3MC 3W99B 1ULYA 1HQ3D 2JE5A 3VH6A 3UT9C 2AROC 3KWQA 3WTPA 3W96B 3AZFA 4J8VA 4JJND 3AN2A 3VH5W 5B1LA 4J8VC 2F8NA 2G5IC 3B6GA 4Z5TB 5B32A 1HQ3B 3X1TD 4AWLC 1M19A 3A1KA 1KX5B 2DF4C 3IP4C 1M19B 5E5AA 3RELB 5GT3A 3LZ1A 1KX4D 2HIOA 1P3KD 1ID3D 3AZJC 4X23B 3B6FB 5DNNC 4J8XB 2CV5A 5AV5D 3VH6W 5B0YD 3W98C 5B1LD 2F8ND 2NZDB 3AZLD 1M18D 5AV6A 2VQRA 3MGRD 1M1AC 1P3MD 1P3MA 1P34A 2PYOC 3WTPE 5FUGB 3B0CT 2Y2GA 3AZMA 1EQZA 5CPJC 2Y2JA 4H9NB 5BNVA 1F66D 3VH5A 5B0ZA 1W2EA 1U35A 3AZEA 1N1JB 4J8UA 3AV1A 1P3FC 2F8NH 3EPJA 3TU4B 5AVBB 1S32B 4G91B 4UPKA 2J8PA 3RELA 3REJD 5AVBA 3MVDD 5B2IC 2HIOC 2F8NG 2PYOD 4H9RB 2NQBD 4H9SA 4YS3C 5AVCB 4XZQA 3TU4C 5JA4B 2HUEB 5B0ZD 4YM6B 4R8PA 4R8PD 2IO5C 5GT0B 5AV6B 3NQJB 5AV5C 5B0YC 2G5HC 4KUDA 5GXQB 1TZYB 3F6TA 2BYMB 5BS7C 5B31G 5JRGD 5JRGA 4Z5TA 4QLCC 3AN2D 1ID3B 4WU8B 1KX4B 1P3FD 3EG5B 4Z66C 5DNMA 3X1TA 1M19D 3WTPD 3WKJB 3UTAD 4ZUXA 3MNNB 1B67A 3KWQC 3LELD 4J8WC 5B40C 3W97A 3B0DC 5GT3D 2CV5B 1KX4C 3W97B 1P3OA 4H9OB 3AZHA 4M6BA 3C1CC 5GSUD 2DQNC 5B40B 4J8WB 4WU8D 1P3BC 5B24D 1P3AA 1P3PB 4KGCD 3A6NB 5BNVB 3MGQD 4WU9B 3C1BB 4YS3D 3AZND 4YM6A 3W99D 4R8PB 3REKA 3REHD 3REHC 5CPJA 3AZJD 4H9QA 1TZYA 5DNNA 5AVCD 4G92B 3AZHC 4WJ3C 4XZQD 3MVDB 3TU4A 3AZIA 1F1EA 3C1BC 1BH9A 5CPID 2BG1A 3WA9B 2RIQA 1A7WA 5GT3B 4Z66D 4Z66A 3AZGA 3MVDC 5BNXA 1BH8B 1TAFB 4G91C 3LZ1C 4J8XA 4WNNA 5B2JD 1U35D 3V9RB 3X1SD 3LJAA 1F66B 4KUDB 3X1VD 1P34B 5JRGB 3AZMB 3MGSD 3MGSC 1P3AC 3AZKB 3AZLC 3LZ0D 1M18C 5B1LC 2XD1A 5F99A 3UTBD 1KX3B 1EQZB 5B1MB 1P3IA 4EO5C 1P34C 1S32C 2PYOA 4H9NA 2Y2NA 3AZEB 4H9QB 3MGSB 5BT1D 4J8XD 5BT1C 4J8UB 3AV1B 3FDDA 3EPKA 4ZUXC 1P3KB 3X1VB 3AZIB 3X1SB 1P3KA 3WAAB 1U35C 3H0MC 4NE6A 1P3IC 3AV2C 1S32A 5C3IC 5GSUC 3X1UC 3KXBA 2HIOB 5AVCA 3H0LC 4Z5TD 4X23A 5BS7A 2HUEC 1BH8A 1TAFA 3A6NA 3WA9D 4E44A 5AV9C 3X1TC 3UTAC 4WV4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AV8 C;  3LJA C;  4KGC C;  1HQ3 C;  5B2J C;  1P3M B;  3B0B A;  1ID3 C;  5B33 B;  3MVD A;  3C1C D;  5DNN D;  5AV5 A;  5B0Y A;  4WU8 A;  3MNN A;  3MGP D;  5B1M A;  4KGC B;  3UT9 A;  4WZS B;  3MGR C;  5DNM B;  1M1A D;  3B6F D;  3B6F C;  3WAA D;  4KGC A;  4AWL B;  3AZI D;  5B24 B;  1AOI A;  3REL D;  3REI B;  3REL C;  3W99 C;  1F66 A;  3REJ C;  1P3O B;  3B0C W;  2L5A A;  5B32 G;  1KX3 D;  2RVQ C;  3W96 A;  4E45 A;  3MNN D;  3LEL B;  3W96 C;  5B0Z C;  1BFM A;  4UUZ B;  1M1A A;  4X23 C;  3W98 A;  3O62 B;  3WA9 C;  3KUY C;  5GSU A;  3W98 B;  2NZD C;  5AV8 D;  5CPJ B;  1AOI C;  1KX5 C;  2FJ7 C;  5GT0 D;  3LZ1 B;  2ARO D;  1P3G C;  5CPK D;  4CAY B;  3X1U D;  3UTB C;  2FJ7 B;  3AZK C;  3AZG B;  5CPK B;  3AN2 C;  1ZLA A;  1S32 D;  5AY8 C;  5AVB D;  5F99 D;  4KUD C;  5B1M D;  5AV8 A;  5B32 D;  1P3L B;  5AV9 A;  4YS3 B;  3A6N D;  1P3A B;  4H9P A;  4H9S C;  5AV9 B;  5B2I D;  4YS3 A;  3AZM D;  2NQB C;  1KX3 C;  3AZK A;  3KXB D;  3MGQ A;  3LZ0 A;  4WU9 A;  3O62 D;  3MNN C;  3KWQ B;  3AV2 A;  1U35 B;  5B2J B;  1P3L C;  1P3I B;  1P3G D;  5GSU B;  5B33 C;  5B24 A;  1P3A D;  2YFV B;  3X1V A;  4J8V B;  5B32 B;  3WAA A;  3AZI C;  1KX5 A;  5CPI A;  1AOI D;  2JSS A;  3UTA B;  3AZG D;  5CPI B;  3B0D B;  3X1U B;  1P3B A;  2FJ7 D;  5E5A D;  1JFI A;  4XZQ B;  3NQU A;  4XUJ A;  4Z2M G;  1P3O C;  2CWE A;  5GT0 A;  2ARO B;  4XUJ B;  4DRA A;  5GXQ D;  5GXQ A;  5CPI C;  3MGP B;  3C1B D;  5G49 A;  5AV6 D;  4G92 C;  5B33 A;  4Z2M H;  5B33 D;  3C1C B;  5KDM A;  3W98 D;  4LD9 A;  2BYM A;  5FUG A;  2LY8 A;  4H9P B;  3AFA C;  5B24 C;  3AFA D;  3AZN A;  4WU8 C;  3AZJ A;  3WKJ A;  1KX3 A;  3LJA D;  3AYW B;  3MGQ C;  5GT3 C;  5B2J A;  2NQB A;  1AOI B;  4NE5 A;  5E5A C;  3W97 D;  3TU4 D;  3MGS A;  4CAY A;  3REI A;  4R8P C;  3REI C;  5CPK A;  1ZLA B;  1P3O D;  3B6G C;  3AYW C;  3VH5 T;  1P3I D;  4QLC D;  4QLC A;  5JRG C;  3UTB A;  3X1U A;  1P3B B;  5AY8 D;  5AVB C;  3KXB B;  3AZG C;  3NQU B;  5CP6 D;  4UUZ A;  5DNM D;  1M1A B;  4LD9 C;  5AV9 D;  1P3P A;  3A6N C;  3WTP C;  3LEL A;  4ZUX D;  4KHA B;  2ARO A;  4YM6 D;  1Q9C A;  5DNN B;  5B31 A;  3KXB C;  5JA4 A;  3O62 A;  3AV2 D;  5B1L B;  2F8N B;  3AZK D;  4LD9 B;  1BH9 B;  3VH6 T;  5F99 C;  5CP6 B;  4EO5 B;  4X23 D;  3WA9 A;  1WWS A;  5AY8 B;  3KUY D;  1WWI A;  1JFI B;  2BYK A;  3LZ1 D;  4HGA C;  5BNX B;  1KX5 D;  2HIO D;  3X1S C;  3X1T B;  5CP6 C;  5AV8 B;  5CPJ D;  2CV5 C;  1HTA A;  1F66 C;  3MGP A;  5BO0 A;  2YFW B;  3AZH D;  5BO0 B;  3LZ0 C;  3AYW D;  3B6G D;  5B31 C;  5KDM B;  3WAA C;  3W96 D;  3AZE D;  2IO5 B;  5AV6 C;  5B40 A;  4J8W A;  3MGR A;  3AV2 B;  1P3P C;  3WKJ C;  5B1M C;  1EQZ D;  5DNM C;  3MGR B;  3LZ0 B;  4WU9 D;  2YFV A;  2NZD D;  4WU9 C;  5B31 B;  4J8U C;  3AV1 C;  4YM6 C;  3REK B;  3X1S A;  5GXQ C;  3UTA A;  3UT9 D;  4QLC B;  5E5A B;  4XUJ C;  3MGP C;  3R45 B;  5CHL B;  4XZQ C;  1ZLA D;  1ZLA C;  4Z66 B;  3R45 A;  3REK C;  1R4V A;  4J8V D;  4JJN A;  4CSR B;  4KHA A;  2NZD A;  4DRB A;  3WKJ D;  4JJN B;  3AZN C;  3KUY A;  3LJA B;  3W97 C;  3KWQ D;  3LEL C;  3V9R A;  3AFA B;  1B6W A;  2RVQ D;  3AZJ B;  3C1C A;  4NE3 A;  3REH B;  4NFT A;  2F8N K;  3O62 C;  5B31 D;  4JJN C;  3AZN B;  1KX4 A;  3MGQ B;  1P3L D;  4Z5T C;  4XUJ D;  3AZL A;  1M18 A;  5B0Z B;  3AYW A;  1EQZ C;  4ZBJ C;  3AZF B;  1H3O B;  1P3P D;  5F99 B;  1M19 C;  2PYO B;  5B40 D;  4J8W D;  4J8U D;  3AV1 D;  3B6G B;  3REJ B;  4H9O A;  3AZH B;  1N1J A;  3X1V C;  4HGA B;  4J8X C;  3REJ A;  4ZBJ B;  3AZF C;  3AZF D;  2CV5 D;  3UTB B;  5CPK C;  3KSY A;  4H9R A;  1P3G A;  5C3I B;  3WTP B;  1P3F A;  1P3G B;  3B6F A;  1P3F B;  3AZE C;  1P34 D;  3KUY B;  3C1B A;  3NQJ A;  5G49 B;  4KUD D;  5B2I A;  1KU5 A;  3AN2 B;  5B32 C;  5GT0 C;  5B2I B;  4LD9 D;  1TZY D;  3AFA A;  1TZY C;  1ID3 A;  5AY8 A;  3REH A;  5AVC C;  1HQ3 A;  3AZM C;  5CP6 A;  3AZL B;  1M18 B;  4ZUX B;  1P3K C;  2NQB B;  5B0Y B;  5AV5 B;  1H3O A;  3REI D;  2BYK B;  3UT9 B;  4CSR A;  2YFW A;  1P3B D;  2FJ7 A;  3REK D;  3W99 A;  1P3L A;  4WNN B;  1P3M C;  3W99 B;  1ULY A;  1HQ3 D;  3VH6 A;  3UT9 C;  2ARO C;  3KWQ A;  3WTP A;  3W96 B;  3AZF A;  4J8V A;  4JJN D;  3AN2 A;  3VH5 W;  5B1L A;  4J8V C;  2F8N A;  3B6G A;  4Z5T B;  5B32 A;  1HQ3 B;  3X1T D;  4AWL C;  1M19 A;  1KX5 B;  1M19 B;  5E5A A;  3REL B;  5GT3 A;  3LZ1 A;  1KX4 D;  2HIO A;  1P3K D;  1ID3 D;  3AZJ C;  4X23 B;  3B6F B;  5DNN C;  4J8X B;  2CV5 A;  5AV5 D;  3VH6 W;  5B0Y D;  3W98 C;  5B1L D;  2F8N D;  2NZD B;  3AZL D;  1M18 D;  5AV6 A;  3MGR D;  1M1A C;  1P3M D;  1P3M A;  1P34 A;  2PYO C;  3WTP E;  5FUG B;  3B0C T;  3AZM A;  1EQZ A;  5CPJ C;  4H9N B;  5BNV A;  1F66 D;  3VH5 A;  5B0Z A;  1U35 A;  3AZE A;  1N1J B;  4J8U A;  3AV1 A;  1P3F C;  2F8N H;  3TU4 B;  5AVB B;  1S32 B;  4G91 B;  3REL A;  3REJ D;  5AVB A;  3MVD D;  5B2I C;  2HIO C;  2F8N G;  2PYO D;  4H9R B;  2NQB D;  4H9S A;  4YS3 C;  5AVC B;  4XZQ A;  3TU4 C;  5JA4 B;  2HUE B;  5B0Z D;  4YM6 B;  4R8P A;  4R8P D;  2IO5 C;  5GT0 B;  5AV6 B;  3NQJ B;  5AV5 C;  5B0Y C;  4KUD A;  5GXQ B;  1TZY B;  5BS7 C;  2BYM B;  5B31 G;  5JRG D;  5JRG A;  4Z5T A;  4QLC C;  3AN2 D;  1ID3 B;  4WU8 B;  1KX4 B;  1P3F D;  4Z66 C;  5DNM A;  3X1T A;  1M19 D;  3WTP D;  3WKJ B;  3UTA D;  4ZUX A;  3MNN B;  1B67 A;  3KWQ C;  3LEL D;  4J8W C;  5B40 C;  3W97 A;  3B0D C;  5GT3 D;  2CV5 B;  1KX4 C;  3W97 B;  1P3O A;  4H9O B;  3AZH A;  4M6B A;  3C1C C;  5GSU D;  5B40 B;  4J8W B;  4WU8 D;  1P3B C;  5B24 D;  1P3A A;  1P3P B;  4KGC D;  3A6N B;  5BNV B;  3MGQ D;  4WU9 B;  3C1B B;  4YS3 D;  3AZN D;  4YM6 A;  3W99 D;  4R8P B;  3REK A;  3REH D;  3REH C;  5CPJ A;  3AZJ D;  4H9Q A;  1TZY A;  5DNN A;  5AVC D;  4G92 B;  3AZH C;  4XZQ D;  3MVD B;  3TU4 A;  3AZI A;  1F1E A;  3C1B C;  1BH9 A;  5CPI D;  3WA9 B;  1A7W A;  5GT3 B;  4Z66 D;  4Z66 A;  3AZG A;  3MVD C;  5BNX A;  1BH8 B;  1TAF B;  4G91 C;  3LZ1 C;  4J8X A;  4WNN A;  5B2J D;  1U35 D;  3V9R B;  3X1S D;  3LJA A;  1F66 B;  4KUD B;  3X1V D;  1P34 B;  5JRG B;  3AZM B;  3MGS D;  3MGS C;  1P3A C;  3AZK B;  3AZL C;  3LZ0 D;  1M18 C;  5B1L C;  5F99 A;  3UTB D;  1KX3 B;  1EQZ B;  5B1M B;  1P3I A;  4EO5 C;  1P34 C;  1S32 C;  2PYO A;  4H9N A;  3AZE B;  4H9Q B;  3MGS B;  5BT1 D;  4J8X D;  5BT1 C;  4J8U B;  3AV1 B;  4ZUX C;  1P3K B;  3X1V B;  3AZI B;  3X1S B;  1P3K A;  3WAA B;  1U35 C;  4NE6 A;  1P3I C;  3AV2 C;  1S32 A;  5C3I C;  5GSU C;  3X1U C;  3KXB A;  2HIO B;  5AVC A;  4Z5T D;  4X23 A;  5BS7 A;  2HUE C;  1BH8 A;  1TAF A;  3A6N A;  3WA9 D;  4E44 A;  5AV9 C;  3X1T C;  3UTA C;  4WV4 B; 
#chains in the Genus database with same CATH topology
 5AV8 C;  3LJA C;  4KGC C;  1HQ3 C;  5B2J C;  1P3M B;  3B0B A;  1ID3 C;  5B33 B;  3MVD A;  3C1C D;  5DNN D;  5AV5 A;  5B0Y A;  4WU8 A;  3MNN A;  3MGP D;  5B1M A;  4KGC B;  3UT9 A;  4WZS B;  3MGR C;  5DNM B;  1M1A D;  3B6F D;  3B6F C;  3WAA D;  4KGC A;  4AWL B;  3AZI D;  1PZR A;  5B24 B;  1AOI A;  3REL D;  3REI B;  3REL C;  3W99 C;  1F66 A;  3REJ C;  1P3O B;  3B0C W;  2L5A A;  3KFU G;  2UWX A;  5B32 G;  1KX3 D;  2RVQ C;  3W96 A;  4E45 A;  3MNN D;  3LEL B;  3W96 C;  5B0Z C;  1BFM A;  4UUZ B;  1M1A A;  4X23 C;  3W98 A;  3O62 B;  3EPL A;  3WA9 C;  3KUY C;  5GSU A;  3W98 B;  2NZD C;  5AV8 D;  5CPJ B;  1AOI C;  1KX5 C;  2FJ7 C;  5GT0 D;  3LZ1 B;  2ARO D;  1P3G C;  5CPK D;  4CAY B;  3X1U D;  3UTB C;  2FJ7 B;  3AZK C;  3AZG B;  5CPK B;  3AN2 C;  1ZLA A;  1S32 D;  5AY8 C;  5AVB D;  5F99 D;  4KUD C;  5B1M D;  5AV8 A;  5B32 D;  1P3L B;  2ZY2 A;  5AV9 A;  4YS3 B;  3A6N D;  1P3A B;  4H9P A;  4H9S C;  5AV9 B;  5B2I D;  4YS3 A;  3AZM D;  2NQB C;  2JCH A;  1KX3 C;  3AZK A;  3KXB D;  3MGQ A;  3LZ0 A;  4WU9 A;  3O62 D;  3MNN C;  3KWQ B;  3AV2 A;  3AL0 C;  1U35 B;  5B2J B;  1P3L C;  1P3I B;  1P3G D;  5GSU B;  5B33 C;  5B24 A;  1P3A D;  2Y2O A;  2YFV B;  3X1V A;  4J8V B;  5B32 B;  3WAA A;  3AZI C;  2Y2I A;  1KX5 A;  5CPI A;  1AOI D;  2JSS A;  3UTA B;  3AZG D;  5CPI B;  3B0D B;  3X1U B;  1P3B A;  2FJ7 D;  5E5A D;  1JFI A;  4XZQ B;  3NQU A;  2ZY3 A;  4XUJ A;  4Z2M G;  1P3O C;  2CWE A;  5GT0 A;  2ARO B;  4XUJ B;  4DRA A;  5GXQ D;  5GXQ A;  5CPI C;  3MGP B;  3C1B D;  5G49 A;  5AV6 D;  4G92 C;  5B33 A;  4Z2M H;  5B33 D;  3C1C B;  5KDM A;  3W98 D;  4LD9 A;  2BYM A;  5FUG A;  2LY8 A;  4H9P B;  5B24 C;  3AFA C;  3AFA D;  3AZN A;  4WU8 C;  2ZM5 A;  3AZJ A;  3WKJ A;  1KX3 A;  3LJA D;  3AYW B;  3MGQ C;  3H0R C;  5GT3 C;  2Y2L A;  5B2J A;  2NQB A;  1AOI B;  4NE5 A;  5E5A C;  3W97 D;  3TU4 D;  3MGS A;  4CAY A;  3REI A;  4R8P C;  3REI C;  5CPK A;  1ZLA B;  1P3O D;  3B6G C;  3AYW C;  3VH5 T;  1P3I D;  4QLC D;  4QLC A;  5JRG C;  3UTB A;  2ZY4 A;  3X1U A;  1P3B B;  5AY8 D;  5AVB C;  3KXB B;  3AZG C;  3NQU B;  5CP6 D;  4UUZ A;  5DNM D;  1M1A B;  4LD9 C;  5AV9 D;  1P3P A;  3A6N C;  3WTP C;  3LEL A;  4ZUX D;  4KHA B;  2ARO A;  4YM6 D;  1Q9C A;  5DNN B;  5B31 A;  2F2A C;  3KXB C;  5JA4 A;  3O62 A;  3AV2 D;  1T3U A;  5B1L B;  2F8N B;  3AZK D;  3P5J B;  4LD9 B;  1BH9 B;  3VH6 T;  5F99 C;  5CP6 B;  4EO5 B;  4X23 D;  3WA9 A;  1WWS A;  5AY8 B;  3KUY D;  1WWI A;  1JFI B;  2BYK A;  3LZ1 D;  4HGA C;  2FFF B;  5BNX B;  1KX5 D;  2HIO D;  3X1S C;  3X1T B;  5CP6 C;  5AV8 B;  5CPJ D;  2CV5 C;  1HTA A;  1F66 C;  3MGP A;  5BO0 A;  2YFW B;  3AZH D;  5BO0 B;  3LZ0 C;  3AYW D;  2W8S A;  3B6G D;  5B31 C;  5KDM B;  3WAA C;  3W96 D;  3AZE D;  2IO5 B;  5AV6 C;  5B40 A;  4J8W A;  3MGR A;  3AV2 B;  1P3P C;  3WKJ C;  5B1M C;  1EQZ D;  5DNM C;  3MGR B;  2Y2Q A;  3LZ0 B;  4WU9 D;  2YFV A;  2NZD D;  4WU9 C;  5B31 B;  4J8U C;  3AV1 C;  4YM6 C;  3REK B;  3X1S A;  5GXQ C;  3UTA A;  3UT9 D;  4QLC B;  5E5A B;  4XUJ C;  3MGP C;  3R45 B;  5CHL B;  4XZQ C;  1ZLA D;  1ZLA C;  4Z66 B;  3R45 A;  3REK C;  1R4V A;  4J8V D;  4JJN A;  4CSR B;  4KHA A;  2NZD A;  4DRB A;  3WKJ D;  4JJN B;  3AZN C;  3KUY A;  3LJA B;  3W97 C;  4DQY B;  3KWQ D;  3LEL C;  3V9R A;  3AFA B;  1B6W A;  2RVQ D;  3AZJ B;  3C1C A;  4NE3 A;  3REH B;  2XD5 A;  4NFT A;  2F8N K;  3O62 C;  5B31 D;  4JJN C;  3AZN B;  1KX4 A;  3MGQ B;  1P3L D;  4Z5T C;  4XUJ D;  3AZL A;  1M18 A;  5B0Z B;  3AYW A;  1EQZ C;  4ZBJ C;  3AZF B;  1H3O B;  1P3P D;  5F99 B;  2Y2H A;  1M19 C;  2PYO B;  5B40 D;  4J8W D;  4J8U D;  3AV1 D;  3B6G B;  1Z2C B;  3REJ B;  4H9O A;  3AZH B;  1N1J A;  3X1V C;  4HGA B;  4J8X C;  3REJ A;  4ZBJ B;  3AZF C;  3AZF D;  2CV5 D;  3UTB B;  5CPK C;  3KSY A;  4H9R A;  1P3G A;  5C3I B;  3WTP B;  1P3F A;  1P3G B;  3B6F A;  1P3F B;  3AZE C;  1P34 D;  3KUY B;  3C1B A;  3NQJ A;  5G49 B;  4KUD D;  5B2I A;  2Y2K A;  1KU5 A;  3AN2 B;  5B32 C;  5GT0 C;  5B2I B;  4LD9 D;  1TZY D;  3AFA A;  1TZY C;  1ID3 A;  5AY8 A;  3REH A;  5AVC C;  1HQ3 A;  3AZM C;  3A1I A;  5CP6 A;  3AZL B;  1M18 B;  4ZUX B;  1P3K C;  2Y2M A;  5AV5 B;  5B0Y B;  2NQB B;  1H3O A;  2Y2P A;  2ZY5 A;  3REI D;  2BYK B;  3UT9 B;  4CSR A;  3EPH A;  2YFW A;  1P3B D;  2FJ7 A;  3REK D;  3W99 A;  1P3L A;  4WNN B;  1P3M C;  3W99 B;  1ULY A;  1HQ3 D;  2JE5 A;  3VH6 A;  3UT9 C;  2ARO C;  3KWQ A;  3WTP A;  3W96 B;  3AZF A;  4J8V A;  4JJN D;  3AN2 A;  3VH5 W;  5B1L A;  4J8V C;  2F8N A;  2G5I C;  3B6G A;  4Z5T B;  5B32 A;  1HQ3 B;  3X1T D;  4AWL C;  1M19 A;  3A1K A;  1KX5 B;  2DF4 C;  3IP4 C;  1M19 B;  5E5A A;  3REL B;  5GT3 A;  3LZ1 A;  1KX4 D;  2HIO A;  1P3K D;  1ID3 D;  3AZJ C;  4X23 B;  3B6F B;  5DNN C;  4J8X B;  2CV5 A;  5AV5 D;  3VH6 W;  5B0Y D;  3W98 C;  5B1L D;  2F8N D;  2NZD B;  3AZL D;  1M18 D;  5AV6 A;  2VQR A;  3MGR D;  1M1A C;  1P3M D;  1P3M A;  1P34 A;  2PYO C;  3WTP E;  5FUG B;  3B0C T;  2Y2G A;  3AZM A;  1EQZ A;  5CPJ C;  2Y2J A;  4H9N B;  5BNV A;  1F66 D;  3VH5 A;  5B0Z A;  1W2E A;  1U35 A;  3AZE A;  1N1J B;  4J8U A;  3AV1 A;  1P3F C;  2F8N H;  3EPJ A;  3TU4 B;  5AVB B;  1S32 B;  4G91 B;  4UPK A;  2J8P A;  3REL A;  3REJ D;  5AVB A;  3MVD D;  5B2I C;  2HIO C;  2F8N G;  2PYO D;  4H9R B;  2NQB D;  4H9S A;  4YS3 C;  5AVC B;  4XZQ A;  3TU4 C;  5JA4 B;  2HUE B;  5B0Z D;  4YM6 B;  4R8P A;  4R8P D;  2IO5 C;  5GT0 B;  5AV6 B;  3NQJ B;  5AV5 C;  5B0Y C;  2G5H C;  4KUD A;  5GXQ B;  1TZY B;  3F6T A;  2BYM B;  5BS7 C;  5B31 G;  5JRG D;  5JRG A;  4Z5T A;  4QLC C;  3AN2 D;  1ID3 B;  4WU8 B;  1KX4 B;  1P3F D;  3EG5 B;  4Z66 C;  5DNM A;  3X1T A;  1M19 D;  3WTP D;  3WKJ B;  3UTA D;  4ZUX A;  3MNN B;  1B67 A;  3KWQ C;  3LEL D;  4J8W C;  5B40 C;  3W97 A;  3B0D C;  5GT3 D;  2CV5 B;  1KX4 C;  3W97 B;  1P3O A;  4H9O B;  3AZH A;  4M6B A;  3C1C C;  5GSU D;  2DQN C;  5B40 B;  4J8W B;  4WU8 D;  1P3B C;  5B24 D;  1P3A A;  1P3P B;  4KGC D;  3A6N B;  5BNV B;  3MGQ D;  4WU9 B;  3C1B B;  4YS3 D;  3AZN D;  4YM6 A;  3W99 D;  4R8P B;  3REK A;  3REH D;  3REH C;  5CPJ A;  3AZJ D;  4H9Q A;  1TZY A;  5DNN A;  5AVC D;  4G92 B;  3AZH C;  4WJ3 C;  4XZQ D;  3MVD B;  3TU4 A;  3AZI A;  1F1E A;  3C1B C;  1BH9 A;  5CPI D;  2BG1 A;  3WA9 B;  2RIQ A;  1A7W A;  5GT3 B;  4Z66 D;  4Z66 A;  3AZG A;  3MVD C;  5BNX A;  1BH8 B;  1TAF B;  4G91 C;  3LZ1 C;  4J8X A;  4WNN A;  5B2J D;  1U35 D;  3V9R B;  3X1S D;  3LJA A;  1F66 B;  4KUD B;  3X1V D;  1P34 B;  5JRG B;  3AZM B;  3MGS D;  3MGS C;  1P3A C;  3AZK B;  3AZL C;  3LZ0 D;  1M18 C;  5B1L C;  2XD1 A;  5F99 A;  3UTB D;  1KX3 B;  1EQZ B;  5B1M B;  1P3I A;  4EO5 C;  1P34 C;  1S32 C;  2PYO A;  4H9N A;  2Y2N A;  3AZE B;  4H9Q B;  3MGS B;  5BT1 D;  4J8X D;  5BT1 C;  4J8U B;  3AV1 B;  3FDD A;  3EPK A;  4ZUX C;  1P3K B;  3X1V B;  3AZI B;  3X1S B;  1P3K A;  3WAA B;  1U35 C;  3H0M C;  4NE6 A;  1P3I C;  3AV2 C;  1S32 A;  5C3I C;  5GSU C;  3X1U C;  3KXB A;  2HIO B;  5AVC A;  3H0L C;  4Z5T D;  4X23 A;  5BS7 A;  2HUE C;  1BH8 A;  1TAF A;  3A6N A;  3WA9 D;  4E44 A;  5AV9 C;  3X1T C;  3UTA C;  4WV4 B; 
#chains in the Genus database with same CATH homology
 5AV8 C;  3LJA C;  4KGC C;  1HQ3 C;  5B2J C;  1P3M B;  3B0B A;  1ID3 C;  5B33 B;  3MVD A;  3C1C D;  5DNN D;  5AV5 A;  5B0Y A;  4WU8 A;  3MNN A;  3MGP D;  5B1M A;  4KGC B;  3UT9 A;  4WZS B;  3MGR C;  5DNM B;  1M1A D;  3B6F D;  3B6F C;  3WAA D;  4KGC A;  4AWL B;  3AZI D;  1PZR A;  5B24 B;  1AOI A;  3REL D;  3REI B;  3REL C;  3W99 C;  1F66 A;  3REJ C;  1P3O B;  3B0C W;  2L5A A;  3KFU G;  2UWX A;  5B32 G;  1KX3 D;  2RVQ C;  3W96 A;  4E45 A;  3MNN D;  3LEL B;  3W96 C;  5B0Z C;  1BFM A;  4UUZ B;  1M1A A;  4X23 C;  3W98 A;  3O62 B;  3EPL A;  3WA9 C;  3KUY C;  5GSU A;  3W98 B;  2NZD C;  5AV8 D;  5CPJ B;  1AOI C;  1KX5 C;  2FJ7 C;  5GT0 D;  3LZ1 B;  2ARO D;  1P3G C;  5CPK D;  4CAY B;  3X1U D;  3UTB C;  2FJ7 B;  3AZK C;  3AZG B;  5CPK B;  3AN2 C;  1ZLA A;  1S32 D;  5AY8 C;  5AVB D;  5F99 D;  4KUD C;  5B1M D;  5AV8 A;  5B32 D;  1P3L B;  2ZY2 A;  5AV9 A;  4YS3 B;  3A6N D;  1P3A B;  4H9P A;  4H9S C;  5AV9 B;  5B2I D;  4YS3 A;  3AZM D;  2NQB C;  2JCH A;  1KX3 C;  3AZK A;  3KXB D;  3MGQ A;  3LZ0 A;  4WU9 A;  3O62 D;  3MNN C;  3KWQ B;  3AV2 A;  3AL0 C;  1U35 B;  5B2J B;  1P3L C;  1P3I B;  1P3G D;  5GSU B;  5B33 C;  5B24 A;  1P3A D;  2Y2O A;  2YFV B;  3X1V A;  4J8V B;  5B32 B;  3WAA A;  3AZI C;  2Y2I A;  1KX5 A;  5CPI A;  1AOI D;  2JSS A;  3UTA B;  3AZG D;  5CPI B;  3B0D B;  3X1U B;  1P3B A;  2FJ7 D;  5E5A D;  1JFI A;  4XZQ B;  3NQU A;  2ZY3 A;  4XUJ A;  4Z2M G;  1P3O C;  2CWE A;  5GT0 A;  2ARO B;  4XUJ B;  4DRA A;  5GXQ D;  5GXQ A;  5CPI C;  3MGP B;  3C1B D;  5G49 A;  5AV6 D;  4G92 C;  5B33 A;  4Z2M H;  5B33 D;  3C1C B;  5KDM A;  3W98 D;  4LD9 A;  2BYM A;  5FUG A;  2LY8 A;  4H9P B;  5B24 C;  3AFA C;  3AFA D;  3AZN A;  4WU8 C;  2ZM5 A;  3AZJ A;  3WKJ A;  1KX3 A;  3LJA D;  3AYW B;  3MGQ C;  3H0R C;  5GT3 C;  2Y2L A;  5B2J A;  2NQB A;  1AOI B;  4NE5 A;  5E5A C;  3W97 D;  3TU4 D;  3MGS A;  4CAY A;  3REI A;  4R8P C;  3REI C;  5CPK A;  1ZLA B;  1P3O D;  3B6G C;  3AYW C;  3VH5 T;  1P3I D;  4QLC D;  4QLC A;  5JRG C;  3UTB A;  2ZY4 A;  3X1U A;  1P3B B;  5AY8 D;  5AVB C;  3KXB B;  3AZG C;  3NQU B;  5CP6 D;  4UUZ A;  5DNM D;  1M1A B;  4LD9 C;  5AV9 D;  1P3P A;  3A6N C;  3WTP C;  3LEL A;  4ZUX D;  4KHA B;  2ARO A;  4YM6 D;  1Q9C A;  5DNN B;  5B31 A;  2F2A C;  3KXB C;  5JA4 A;  3O62 A;  3AV2 D;  1T3U A;  5B1L B;  2F8N B;  3AZK D;  3P5J B;  4LD9 B;  1BH9 B;  3VH6 T;  5F99 C;  5CP6 B;  4EO5 B;  4X23 D;  3WA9 A;  1WWS A;  5AY8 B;  3KUY D;  1WWI A;  1JFI B;  2BYK A;  3LZ1 D;  4HGA C;  2FFF B;  5BNX B;  1KX5 D;  2HIO D;  3X1S C;  3X1T B;  5CP6 C;  5AV8 B;  5CPJ D;  2CV5 C;  1HTA A;  1F66 C;  3MGP A;  5BO0 A;  2YFW B;  3AZH D;  5BO0 B;  3LZ0 C;  3AYW D;  2W8S A;  3B6G D;  5B31 C;  5KDM B;  3WAA C;  3W96 D;  3AZE D;  2IO5 B;  5AV6 C;  5B40 A;  4J8W A;  3MGR A;  3AV2 B;  1P3P C;  3WKJ C;  5B1M C;  1EQZ D;  5DNM C;  3MGR B;  2Y2Q A;  3LZ0 B;  4WU9 D;  2YFV A;  2NZD D;  4WU9 C;  5B31 B;  4J8U C;  3AV1 C;  4YM6 C;  3REK B;  3X1S A;  5GXQ C;  3UTA A;  3UT9 D;  4QLC B;  5E5A B;  4XUJ C;  3MGP C;  3R45 B;  5CHL B;  4XZQ C;  1ZLA D;  1ZLA C;  4Z66 B;  3R45 A;  3REK C;  1R4V A;  4J8V D;  4JJN A;  4CSR B;  4KHA A;  2NZD A;  4DRB A;  3WKJ D;  4JJN B;  3AZN C;  3KUY A;  3LJA B;  3W97 C;  4DQY B;  3KWQ D;  3LEL C;  3V9R A;  3AFA B;  1B6W A;  2RVQ D;  3AZJ B;  3C1C A;  4NE3 A;  3REH B;  2XD5 A;  4NFT A;  2F8N K;  3O62 C;  5B31 D;  4JJN C;  3AZN B;  1KX4 A;  3MGQ B;  1P3L D;  4Z5T C;  4XUJ D;  3AZL A;  1M18 A;  5B0Z B;  3AYW A;  1EQZ C;  4ZBJ C;  3AZF B;  1H3O B;  1P3P D;  5F99 B;  2Y2H A;  1M19 C;  2PYO B;  5B40 D;  4J8W D;  4J8U D;  3AV1 D;  3B6G B;  1Z2C B;  3REJ B;  4H9O A;  3AZH B;  1N1J A;  3X1V C;  4HGA B;  4J8X C;  3REJ A;  4ZBJ B;  3AZF C;  3AZF D;  2CV5 D;  3UTB B;  5CPK C;  3KSY A;  4H9R A;  1P3G A;  5C3I B;  3WTP B;  1P3F A;  1P3G B;  3B6F A;  1P3F B;  3AZE C;  1P34 D;  3KUY B;  3C1B A;  3NQJ A;  5G49 B;  4KUD D;  5B2I A;  2Y2K A;  1KU5 A;  3AN2 B;  5B32 C;  5GT0 C;  5B2I B;  4LD9 D;  1TZY D;  3AFA A;  1TZY C;  1ID3 A;  5AY8 A;  3REH A;  5AVC C;  1HQ3 A;  3AZM C;  3A1I A;  5CP6 A;  3AZL B;  1M18 B;  4ZUX B;  1P3K C;  2Y2M A;  5AV5 B;  5B0Y B;  2NQB B;  1H3O A;  2Y2P A;  2ZY5 A;  3REI D;  2BYK B;  3UT9 B;  4CSR A;  3EPH A;  2YFW A;  1P3B D;  2FJ7 A;  3REK D;  3W99 A;  1P3L A;  4WNN B;  1P3M C;  3W99 B;  1ULY A;  1HQ3 D;  2JE5 A;  3VH6 A;  3UT9 C;  2ARO C;  3KWQ A;  3WTP A;  3W96 B;  3AZF A;  4J8V A;  4JJN D;  3AN2 A;  3VH5 W;  5B1L A;  4J8V C;  2F8N A;  2G5I C;  3B6G A;  4Z5T B;  5B32 A;  1HQ3 B;  3X1T D;  4AWL C;  1M19 A;  3A1K A;  1KX5 B;  2DF4 C;  3IP4 C;  1M19 B;  5E5A A;  3REL B;  5GT3 A;  3LZ1 A;  1KX4 D;  2HIO A;  1P3K D;  1ID3 D;  3AZJ C;  4X23 B;  3B6F B;  5DNN C;  4J8X B;  2CV5 A;  5AV5 D;  3VH6 W;  5B0Y D;  3W98 C;  5B1L D;  2F8N D;  2NZD B;  3AZL D;  1M18 D;  5AV6 A;  2VQR A;  3MGR D;  1M1A C;  1P3M D;  1P3M A;  1P34 A;  2PYO C;  3WTP E;  5FUG B;  3B0C T;  2Y2G A;  3AZM A;  1EQZ A;  5CPJ C;  2Y2J A;  4H9N B;  5BNV A;  1F66 D;  3VH5 A;  5B0Z A;  1W2E A;  1U35 A;  3AZE A;  1N1J B;  4J8U A;  3AV1 A;  1P3F C;  2F8N H;  3EPJ A;  3TU4 B;  5AVB B;  1S32 B;  4G91 B;  4UPK A;  2J8P A;  3REL A;  3REJ D;  5AVB A;  3MVD D;  5B2I C;  2HIO C;  2F8N G;  2PYO D;  4H9R B;  2NQB D;  4H9S A;  4YS3 C;  5AVC B;  4XZQ A;  3TU4 C;  5JA4 B;  2HUE B;  5B0Z D;  4YM6 B;  4R8P A;  4R8P D;  2IO5 C;  5GT0 B;  5AV6 B;  3NQJ B;  5AV5 C;  5B0Y C;  2G5H C;  4KUD A;  5GXQ B;  1TZY B;  3F6T A;  2BYM B;  5BS7 C;  5B31 G;  5JRG D;  5JRG A;  4Z5T A;  4QLC C;  3AN2 D;  1ID3 B;  4WU8 B;  1KX4 B;  1P3F D;  3EG5 B;  4Z66 C;  5DNM A;  3X1T A;  1M19 D;  3WTP D;  3WKJ B;  3UTA D;  4ZUX A;  3MNN B;  1B67 A;  3KWQ C;  3LEL D;  4J8W C;  5B40 C;  3W97 A;  3B0D C;  5GT3 D;  2CV5 B;  1KX4 C;  3W97 B;  1P3O A;  4H9O B;  3AZH A;  4M6B A;  3C1C C;  5GSU D;  2DQN C;  5B40 B;  4J8W B;  4WU8 D;  1P3B C;  5B24 D;  1P3A A;  1P3P B;  4KGC D;  3A6N B;  5BNV B;  3MGQ D;  4WU9 B;  3C1B B;  4YS3 D;  3AZN D;  4YM6 A;  3W99 D;  4R8P B;  3REK A;  3REH D;  3REH C;  5CPJ A;  3AZJ D;  4H9Q A;  1TZY A;  5DNN A;  5AVC D;  4G92 B;  3AZH C;  4WJ3 C;  4XZQ D;  3MVD B;  3TU4 A;  3AZI A;  1F1E A;  3C1B C;  1BH9 A;  5CPI D;  2BG1 A;  3WA9 B;  2RIQ A;  1A7W A;  5GT3 B;  4Z66 D;  4Z66 A;  3AZG A;  3MVD C;  5BNX A;  1BH8 B;  1TAF B;  4G91 C;  3LZ1 C;  4J8X A;  4WNN A;  5B2J D;  1U35 D;  3V9R B;  3X1S D;  3LJA A;  1F66 B;  4KUD B;  3X1V D;  1P34 B;  5JRG B;  3AZM B;  3MGS D;  3MGS C;  1P3A C;  3AZK B;  3AZL C;  3LZ0 D;  1M18 C;  5B1L C;  2XD1 A;  5F99 A;  3UTB D;  1KX3 B;  1EQZ B;  5B1M B;  1P3I A;  4EO5 C;  1P34 C;  1S32 C;  2PYO A;  4H9N A;  2Y2N A;  3AZE B;  4H9Q B;  3MGS B;  5BT1 D;  4J8X D;  5BT1 C;  4J8U B;  3AV1 B;  3FDD A;  3EPK A;  4ZUX C;  1P3K B;  3X1V B;  3AZI B;  3X1S B;  1P3K A;  3WAA B;  1U35 C;  3H0M C;  4NE6 A;  1P3I C;  3AV2 C;  1S32 A;  5C3I C;  5GSU C;  3X1U C;  3KXB A;  2HIO B;  5AVC A;  3H0L C;  4Z5T D;  4X23 A;  5BS7 A;  2HUE C;  1BH8 A;  1TAF A;  3A6N A;  3WA9 D;  4E44 A;  5AV9 C;  3X1T C;  3UTA C;  4WV4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...