3AZFC

Crystal structure of human nucleosome core particle containing h3k79q mutation
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
108
structure length
108
Chain Sequence
RAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 108
sequence length 108
chains with identical sequence G
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3azfC00
1TAFB 3C1CA 5CPKA 3C1BC 5E5AB 1TZYB 3X1VB 1S32B 3AYWA 4XUJB 5F99B 1U35C 1M1AA 3AZHD 5GT0D 4JJNC 5GXQC 1KX5B 1P3BB 2CV5B 3AZNB 3RELA 5CHLB 2RVQC 4WU9B 3REHA 3MGPB 1P3PC 4J8WC 1P3LB 2L5AA 4H9PB 5AV6B 5AV8A 5B0YC 5JRGC 5AV5D 3B6GD 1B67A 5AV9B 3AZGC 3W99D 4NE5A 5B1MC 3LELB 4ZUXD 3REIA 4H9SC 3VH5T 1A7WA 3KSYA 3W96D 1P3AA 3C1BB 3W98D 5CP6A 3MGSD 4R8PA 4KGCC 3AV1A 4H9NA 1U35B 4X23A 4JJNB 5GXQB 4HGAC 1WWSA 3X1TC 1JFIB 1P3PB 3AFAC 4J8UD 1H3OA 1P3KA 5BO0A 4J8WB 4Z66A 4YM6D 4CSRB 4XUJD 5B0YB 5JRGB 5B2JA 1P3IC 1KX4A 2NQBB 3AZGB 1KX5D 3WKJC 5B1MB 3WTPE 4YS3A 3C1CD 5CPKD 3AZEC 2NZDC 3TU4C 4CAYB 1M1AD 5B33C 3B0CT 3AZLC 3LZ1C 4KGCB 3RELD 3MGQA 5B1LA 3LJAA 1P3OA 3REHD 4HGAB 4G91C 3WTPA 5AV8D 3X1TB 5FUGA 5GT0C 3AFAB 5B32A 3W97A 1P3IB 3UTBA 3REID 3KWQA 3NQJB 3WKJB 5AV5C 1P3GA 3B6GC 5BT1D 1P3PD 5AVCA 3W99C 3AZEB 1WWIA 5CP6D 4R8PD 4ZUXC 2NZDB 5B0YD 3AV1D 1BH8A 4G92C 3TU4B 5B33B 4X23D 3AZLB 3LZ1B 3W96C 5B1MD 1HQ3A 5GT3C 3W98C 3MNNA 1BH9B 3MGSC 3KXBA 1P3KD 2HIOA 2F8NB 4G91B 4Z66D 5BNVB 3MVDA 5B2JD 5GT0B 1KX4D 1M18A 2PYOA 4H9OA 4KGCD 1P3FA 1F66A 5B2IA 4J8UC 4WNNA 4YS3D 4YM6C 5AV5B 1P34C 5GT3A 3B6GB 3X1TD 5DNNA 3LZ0A 5DNMA 3AZMA 3W99B 3VH6T 4ZUXB 1P3ID 4WU8A 3C1CC 4KHAA 5B1LD 3LJAD 3MGQD 4G92B 5CPKC 1P3OD 3AYWC 3W96B 1M1AC 4Z5TA 3W98B 3MGSB 3WAAA 2F8NH 3RELC 3W97D 4KUDA 3REHC 3UTBD 3UTAA 2YFVB 5AV8C 1P3GD 4QLCA 4J8UB 5AVCD 4YM6B 2F8ND 1P34B 5KDMA 3REIC 2F8NG 5BT1C 3C1CB 5CPJA 4WZSB 5CPKB 1P3AC 5CP6C 5BS7A 4R8PC 3AYWB 3AV1C 5AY8A 1M1AB 1P3BA 3MVDD 3AZKA 4X23C 5B31A 2BYMA 3RELB 5GSUA 3REHB 1P3FD 1F66D 5B2ID 1P3KC 1N1JA 4XZQA 4Z66C 5AV8B 5B2JC 1KX4C 5GT3D 5DNND 3LZ0D 3AZMD 5B24A 4H9QA 4YS3C 3REIB 4WU8D 4H9RA 3B6FA 1P3AB 4Z5TD 5CP6B 3WAAD 4R8PB 3AV1B 4H9NB 3X1UA 3MGQC 5B1LC 3LJAC 1P34D 4EO5C 1P3OC 4KUDD 4X23B 3UTAD 3R45A 3WTPC 4QLCD 1H3OB 3AZJA 4CSRA 5BO0B 1P3KB 5B32C 4Z66B 3AYWD 3W97C 5B2JB 1KX4B 3UTBC 3REKA 3VH5A 1AOIA 3KWQC 3WA9A 1P3GC 1ID3A 4YS3B 5CPJD 5AVCC 3AZFA 4UUZA 3O62A 5AY8D 3AZKD 5B31D 5GSUD 5B31G 3MGQB 5B1LB 2YFWA 1HQ3C 4EO5B 3LJAB 5CPIA 1P3OB 3MNNC 1M19A 3KXBC 1P3MA 2HIOC 4XZQD 3AV2A 3UT9A 3WTPB 3MVDC 5FUGB 1P3AD 3V9RA 1ZLAA 3AN2A 1M18C 3AZIA 5B32B 5AVBA 2PYOC 5B24D 3KUYA 3W97B 3NQUA 5G49A 1P3FC 5B2IC 3UTBB 1F66C 3KWQB 5B0ZA 3B6FD 1P3GB 2FJ7A 3MGRA 5JA4A 5DNNC 3LZ0C 5DNMC 3AZMC 5AVCB 4J8VA 1KX3A 4LD9A 4WU8C 1BH8B 3X1UD 1EQZA 3VH5W 1HQ3B 4Z5TC 1F1EA 3MNNB 3WAAC 3KXBB 2BYKA 5B40A 2HIOB 3AZJD 3AZHA 3A6NA 3MVDB 4KUDC 3REJA 3UTAC 1M18B 1AOID 2PYOB 1HTAA 4H9OB 3WA9D 1P3FB 1F66B 5B2IB 1ID3D 4QLCC 4WNNB 2AROA 3X1SA 3AZFD 4J8XC 5GT3B 3WTPD 3O62D 5DNNB 3LZ0B 5DNMB 3AZMB 4Z2MG 5B32D 5B32G 4WU8B 5CPJC 4KHAB 5CPID 4AWLC 3KWQD 5BS7C 1M19D 5BNXA 5AY8C 4Z5TB 1P3BC 3AZKC 2JSSA 3WAAB 3B0CW 5B31C 3AN2D 1ZLAD 3AZID 5GSUC 5AVBD 4J8XA 3KUYD 4KUDB 3UTAB 4XZQC 1TAFA 5E5AA 1BFMA 1TZYA 4WV4B 1HQ3D 4QLCB 3MGRD 3X1VA 2FJ7D 3MNND 1S32A 3VH6A 4XUJA 5F99A 5B24C 3KXBD 4J8VD 2HIOD 1KX3D 4LD9D 1KX5A 4DRBA 5KDMB 2CV5A 3AZNA 1M18D 1EQZD 4WU9A 2PYOD 3B6FC 1B6WA 3MGPA 5CPJB 1P3LA 4H9PA 5AV6A 4AWLB 5B40D 2LY8A 3X1UC 5AY8B 5AV9A 3A6ND 3AZKB 3REJD 1Q9CA 5DNMD 3LELA 5B31B 2BYMB 2CWEA 5GSUB 4NE3A 3AZJC 1N1JB 2AROD 4XZQB 3X1SD 3C1BA 2NQBC 3REKC 1AOIC 5B24B 1U35A 4H9QB 3WA9C 4JJNA 5GXQA 1ID3C 3AZFC 4H9RB 1JFIA 3B6FB 1P3PA 3O62C 1KU5A 4J8WA 5B0YA 5JRGA 2HUEC 3VH6W 2NQBA 3X1UB 4J8XD 3AZGA 5CPIC 5B1MA 1M19C 1P3MC 3R45B 4NE6A 3AV2C 4H9SA 3UT9C 5E5AD 1TZYD 3X1VD 1ZLAC 3AN2C 3AZJB 1S32D 3AZIC 5AVBC 5F99D 3KUYC 4CAYA 3REKB 1P3BD 1AOIB 2CV5D 3AZND 4KGCA 5B0ZC 3WA9B 4WU9D 3MGPD 1ID3B 3MGRC 2FJ7C 1P3LD 3AZFB 4J8VC 5AV6D 4UUZB 3X1TA 1KX3C 4LD9C 3AFAA 3O62B 5AV9D 1EQZC 1P3IA 3LELD 2HUEB 2YFWB 3NQJA 5CPIB 3WKJA 1ULYA 1M19B 2IO5C 5B40C 1P3MB 3AZHC 3A6NC 3AV2B 3UT9B 3C1BD 3AZEA 3REJC 3V9RB 1ZLAB 3AN2B 2NZDA 3AZIB 5AVBB 3KUYB 3TU4A 1U35D 3NQUB 5G49B 5B33A 4JJND 3AZLA 5GXQD 3LZ1A 2AROC 5B0ZB 3X1SC 2RVQD 1BH9A 2FJ7B 3MGRB 5JA4B 4J8WD 2F8NA 4J8VB 5BNVA 1KX3B 4LD9B 5JRGD 5GT0A 2NQBD 4Z2MH 3AZGD 3REKD 1EQZB 4NFTA 4E45A 5C3IC 5AV5A 2BYKB 2IO5B 5B40B 3AZHB 3B6GA 4ZBJC 3A6NB 3W99A 3REJB 4ZUXA 3B0DC 5E5AC 1TZYC 3X1VC 1S32C 3W96A 2AROB 4XUJC 5F99C 3X1SB 1P3MD 3W98A 3MGSA 3AV2D 3UT9D 1KX5C 3AFAD 2CV5C 3AZNC 4M6BA 4WU9C 3MGPC 2YFVA 4DRAA 3B0BA 1R4VA 4E44A 1P3LC 5AV6C 3WKJD 5B0ZD 2F8NK 4J8UA 5BNXB 5AV9C 4YM6A 5C3IB 3AZED 3LELC 1P34A 2NZDD 4ZBJB 4J8XB 3TU4D 5B33D 3AZLD 3LZ1D 3B0DB
chains in the Genus database with same CATH superfamily
1TAFB 3C1CA 5CPKA 3A1IA 3C1BC 5E5AB 1TZYB 3X1VB 1S32B 3AYWA 2Y2JA 4XUJB 5F99B 1U35C 3EPJA 1M1AA 3AZHD 5GT0D 4JJNC 5GXQC 1KX5B 1P3BB 2CV5B 3AZNB 3RELA 5CHLB 2RVQC 4WU9B 3REHA 3MGPB 1P3PC 4J8WC 1P3LB 2L5AA 4H9PB 5AV6B 5AV8A 5B0YC 5JRGC 5AV5D 3B6GD 1B67A 2Y2KA 5AV9B 3AZGC 3W99D 4NE5A 1PZRA 2Y2LA 5B1MC 3LELB 4ZUXD 3REIA 4H9SC 3VH5T 1A7WA 3KSYA 3W96D 1P3AA 3C1BB 3W98D 5CP6A 3MGSD 4R8PA 4KGCC 3AV1A 4H9NA 1U35B 2ZY3A 4X23A 4JJNB 5GXQB 4HGAC 1WWSA 2Y2PA 3X1TC 1JFIB 1P3PB 3AFAC 4J8UD 1H3OA 1P3KA 5BO0A 4J8WB 4Z66A 4YM6D 4CSRB 4XUJD 3EG5B 5JRGB 5B2JA 5B0YB 1P3IC 1KX4A 2NQBB 3AZGB 1KX5D 3WKJC 5B1MB 3WTPE 4YS3A 3C1CD 5CPKD 3AZEC 4WJ3C 2NZDC 3TU4C 4CAYB 2DF4C 1M1AD 5B33C 3B0CT 2F2AC 3LZ1C 3AZLC 4KGCB 3RELD 3MGQA 5B1LA 3LJAA 2G5HC 2ZY5A 1P3OA 3REHD 4HGAB 4G91C 3WTPA 5AV8D 3X1TB 5FUGA 5GT0C 3AFAB 2ZY2A 2UWXA 5B32A 3W97A 1P3IB 2JE5A 3UTBA 3REID 3KWQA 3IP4C 3NQJB 3WKJB 3H0MC 5AV5C 1P3GA 3B6GC 5BT1D 1P3PD 5AVCA 3W99C 3AZEB 1WWIA 5CP6D 4R8PD 4ZUXC 2NZDB 5B0YD 3AV1D 1BH8A 4G92C 3TU4B 5B33B 4X23D 3AZLB 3LZ1B 3A1KA 3W96C 5B1MD 1HQ3A 5GT3C 3W98C 3MNNA 1BH9B 3MGSC 3KXBA 1P3KD 2HIOA 2F8NB 4G91B 4Z66D 5BNVB 3MVDA 5B2JD 5GT0B 1KX4D 1M18A 2BG1A 2Y2HA 2PYOA 4H9OA 4KGCD 1P3FA 1F66A 5B2IA 4J8UC 4WNNA 4YS3D 4YM6C 5AV5B 1P34C 5GT3A 3B6GB 3X1TD 5DNNA 3LZ0A 5DNMA 3AZMA 3W99B 2JCHA 3VH6T 4ZUXB 1P3ID 4WU8A 3C1CC 4KHAA 5B1LD 3LJAD 3MGQD 4G92B 5CPKC 1P3OD 2Y2QA 3AYWC 3W96B 1M1AC 4Z5TA 3W98B 3MGSB 1T3UA 3WAAA 2F8NH 3RELC 2ZM5A 3W97D 4KUDA 3REHC 3UTBD 3UTAA 2YFVB 3EPLA 5AV8C 1P3GD 4QLCA 4J8UB 1W2EA 5AVCD 4YM6B 2F8ND 1P34B 5KDMA 3REIC 2F8NG 5BT1C 3C1CB 5CPJA 4WZSB 5CPKB 1P3AC 5CP6C 5BS7A 4R8PC 3AYWB 3AV1C 5AY8A 1M1AB 1P3BA 3MVDD 3AZKA 4X23C 5B31A 2BYMA 3RELB 5GSUA 3REHB 1P3FD 1F66D 5B2ID 1P3KC 1N1JA 4XZQA 3KFUG 4Z66C 2XD5A 5AV8B 5B2JC 1KX4C 5GT3D 5DNND 3LZ0D 3AZMD 5B24A 4H9QA 4UPKA 4YS3C 3REIB 4WU8D 1Z2CB 4H9RA 3B6FA 2XD1A 1P3AB 4Z5TD 5CP6B 3WAAD 4R8PB 3AV1B 4H9NB 3X1UA 3MGQC 5B1LC 3LJAC 1P34D 4EO5C 1P3OC 4KUDD 4X23B 3UTAD 3R45A 3WTPC 3AL0C 4QLCD 1H3OB 3AZJA 4CSRA 5BO0B 1P3KB 5B32C 4Z66B 3AYWD 3W97C 5B2JB 1KX4B 3UTBC 3REKA 3VH5A 1AOIA 3KWQC 3WA9A 1P3GC 1ID3A 4YS3B 5CPJD 5AVCC 3AZFA 4UUZA 3O62A 5AY8D 3AZKD 2J8PA 5B31D 5GSUD 5B31G 3MGQB 5B1LB 2YFWA 2DQNC 1HQ3C 4EO5B 3LJAB 5CPIA 3MNNC 1P3OB 1M19A 3KXBC 1P3MA 2HIOC 4XZQD 2Y2NA 3UT9A 3WTPB 3MVDC 3AV2A 5FUGB 1P3AD 3V9RA 1ZLAA 3AN2A 3EPKA 1M18C 3AZIA 5B32B 5AVBA 2PYOC 5B24D 3KUYA 3W97B 3NQUA 5G49A 1P3FC 5B2IC 3UTBB 1F66C 3KWQB 5B0ZA 2W8SA 3B6FD 2FFFB 1P3GB 2FJ7A 3MGRA 5JA4A 5DNNC 3LZ0C 5DNMC 3AZMC 5AVCB 4J8VA 1KX3A 4LD9A 4WU8C 1BH8B 3X1UD 1EQZA 2ZY4A 3VH5W 1HQ3B 2Y2OA 4Z5TC 1F1EA 3MNNB 3WAAC 3KXBB 2BYKA 5B40A 2HIOB 3AZJD 3AZHA 3A6NA 3MVDB 4KUDC 3REJA 3UTAC 1M18B 1AOID 2PYOB 1HTAA 4H9OB 3WA9D 1P3FB 1F66B 5B2IB 1ID3D 4QLCC 4WNNB 2AROA 3X1SA 3AZFD 4J8XC 5GT3B 3WTPD 3O62D 5DNNB 3LZ0B 5DNMB 3AZMB 4Z2MG 5B32D 5B32G 4WU8B 5CPJC 4KHAB 5CPID 4AWLC 3KWQD 5BS7C 1M19D 5BNXA 5AY8C 4Z5TB 1P3BC 3AZKC 2JSSA 3WAAB 3B0CW 5B31C 3AN2D 1ZLAD 3AZID 5GSUC 5AVBD 4J8XA 3KUYD 4KUDB 3UTAB 4XZQC 1TAFA 5E5AA 1BFMA 1TZYA 4WV4B 1HQ3D 4QLCB 3MGRD 3X1VA 2FJ7D 3MNND 1S32A 3VH6A 4XUJA 5F99A 5B24C 3KXBD 4J8VD 2HIOD 1KX3D 4LD9D 1KX5A 4DRBA 5KDMB 2CV5A 3AZNA 1M18D 4DQYB 1EQZD 4WU9A 2PYOD 3B6FC 1B6WA 3MGPA 5CPJB 1P3LA 4H9PA 5AV6A 4AWLB 5B40D 2LY8A 3X1UC 5AY8B 5AV9A 3A6ND 3AZKB 3REJD 1Q9CA 5DNMD 3LELA 5B31B 2BYMB 2CWEA 5GSUB 4NE3A 3AZJC 1N1JB 2AROD 4XZQB 3X1SD 3C1BA 2NQBC 3REKC 1AOIC 5B24B 1U35A 4H9QB 3WA9C 4JJNA 5GXQA 1ID3C 3AZFC 4H9RB 1JFIA 3B6FB 1P3PA 3O62C 1KU5A 4J8WA 3H0LC 5B0YA 2Y2IA 5JRGA 2HUEC 3VH6W 2NQBA 3X1UB 4J8XD 3AZGA 5CPIC 5B1MA 1M19C 3F6TA 1P3MC 3R45B 4NE6A 3AV2C 4H9SA 3UT9C 5E5AD 1TZYD 3X1VD 1ZLAC 3AN2C 3AZJB 1S32D 3AZIC 5AVBC 5F99D 3KUYC 4CAYA 3P5JB 3REKB 1P3BD 1AOIB 2CV5D 3AZND 4KGCA 5B0ZC 3WA9B 4WU9D 3MGPD 1ID3B 3MGRC 2FJ7C 1P3LD 3AZFB 4J8VC 5AV6D 4UUZB 3X1TA 1KX3C 4LD9C 3AFAA 3O62B 5AV9D 1EQZC 1P3IA 3LELD 2HUEB 2YFWB 3NQJA 5CPIB 3WKJA 1ULYA 1M19B 2IO5C 5B40C 1P3MB 3AZHC 3A6NC 3AV2B 3UT9B 3C1BD 3AZEA 3REJC 3V9RB 1ZLAB 3AN2B 2NZDA 3AZIB 5AVBB 3KUYB 3TU4A 1U35D 3NQUB 5G49B 5B33A 4JJND 3AZLA 2VQRA 5GXQD 3LZ1A 2AROC 5B0ZB 3X1SC 2RVQD 1BH9A 2FJ7B 3MGRB 5JA4B 4J8WD 2F8NA 4J8VB 5BNVA 1KX3B 4LD9B 5JRGD 5GT0A 2NQBD 4Z2MH 3AZGD 3REKD 1EQZB 4NFTA 4E45A 5C3IC 5AV5A 2BYKB 2IO5B 5B40B 3AZHB 3B6GA 4ZBJC 3A6NB 2G5IC 3W99A 3REJB 3FDDA 4ZUXA 3EPHA 3B0DC 5E5AC 1TZYC 3X1VC 1S32C 3W96A 2AROB 4XUJC 5F99C 3X1SB 1P3MD 3W98A 3MGSA 3AV2D 3UT9D 1KX5C 3AFAD 2CV5C 3AZNC 4M6BA 4WU9C 3H0RC 3MGPC 2YFVA 4DRAA 3B0BA 1R4VA 4E44A 1P3LC 2Y2GA 5AV6C 3WKJD 5B0ZD 2F8NK 4J8UA 5BNXB 5AV9C 4YM6A 5C3IB 3AZED 2Y2MA 3LELC 1P34A 2NZDD 4ZBJB 4J8XB 3TU4D 5B33D 3AZLD 3LZ1D 2RIQA 3B0DB
chains in the Genus database with same CATH topology
1TAFB 3C1CA 5CPKA 3A1IA 3C1BC 5E5AB 1TZYB 3X1VB 1S32B 3AYWA 2Y2JA 4XUJB 5F99B 1U35C 3EPJA 1M1AA 3AZHD 5GT0D 4JJNC 5GXQC 1KX5B 1P3BB 2CV5B 3AZNB 3RELA 5CHLB 2RVQC 4WU9B 3REHA 3MGPB 1P3PC 4J8WC 1P3LB 2L5AA 4H9PB 5AV6B 5AV8A 5B0YC 5JRGC 5AV5D 3B6GD 1B67A 2Y2KA 5AV9B 3AZGC 3W99D 4NE5A 1PZRA 2Y2LA 5B1MC 3LELB 4ZUXD 3REIA 4H9SC 3VH5T 1A7WA 3KSYA 3W96D 1P3AA 3C1BB 3W98D 5CP6A 3MGSD 4R8PA 4KGCC 3AV1A 4H9NA 1U35B 2ZY3A 4X23A 4JJNB 5GXQB 4HGAC 1WWSA 2Y2PA 3X1TC 1JFIB 1P3PB 3AFAC 4J8UD 1H3OA 1P3KA 5BO0A 4J8WB 4Z66A 4YM6D 4CSRB 4XUJD 3EG5B 5JRGB 5B2JA 5B0YB 1P3IC 1KX4A 2NQBB 3AZGB 1KX5D 3WKJC 5B1MB 3WTPE 4YS3A 3C1CD 5CPKD 3AZEC 4WJ3C 2NZDC 3TU4C 4CAYB 2DF4C 1M1AD 5B33C 3B0CT 2F2AC 3LZ1C 3AZLC 4KGCB 3RELD 3MGQA 5B1LA 3LJAA 2G5HC 2ZY5A 1P3OA 3REHD 4HGAB 4G91C 3WTPA 5AV8D 3X1TB 5FUGA 5GT0C 3AFAB 2ZY2A 2UWXA 5B32A 3W97A 1P3IB 2JE5A 3UTBA 3REID 3KWQA 3IP4C 3NQJB 3WKJB 3H0MC 5AV5C 1P3GA 3B6GC 5BT1D 1P3PD 5AVCA 3W99C 3AZEB 1WWIA 5CP6D 4R8PD 4ZUXC 2NZDB 5B0YD 3AV1D 1BH8A 4G92C 3TU4B 5B33B 4X23D 3AZLB 3LZ1B 3A1KA 3W96C 5B1MD 1HQ3A 5GT3C 3W98C 3MNNA 1BH9B 3MGSC 3KXBA 1P3KD 2HIOA 2F8NB 4G91B 4Z66D 5BNVB 3MVDA 5B2JD 5GT0B 1KX4D 1M18A 2BG1A 2Y2HA 2PYOA 4H9OA 4KGCD 1P3FA 1F66A 5B2IA 4J8UC 4WNNA 4YS3D 4YM6C 5AV5B 1P34C 5GT3A 3B6GB 3X1TD 5DNNA 3LZ0A 5DNMA 3AZMA 3W99B 2JCHA 3VH6T 4ZUXB 1P3ID 4WU8A 3C1CC 4KHAA 5B1LD 3LJAD 3MGQD 4G92B 5CPKC 1P3OD 2Y2QA 3AYWC 3W96B 1M1AC 4Z5TA 3W98B 3MGSB 1T3UA 3WAAA 2F8NH 3RELC 2ZM5A 3W97D 4KUDA 3REHC 3UTBD 3UTAA 2YFVB 3EPLA 5AV8C 1P3GD 4QLCA 4J8UB 1W2EA 5AVCD 4YM6B 2F8ND 1P34B 5KDMA 3REIC 2F8NG 5BT1C 3C1CB 5CPJA 4WZSB 5CPKB 1P3AC 5CP6C 5BS7A 4R8PC 3AYWB 3AV1C 5AY8A 1M1AB 1P3BA 3MVDD 3AZKA 4X23C 5B31A 2BYMA 3RELB 5GSUA 3REHB 1P3FD 1F66D 5B2ID 1P3KC 1N1JA 4XZQA 3KFUG 4Z66C 2XD5A 5AV8B 5B2JC 1KX4C 5GT3D 5DNND 3LZ0D 3AZMD 5B24A 4H9QA 4UPKA 4YS3C 3REIB 4WU8D 1Z2CB 4H9RA 3B6FA 2XD1A 1P3AB 4Z5TD 5CP6B 3WAAD 4R8PB 3AV1B 4H9NB 3X1UA 3MGQC 5B1LC 3LJAC 1P34D 4EO5C 1P3OC 4KUDD 4X23B 3UTAD 3R45A 3WTPC 3AL0C 4QLCD 1H3OB 3AZJA 4CSRA 5BO0B 1P3KB 5B32C 4Z66B 3AYWD 3W97C 5B2JB 1KX4B 3UTBC 3REKA 3VH5A 1AOIA 3KWQC 3WA9A 1P3GC 1ID3A 4YS3B 5CPJD 5AVCC 3AZFA 4UUZA 3O62A 5AY8D 3AZKD 2J8PA 5B31D 5GSUD 5B31G 3MGQB 5B1LB 2YFWA 2DQNC 1HQ3C 4EO5B 3LJAB 5CPIA 3MNNC 1P3OB 1M19A 3KXBC 1P3MA 2HIOC 4XZQD 2Y2NA 3UT9A 3WTPB 3MVDC 3AV2A 5FUGB 1P3AD 3V9RA 1ZLAA 3AN2A 3EPKA 1M18C 3AZIA 5B32B 5AVBA 2PYOC 5B24D 3KUYA 3W97B 3NQUA 5G49A 1P3FC 5B2IC 3UTBB 1F66C 3KWQB 5B0ZA 2W8SA 3B6FD 2FFFB 1P3GB 2FJ7A 3MGRA 5JA4A 5DNNC 3LZ0C 5DNMC 3AZMC 5AVCB 4J8VA 1KX3A 4LD9A 4WU8C 1BH8B 3X1UD 1EQZA 2ZY4A 3VH5W 1HQ3B 2Y2OA 4Z5TC 1F1EA 3MNNB 3WAAC 3KXBB 2BYKA 5B40A 2HIOB 3AZJD 3AZHA 3A6NA 3MVDB 4KUDC 3REJA 3UTAC 1M18B 1AOID 2PYOB 1HTAA 4H9OB 3WA9D 1P3FB 1F66B 5B2IB 1ID3D 4QLCC 4WNNB 2AROA 3X1SA 3AZFD 4J8XC 5GT3B 3WTPD 3O62D 5DNNB 3LZ0B 5DNMB 3AZMB 4Z2MG 5B32D 5B32G 4WU8B 5CPJC 4KHAB 5CPID 4AWLC 3KWQD 5BS7C 1M19D 5BNXA 5AY8C 4Z5TB 1P3BC 3AZKC 2JSSA 3WAAB 3B0CW 5B31C 3AN2D 1ZLAD 3AZID 5GSUC 5AVBD 4J8XA 3KUYD 4KUDB 3UTAB 4XZQC 1TAFA 5E5AA 1BFMA 1TZYA 4WV4B 1HQ3D 4QLCB 3MGRD 3X1VA 2FJ7D 3MNND 1S32A 3VH6A 4XUJA 5F99A 5B24C 3KXBD 4J8VD 2HIOD 1KX3D 4LD9D 1KX5A 4DRBA 5KDMB 2CV5A 3AZNA 1M18D 4DQYB 1EQZD 4WU9A 2PYOD 3B6FC 1B6WA 3MGPA 5CPJB 1P3LA 4H9PA 5AV6A 4AWLB 5B40D 2LY8A 3X1UC 5AY8B 5AV9A 3A6ND 3AZKB 3REJD 1Q9CA 5DNMD 3LELA 5B31B 2BYMB 2CWEA 5GSUB 4NE3A 3AZJC 1N1JB 2AROD 4XZQB 3X1SD 3C1BA 2NQBC 3REKC 1AOIC 5B24B 1U35A 4H9QB 3WA9C 4JJNA 5GXQA 1ID3C 3AZFC 4H9RB 1JFIA 3B6FB 1P3PA 3O62C 1KU5A 4J8WA 3H0LC 5B0YA 2Y2IA 5JRGA 2HUEC 3VH6W 2NQBA 3X1UB 4J8XD 3AZGA 5CPIC 5B1MA 1M19C 3F6TA 1P3MC 3R45B 4NE6A 3AV2C 4H9SA 3UT9C 5E5AD 1TZYD 3X1VD 1ZLAC 3AN2C 3AZJB 1S32D 3AZIC 5AVBC 5F99D 3KUYC 4CAYA 3P5JB 3REKB 1P3BD 1AOIB 2CV5D 3AZND 4KGCA 5B0ZC 3WA9B 4WU9D 3MGPD 1ID3B 3MGRC 2FJ7C 1P3LD 3AZFB 4J8VC 5AV6D 4UUZB 3X1TA 1KX3C 4LD9C 3AFAA 3O62B 5AV9D 1EQZC 1P3IA 3LELD 2HUEB 2YFWB 3NQJA 5CPIB 3WKJA 1ULYA 1M19B 2IO5C 5B40C 1P3MB 3AZHC 3A6NC 3AV2B 3UT9B 3C1BD 3AZEA 3REJC 3V9RB 1ZLAB 3AN2B 2NZDA 3AZIB 5AVBB 3KUYB 3TU4A 1U35D 3NQUB 5G49B 5B33A 4JJND 3AZLA 2VQRA 5GXQD 3LZ1A 2AROC 5B0ZB 3X1SC 2RVQD 1BH9A 2FJ7B 3MGRB 5JA4B 4J8WD 2F8NA 4J8VB 5BNVA 1KX3B 4LD9B 5JRGD 5GT0A 2NQBD 4Z2MH 3AZGD 3REKD 1EQZB 4NFTA 4E45A 5C3IC 5AV5A 2BYKB 2IO5B 5B40B 3AZHB 3B6GA 4ZBJC 3A6NB 2G5IC 3W99A 3REJB 3FDDA 4ZUXA 3EPHA 3B0DC 5E5AC 1TZYC 3X1VC 1S32C 3W96A 2AROB 4XUJC 5F99C 3X1SB 1P3MD 3W98A 3MGSA 3AV2D 3UT9D 1KX5C 3AFAD 2CV5C 3AZNC 4M6BA 4WU9C 3H0RC 3MGPC 2YFVA 4DRAA 3B0BA 1R4VA 4E44A 1P3LC 2Y2GA 5AV6C 3WKJD 5B0ZD 2F8NK 4J8UA 5BNXB 5AV9C 4YM6A 5C3IB 3AZED 2Y2MA 3LELC 1P34A 2NZDD 4ZBJB 4J8XB 3TU4D 5B33D 3AZLD 3LZ1D 2RIQA 3B0DB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TAF B;  3C1C A;  5CPK A;  3C1B C;  5E5A B;  1TZY B;  3X1V B;  1S32 B;  3AYW A;  4XUJ B;  5F99 B;  1U35 C;  1M1A A;  3AZH D;  5GT0 D;  4JJN C;  5GXQ C;  1KX5 B;  1P3B B;  2CV5 B;  3AZN B;  3REL A;  5CHL B;  2RVQ C;  4WU9 B;  3REH A;  3MGP B;  1P3P C;  4J8W C;  1P3L B;  2L5A A;  4H9P B;  5AV6 B;  5AV8 A;  5B0Y C;  5JRG C;  5AV5 D;  3B6G D;  1B67 A;  5AV9 B;  3AZG C;  3W99 D;  4NE5 A;  5B1M C;  3LEL B;  4ZUX D;  3REI A;  4H9S C;  3VH5 T;  1A7W A;  3KSY A;  3W96 D;  1P3A A;  3C1B B;  3W98 D;  5CP6 A;  3MGS D;  4R8P A;  4KGC C;  3AV1 A;  4H9N A;  1U35 B;  4X23 A;  4JJN B;  5GXQ B;  4HGA C;  1WWS A;  3X1T C;  1JFI B;  1P3P B;  3AFA C;  4J8U D;  1H3O A;  1P3K A;  5BO0 A;  4J8W B;  4Z66 A;  4YM6 D;  4CSR B;  4XUJ D;  5B0Y B;  5JRG B;  5B2J A;  1P3I C;  1KX4 A;  2NQB B;  3AZG B;  1KX5 D;  3WKJ C;  5B1M B;  3WTP E;  4YS3 A;  3C1C D;  5CPK D;  3AZE C;  2NZD C;  3TU4 C;  4CAY B;  1M1A D;  5B33 C;  3B0C T;  3AZL C;  3LZ1 C;  4KGC B;  3REL D;  3MGQ A;  5B1L A;  3LJA A;  1P3O A;  3REH D;  4HGA B;  4G91 C;  3WTP A;  5AV8 D;  3X1T B;  5FUG A;  5GT0 C;  3AFA B;  5B32 A;  3W97 A;  1P3I B;  3UTB A;  3REI D;  3KWQ A;  3NQJ B;  3WKJ B;  5AV5 C;  1P3G A;  3B6G C;  5BT1 D;  1P3P D;  5AVC A;  3W99 C;  3AZE B;  1WWI A;  5CP6 D;  4R8P D;  4ZUX C;  2NZD B;  5B0Y D;  3AV1 D;  1BH8 A;  4G92 C;  3TU4 B;  5B33 B;  4X23 D;  3AZL B;  3LZ1 B;  3W96 C;  5B1M D;  1HQ3 A;  5GT3 C;  3W98 C;  3MNN A;  1BH9 B;  3MGS C;  3KXB A;  1P3K D;  2HIO A;  2F8N B;  4G91 B;  4Z66 D;  5BNV B;  3MVD A;  5B2J D;  5GT0 B;  1KX4 D;  1M18 A;  2PYO A;  4H9O A;  4KGC D;  1P3F A;  1F66 A;  5B2I A;  4J8U C;  4WNN A;  4YS3 D;  4YM6 C;  5AV5 B;  1P34 C;  5GT3 A;  3B6G B;  3X1T D;  5DNN A;  3LZ0 A;  5DNM A;  3AZM A;  3W99 B;  3VH6 T;  4ZUX B;  1P3I D;  4WU8 A;  3C1C C;  4KHA A;  5B1L D;  3LJA D;  3MGQ D;  4G92 B;  5CPK C;  1P3O D;  3AYW C;  3W96 B;  1M1A C;  4Z5T A;  3W98 B;  3MGS B;  3WAA A;  2F8N H;  3REL C;  3W97 D;  4KUD A;  3REH C;  3UTB D;  3UTA A;  2YFV B;  5AV8 C;  1P3G D;  4QLC A;  4J8U B;  5AVC D;  4YM6 B;  2F8N D;  1P34 B;  5KDM A;  3REI C;  2F8N G;  5BT1 C;  3C1C B;  5CPJ A;  4WZS B;  5CPK B;  1P3A C;  5CP6 C;  5BS7 A;  4R8P C;  3AYW B;  3AV1 C;  5AY8 A;  1M1A B;  1P3B A;  3MVD D;  3AZK A;  4X23 C;  5B31 A;  2BYM A;  3REL B;  5GSU A;  3REH B;  1P3F D;  1F66 D;  5B2I D;  1P3K C;  1N1J A;  4XZQ A;  4Z66 C;  5AV8 B;  5B2J C;  1KX4 C;  5GT3 D;  5DNN D;  3LZ0 D;  3AZM D;  5B24 A;  4H9Q A;  4YS3 C;  3REI B;  4WU8 D;  4H9R A;  3B6F A;  1P3A B;  4Z5T D;  5CP6 B;  3WAA D;  4R8P B;  3AV1 B;  4H9N B;  3X1U A;  3MGQ C;  5B1L C;  3LJA C;  1P34 D;  4EO5 C;  1P3O C;  4KUD D;  4X23 B;  3UTA D;  3R45 A;  3WTP C;  4QLC D;  1H3O B;  3AZJ A;  4CSR A;  5BO0 B;  1P3K B;  5B32 C;  4Z66 B;  3AYW D;  3W97 C;  5B2J B;  1KX4 B;  3UTB C;  3REK A;  3VH5 A;  1AOI A;  3KWQ C;  3WA9 A;  1P3G C;  1ID3 A;  4YS3 B;  5CPJ D;  5AVC C;  3AZF A;  4UUZ A;  3O62 A;  5AY8 D;  3AZK D;  5B31 D;  5GSU D;  5B31 G;  3MGQ B;  5B1L B;  2YFW A;  1HQ3 C;  4EO5 B;  3LJA B;  5CPI A;  1P3O B;  3MNN C;  1M19 A;  3KXB C;  1P3M A;  2HIO C;  4XZQ D;  3AV2 A;  3UT9 A;  3WTP B;  3MVD C;  5FUG B;  1P3A D;  3V9R A;  1ZLA A;  3AN2 A;  1M18 C;  3AZI A;  5B32 B;  5AVB A;  2PYO C;  5B24 D;  3KUY A;  3W97 B;  3NQU A;  5G49 A;  1P3F C;  5B2I C;  3UTB B;  1F66 C;  3KWQ B;  5B0Z A;  3B6F D;  1P3G B;  2FJ7 A;  3MGR A;  5JA4 A;  5DNN C;  3LZ0 C;  5DNM C;  3AZM C;  5AVC B;  4J8V A;  1KX3 A;  4LD9 A;  4WU8 C;  1BH8 B;  3X1U D;  1EQZ A;  3VH5 W;  1HQ3 B;  4Z5T C;  1F1E A;  3MNN B;  3WAA C;  3KXB B;  2BYK A;  5B40 A;  2HIO B;  3AZJ D;  3AZH A;  3A6N A;  3MVD B;  4KUD C;  3REJ A;  3UTA C;  1M18 B;  1AOI D;  2PYO B;  1HTA A;  4H9O B;  3WA9 D;  1P3F B;  1F66 B;  5B2I B;  1ID3 D;  4QLC C;  4WNN B;  2ARO A;  3X1S A;  3AZF D;  4J8X C;  5GT3 B;  3WTP D;  3O62 D;  5DNN B;  3LZ0 B;  5DNM B;  3AZM B;  4Z2M G;  5B32 D;  5B32 G;  4WU8 B;  5CPJ C;  4KHA B;  5CPI D;  4AWL C;  3KWQ D;  5BS7 C;  1M19 D;  5BNX A;  5AY8 C;  4Z5T B;  1P3B C;  3AZK C;  2JSS A;  3WAA B;  3B0C W;  5B31 C;  3AN2 D;  1ZLA D;  3AZI D;  5GSU C;  5AVB D;  4J8X A;  3KUY D;  4KUD B;  3UTA B;  4XZQ C;  1TAF A;  5E5A A;  1BFM A;  1TZY A;  4WV4 B;  1HQ3 D;  4QLC B;  3MGR D;  3X1V A;  2FJ7 D;  3MNN D;  1S32 A;  3VH6 A;  4XUJ A;  5F99 A;  5B24 C;  3KXB D;  4J8V D;  2HIO D;  1KX3 D;  4LD9 D;  1KX5 A;  4DRB A;  5KDM B;  2CV5 A;  3AZN A;  1M18 D;  1EQZ D;  4WU9 A;  2PYO D;  3B6F C;  1B6W A;  3MGP A;  5CPJ B;  1P3L A;  4H9P A;  5AV6 A;  4AWL B;  5B40 D;  2LY8 A;  3X1U C;  5AY8 B;  5AV9 A;  3A6N D;  3AZK B;  3REJ D;  1Q9C A;  5DNM D;  3LEL A;  5B31 B;  2BYM B;  2CWE A;  5GSU B;  4NE3 A;  3AZJ C;  1N1J B;  2ARO D;  4XZQ B;  3X1S D;  3C1B A;  2NQB C;  3REK C;  1AOI C;  5B24 B;  1U35 A;  4H9Q B;  3WA9 C;  4JJN A;  5GXQ A;  1ID3 C;  3AZF C;  4H9R B;  1JFI A;  3B6F B;  1P3P A;  3O62 C;  1KU5 A;  4J8W A;  5B0Y A;  5JRG A;  2HUE C;  3VH6 W;  2NQB A;  3X1U B;  4J8X D;  3AZG A;  5CPI C;  5B1M A;  1M19 C;  1P3M C;  3R45 B;  4NE6 A;  3AV2 C;  4H9S A;  3UT9 C;  5E5A D;  1TZY D;  3X1V D;  1ZLA C;  3AN2 C;  3AZJ B;  1S32 D;  3AZI C;  5AVB C;  5F99 D;  3KUY C;  4CAY A;  3REK B;  1P3B D;  1AOI B;  2CV5 D;  3AZN D;  4KGC A;  5B0Z C;  3WA9 B;  4WU9 D;  3MGP D;  1ID3 B;  3MGR C;  2FJ7 C;  1P3L D;  3AZF B;  4J8V C;  5AV6 D;  4UUZ B;  3X1T A;  1KX3 C;  4LD9 C;  3AFA A;  3O62 B;  5AV9 D;  1EQZ C;  1P3I A;  3LEL D;  2HUE B;  2YFW B;  3NQJ A;  5CPI B;  3WKJ A;  1ULY A;  1M19 B;  2IO5 C;  5B40 C;  1P3M B;  3AZH C;  3A6N C;  3AV2 B;  3UT9 B;  3C1B D;  3AZE A;  3REJ C;  3V9R B;  1ZLA B;  3AN2 B;  2NZD A;  3AZI B;  5AVB B;  3KUY B;  3TU4 A;  1U35 D;  3NQU B;  5G49 B;  5B33 A;  4JJN D;  3AZL A;  5GXQ D;  3LZ1 A;  2ARO C;  5B0Z B;  3X1S C;  2RVQ D;  1BH9 A;  2FJ7 B;  3MGR B;  5JA4 B;  4J8W D;  2F8N A;  4J8V B;  5BNV A;  1KX3 B;  4LD9 B;  5JRG D;  5GT0 A;  2NQB D;  4Z2M H;  3AZG D;  3REK D;  1EQZ B;  4NFT A;  4E45 A;  5C3I C;  5AV5 A;  2BYK B;  2IO5 B;  5B40 B;  3AZH B;  3B6G A;  4ZBJ C;  3A6N B;  3W99 A;  3REJ B;  4ZUX A;  3B0D C;  5E5A C;  1TZY C;  3X1V C;  1S32 C;  3W96 A;  2ARO B;  4XUJ C;  5F99 C;  3X1S B;  1P3M D;  3W98 A;  3MGS A;  3AV2 D;  3UT9 D;  1KX5 C;  3AFA D;  2CV5 C;  3AZN C;  4M6B A;  4WU9 C;  3MGP C;  2YFV A;  4DRA A;  3B0B A;  1R4V A;  4E44 A;  1P3L C;  5AV6 C;  3WKJ D;  5B0Z D;  2F8N K;  4J8U A;  5BNX B;  5AV9 C;  4YM6 A;  5C3I B;  3AZE D;  3LEL C;  1P34 A;  2NZD D;  4ZBJ B;  4J8X B;  3TU4 D;  5B33 D;  3AZL D;  3LZ1 D;  3B0D B; 
#chains in the Genus database with same CATH topology
 1TAF B;  3C1C A;  5CPK A;  3A1I A;  3C1B C;  5E5A B;  1TZY B;  3X1V B;  1S32 B;  3AYW A;  2Y2J A;  4XUJ B;  5F99 B;  1U35 C;  3EPJ A;  1M1A A;  3AZH D;  5GT0 D;  4JJN C;  5GXQ C;  1KX5 B;  1P3B B;  2CV5 B;  3AZN B;  3REL A;  5CHL B;  2RVQ C;  4WU9 B;  3REH A;  3MGP B;  1P3P C;  4J8W C;  1P3L B;  2L5A A;  4H9P B;  5AV6 B;  5AV8 A;  5B0Y C;  5JRG C;  5AV5 D;  3B6G D;  1B67 A;  2Y2K A;  5AV9 B;  3AZG C;  3W99 D;  4NE5 A;  1PZR A;  2Y2L A;  5B1M C;  3LEL B;  4ZUX D;  3REI A;  4H9S C;  3VH5 T;  1A7W A;  3KSY A;  3W96 D;  1P3A A;  3C1B B;  3W98 D;  5CP6 A;  3MGS D;  4R8P A;  4KGC C;  3AV1 A;  4H9N A;  1U35 B;  2ZY3 A;  4X23 A;  4JJN B;  5GXQ B;  4HGA C;  1WWS A;  2Y2P A;  3X1T C;  1JFI B;  1P3P B;  3AFA C;  4J8U D;  1H3O A;  1P3K A;  5BO0 A;  4J8W B;  4Z66 A;  4YM6 D;  4CSR B;  4XUJ D;  3EG5 B;  5JRG B;  5B2J A;  5B0Y B;  1P3I C;  1KX4 A;  2NQB B;  3AZG B;  1KX5 D;  3WKJ C;  5B1M B;  3WTP E;  4YS3 A;  3C1C D;  5CPK D;  3AZE C;  4WJ3 C;  2NZD C;  3TU4 C;  4CAY B;  2DF4 C;  1M1A D;  5B33 C;  3B0C T;  2F2A C;  3LZ1 C;  3AZL C;  4KGC B;  3REL D;  3MGQ A;  5B1L A;  3LJA A;  2G5H C;  2ZY5 A;  1P3O A;  3REH D;  4HGA B;  4G91 C;  3WTP A;  5AV8 D;  3X1T B;  5FUG A;  5GT0 C;  3AFA B;  2ZY2 A;  2UWX A;  5B32 A;  3W97 A;  1P3I B;  2JE5 A;  3UTB A;  3REI D;  3KWQ A;  3IP4 C;  3NQJ B;  3WKJ B;  3H0M C;  5AV5 C;  1P3G A;  3B6G C;  5BT1 D;  1P3P D;  5AVC A;  3W99 C;  3AZE B;  1WWI A;  5CP6 D;  4R8P D;  4ZUX C;  2NZD B;  5B0Y D;  3AV1 D;  1BH8 A;  4G92 C;  3TU4 B;  5B33 B;  4X23 D;  3AZL B;  3LZ1 B;  3A1K A;  3W96 C;  5B1M D;  1HQ3 A;  5GT3 C;  3W98 C;  3MNN A;  1BH9 B;  3MGS C;  3KXB A;  1P3K D;  2HIO A;  2F8N B;  4G91 B;  4Z66 D;  5BNV B;  3MVD A;  5B2J D;  5GT0 B;  1KX4 D;  1M18 A;  2BG1 A;  2Y2H A;  2PYO A;  4H9O A;  4KGC D;  1P3F A;  1F66 A;  5B2I A;  4J8U C;  4WNN A;  4YS3 D;  4YM6 C;  5AV5 B;  1P34 C;  5GT3 A;  3B6G B;  3X1T D;  5DNN A;  3LZ0 A;  5DNM A;  3AZM A;  3W99 B;  2JCH A;  3VH6 T;  4ZUX B;  1P3I D;  4WU8 A;  3C1C C;  4KHA A;  5B1L D;  3LJA D;  3MGQ D;  4G92 B;  5CPK C;  1P3O D;  2Y2Q A;  3AYW C;  3W96 B;  1M1A C;  4Z5T A;  3W98 B;  3MGS B;  1T3U A;  3WAA A;  2F8N H;  3REL C;  2ZM5 A;  3W97 D;  4KUD A;  3REH C;  3UTB D;  3UTA A;  2YFV B;  3EPL A;  5AV8 C;  1P3G D;  4QLC A;  4J8U B;  1W2E A;  5AVC D;  4YM6 B;  2F8N D;  1P34 B;  5KDM A;  3REI C;  2F8N G;  5BT1 C;  3C1C B;  5CPJ A;  4WZS B;  5CPK B;  1P3A C;  5CP6 C;  5BS7 A;  4R8P C;  3AYW B;  3AV1 C;  5AY8 A;  1M1A B;  1P3B A;  3MVD D;  3AZK A;  4X23 C;  5B31 A;  2BYM A;  3REL B;  5GSU A;  3REH B;  1P3F D;  1F66 D;  5B2I D;  1P3K C;  1N1J A;  4XZQ A;  3KFU G;  4Z66 C;  2XD5 A;  5AV8 B;  5B2J C;  1KX4 C;  5GT3 D;  5DNN D;  3LZ0 D;  3AZM D;  5B24 A;  4H9Q A;  4UPK A;  4YS3 C;  3REI B;  4WU8 D;  1Z2C B;  4H9R A;  3B6F A;  2XD1 A;  1P3A B;  4Z5T D;  5CP6 B;  3WAA D;  4R8P B;  3AV1 B;  4H9N B;  3X1U A;  3MGQ C;  5B1L C;  3LJA C;  1P34 D;  4EO5 C;  1P3O C;  4KUD D;  4X23 B;  3UTA D;  3R45 A;  3WTP C;  3AL0 C;  4QLC D;  1H3O B;  3AZJ A;  4CSR A;  5BO0 B;  1P3K B;  5B32 C;  4Z66 B;  3AYW D;  3W97 C;  5B2J B;  1KX4 B;  3UTB C;  3REK A;  3VH5 A;  1AOI A;  3KWQ C;  3WA9 A;  1P3G C;  1ID3 A;  4YS3 B;  5CPJ D;  5AVC C;  3AZF A;  4UUZ A;  3O62 A;  5AY8 D;  3AZK D;  2J8P A;  5B31 D;  5GSU D;  5B31 G;  3MGQ B;  5B1L B;  2YFW A;  2DQN C;  1HQ3 C;  4EO5 B;  3LJA B;  5CPI A;  3MNN C;  1P3O B;  1M19 A;  3KXB C;  1P3M A;  2HIO C;  4XZQ D;  2Y2N A;  3UT9 A;  3WTP B;  3MVD C;  3AV2 A;  5FUG B;  1P3A D;  3V9R A;  1ZLA A;  3AN2 A;  3EPK A;  1M18 C;  3AZI A;  5B32 B;  5AVB A;  2PYO C;  5B24 D;  3KUY A;  3W97 B;  3NQU A;  5G49 A;  1P3F C;  5B2I C;  3UTB B;  1F66 C;  3KWQ B;  5B0Z A;  2W8S A;  3B6F D;  2FFF B;  1P3G B;  2FJ7 A;  3MGR A;  5JA4 A;  5DNN C;  3LZ0 C;  5DNM C;  3AZM C;  5AVC B;  4J8V A;  1KX3 A;  4LD9 A;  4WU8 C;  1BH8 B;  3X1U D;  1EQZ A;  2ZY4 A;  3VH5 W;  1HQ3 B;  2Y2O A;  4Z5T C;  1F1E A;  3MNN B;  3WAA C;  3KXB B;  2BYK A;  5B40 A;  2HIO B;  3AZJ D;  3AZH A;  3A6N A;  3MVD B;  4KUD C;  3REJ A;  3UTA C;  1M18 B;  1AOI D;  2PYO B;  1HTA A;  4H9O B;  3WA9 D;  1P3F B;  1F66 B;  5B2I B;  1ID3 D;  4QLC C;  4WNN B;  2ARO A;  3X1S A;  3AZF D;  4J8X C;  5GT3 B;  3WTP D;  3O62 D;  5DNN B;  3LZ0 B;  5DNM B;  3AZM B;  4Z2M G;  5B32 D;  5B32 G;  4WU8 B;  5CPJ C;  4KHA B;  5CPI D;  4AWL C;  3KWQ D;  5BS7 C;  1M19 D;  5BNX A;  5AY8 C;  4Z5T B;  1P3B C;  3AZK C;  2JSS A;  3WAA B;  3B0C W;  5B31 C;  3AN2 D;  1ZLA D;  3AZI D;  5GSU C;  5AVB D;  4J8X A;  3KUY D;  4KUD B;  3UTA B;  4XZQ C;  1TAF A;  5E5A A;  1BFM A;  1TZY A;  4WV4 B;  1HQ3 D;  4QLC B;  3MGR D;  3X1V A;  2FJ7 D;  3MNN D;  1S32 A;  3VH6 A;  4XUJ A;  5F99 A;  5B24 C;  3KXB D;  4J8V D;  2HIO D;  1KX3 D;  4LD9 D;  1KX5 A;  4DRB A;  5KDM B;  2CV5 A;  3AZN A;  1M18 D;  4DQY B;  1EQZ D;  4WU9 A;  2PYO D;  3B6F C;  1B6W A;  3MGP A;  5CPJ B;  1P3L A;  4H9P A;  5AV6 A;  4AWL B;  5B40 D;  2LY8 A;  3X1U C;  5AY8 B;  5AV9 A;  3A6N D;  3AZK B;  3REJ D;  1Q9C A;  5DNM D;  3LEL A;  5B31 B;  2BYM B;  2CWE A;  5GSU B;  4NE3 A;  3AZJ C;  1N1J B;  2ARO D;  4XZQ B;  3X1S D;  3C1B A;  2NQB C;  3REK C;  1AOI C;  5B24 B;  1U35 A;  4H9Q B;  3WA9 C;  4JJN A;  5GXQ A;  1ID3 C;  3AZF C;  4H9R B;  1JFI A;  3B6F B;  1P3P A;  3O62 C;  1KU5 A;  4J8W A;  3H0L C;  5B0Y A;  2Y2I A;  5JRG A;  2HUE C;  3VH6 W;  2NQB A;  3X1U B;  4J8X D;  3AZG A;  5CPI C;  5B1M A;  1M19 C;  3F6T A;  1P3M C;  3R45 B;  4NE6 A;  3AV2 C;  4H9S A;  3UT9 C;  5E5A D;  1TZY D;  3X1V D;  1ZLA C;  3AN2 C;  3AZJ B;  1S32 D;  3AZI C;  5AVB C;  5F99 D;  3KUY C;  4CAY A;  3P5J B;  3REK B;  1P3B D;  1AOI B;  2CV5 D;  3AZN D;  4KGC A;  5B0Z C;  3WA9 B;  4WU9 D;  3MGP D;  1ID3 B;  3MGR C;  2FJ7 C;  1P3L D;  3AZF B;  4J8V C;  5AV6 D;  4UUZ B;  3X1T A;  1KX3 C;  4LD9 C;  3AFA A;  3O62 B;  5AV9 D;  1EQZ C;  1P3I A;  3LEL D;  2HUE B;  2YFW B;  3NQJ A;  5CPI B;  3WKJ A;  1ULY A;  1M19 B;  2IO5 C;  5B40 C;  1P3M B;  3AZH C;  3A6N C;  3AV2 B;  3UT9 B;  3C1B D;  3AZE A;  3REJ C;  3V9R B;  1ZLA B;  3AN2 B;  2NZD A;  3AZI B;  5AVB B;  3KUY B;  3TU4 A;  1U35 D;  3NQU B;  5G49 B;  5B33 A;  4JJN D;  3AZL A;  2VQR A;  5GXQ D;  3LZ1 A;  2ARO C;  5B0Z B;  3X1S C;  2RVQ D;  1BH9 A;  2FJ7 B;  3MGR B;  5JA4 B;  4J8W D;  2F8N A;  4J8V B;  5BNV A;  1KX3 B;  4LD9 B;  5JRG D;  5GT0 A;  2NQB D;  4Z2M H;  3AZG D;  3REK D;  1EQZ B;  4NFT A;  4E45 A;  5C3I C;  5AV5 A;  2BYK B;  2IO5 B;  5B40 B;  3AZH B;  3B6G A;  4ZBJ C;  3A6N B;  2G5I C;  3W99 A;  3REJ B;  3FDD A;  4ZUX A;  3EPH A;  3B0D C;  5E5A C;  1TZY C;  3X1V C;  1S32 C;  3W96 A;  2ARO B;  4XUJ C;  5F99 C;  3X1S B;  1P3M D;  3W98 A;  3MGS A;  3AV2 D;  3UT9 D;  1KX5 C;  3AFA D;  2CV5 C;  3AZN C;  4M6B A;  4WU9 C;  3H0R C;  3MGP C;  2YFV A;  4DRA A;  3B0B A;  1R4V A;  4E44 A;  1P3L C;  2Y2G A;  5AV6 C;  3WKJ D;  5B0Z D;  2F8N K;  4J8U A;  5BNX B;  5AV9 C;  4YM6 A;  5C3I B;  3AZE D;  2Y2M A;  3LEL C;  1P34 A;  2NZD D;  4ZBJ B;  4J8X B;  3TU4 D;  5B33 D;  3AZL D;  3LZ1 D;  2RIQ A;  3B0D B; 
#chains in the Genus database with same CATH homology
 1TAF B;  3C1C A;  5CPK A;  3A1I A;  3C1B C;  5E5A B;  1TZY B;  3X1V B;  1S32 B;  3AYW A;  2Y2J A;  4XUJ B;  5F99 B;  1U35 C;  3EPJ A;  1M1A A;  3AZH D;  5GT0 D;  4JJN C;  5GXQ C;  1KX5 B;  1P3B B;  2CV5 B;  3AZN B;  3REL A;  5CHL B;  2RVQ C;  4WU9 B;  3REH A;  3MGP B;  1P3P C;  4J8W C;  1P3L B;  2L5A A;  4H9P B;  5AV6 B;  5AV8 A;  5B0Y C;  5JRG C;  5AV5 D;  3B6G D;  1B67 A;  2Y2K A;  5AV9 B;  3AZG C;  3W99 D;  4NE5 A;  1PZR A;  2Y2L A;  5B1M C;  3LEL B;  4ZUX D;  3REI A;  4H9S C;  3VH5 T;  1A7W A;  3KSY A;  3W96 D;  1P3A A;  3C1B B;  3W98 D;  5CP6 A;  3MGS D;  4R8P A;  4KGC C;  3AV1 A;  4H9N A;  1U35 B;  2ZY3 A;  4X23 A;  4JJN B;  5GXQ B;  4HGA C;  1WWS A;  2Y2P A;  3X1T C;  1JFI B;  1P3P B;  3AFA C;  4J8U D;  1H3O A;  1P3K A;  5BO0 A;  4J8W B;  4Z66 A;  4YM6 D;  4CSR B;  4XUJ D;  3EG5 B;  5JRG B;  5B2J A;  5B0Y B;  1P3I C;  1KX4 A;  2NQB B;  3AZG B;  1KX5 D;  3WKJ C;  5B1M B;  3WTP E;  4YS3 A;  3C1C D;  5CPK D;  3AZE C;  4WJ3 C;  2NZD C;  3TU4 C;  4CAY B;  2DF4 C;  1M1A D;  5B33 C;  3B0C T;  2F2A C;  3LZ1 C;  3AZL C;  4KGC B;  3REL D;  3MGQ A;  5B1L A;  3LJA A;  2G5H C;  2ZY5 A;  1P3O A;  3REH D;  4HGA B;  4G91 C;  3WTP A;  5AV8 D;  3X1T B;  5FUG A;  5GT0 C;  3AFA B;  2ZY2 A;  2UWX A;  5B32 A;  3W97 A;  1P3I B;  2JE5 A;  3UTB A;  3REI D;  3KWQ A;  3IP4 C;  3NQJ B;  3WKJ B;  3H0M C;  5AV5 C;  1P3G A;  3B6G C;  5BT1 D;  1P3P D;  5AVC A;  3W99 C;  3AZE B;  1WWI A;  5CP6 D;  4R8P D;  4ZUX C;  2NZD B;  5B0Y D;  3AV1 D;  1BH8 A;  4G92 C;  3TU4 B;  5B33 B;  4X23 D;  3AZL B;  3LZ1 B;  3A1K A;  3W96 C;  5B1M D;  1HQ3 A;  5GT3 C;  3W98 C;  3MNN A;  1BH9 B;  3MGS C;  3KXB A;  1P3K D;  2HIO A;  2F8N B;  4G91 B;  4Z66 D;  5BNV B;  3MVD A;  5B2J D;  5GT0 B;  1KX4 D;  1M18 A;  2BG1 A;  2Y2H A;  2PYO A;  4H9O A;  4KGC D;  1P3F A;  1F66 A;  5B2I A;  4J8U C;  4WNN A;  4YS3 D;  4YM6 C;  5AV5 B;  1P34 C;  5GT3 A;  3B6G B;  3X1T D;  5DNN A;  3LZ0 A;  5DNM A;  3AZM A;  3W99 B;  2JCH A;  3VH6 T;  4ZUX B;  1P3I D;  4WU8 A;  3C1C C;  4KHA A;  5B1L D;  3LJA D;  3MGQ D;  4G92 B;  5CPK C;  1P3O D;  2Y2Q A;  3AYW C;  3W96 B;  1M1A C;  4Z5T A;  3W98 B;  3MGS B;  1T3U A;  3WAA A;  2F8N H;  3REL C;  2ZM5 A;  3W97 D;  4KUD A;  3REH C;  3UTB D;  3UTA A;  2YFV B;  3EPL A;  5AV8 C;  1P3G D;  4QLC A;  4J8U B;  1W2E A;  5AVC D;  4YM6 B;  2F8N D;  1P34 B;  5KDM A;  3REI C;  2F8N G;  5BT1 C;  3C1C B;  5CPJ A;  4WZS B;  5CPK B;  1P3A C;  5CP6 C;  5BS7 A;  4R8P C;  3AYW B;  3AV1 C;  5AY8 A;  1M1A B;  1P3B A;  3MVD D;  3AZK A;  4X23 C;  5B31 A;  2BYM A;  3REL B;  5GSU A;  3REH B;  1P3F D;  1F66 D;  5B2I D;  1P3K C;  1N1J A;  4XZQ A;  3KFU G;  4Z66 C;  2XD5 A;  5AV8 B;  5B2J C;  1KX4 C;  5GT3 D;  5DNN D;  3LZ0 D;  3AZM D;  5B24 A;  4H9Q A;  4UPK A;  4YS3 C;  3REI B;  4WU8 D;  1Z2C B;  4H9R A;  3B6F A;  2XD1 A;  1P3A B;  4Z5T D;  5CP6 B;  3WAA D;  4R8P B;  3AV1 B;  4H9N B;  3X1U A;  3MGQ C;  5B1L C;  3LJA C;  1P34 D;  4EO5 C;  1P3O C;  4KUD D;  4X23 B;  3UTA D;  3R45 A;  3WTP C;  3AL0 C;  4QLC D;  1H3O B;  3AZJ A;  4CSR A;  5BO0 B;  1P3K B;  5B32 C;  4Z66 B;  3AYW D;  3W97 C;  5B2J B;  1KX4 B;  3UTB C;  3REK A;  3VH5 A;  1AOI A;  3KWQ C;  3WA9 A;  1P3G C;  1ID3 A;  4YS3 B;  5CPJ D;  5AVC C;  3AZF A;  4UUZ A;  3O62 A;  5AY8 D;  3AZK D;  2J8P A;  5B31 D;  5GSU D;  5B31 G;  3MGQ B;  5B1L B;  2YFW A;  2DQN C;  1HQ3 C;  4EO5 B;  3LJA B;  5CPI A;  3MNN C;  1P3O B;  1M19 A;  3KXB C;  1P3M A;  2HIO C;  4XZQ D;  2Y2N A;  3UT9 A;  3WTP B;  3MVD C;  3AV2 A;  5FUG B;  1P3A D;  3V9R A;  1ZLA A;  3AN2 A;  3EPK A;  1M18 C;  3AZI A;  5B32 B;  5AVB A;  2PYO C;  5B24 D;  3KUY A;  3W97 B;  3NQU A;  5G49 A;  1P3F C;  5B2I C;  3UTB B;  1F66 C;  3KWQ B;  5B0Z A;  2W8S A;  3B6F D;  2FFF B;  1P3G B;  2FJ7 A;  3MGR A;  5JA4 A;  5DNN C;  3LZ0 C;  5DNM C;  3AZM C;  5AVC B;  4J8V A;  1KX3 A;  4LD9 A;  4WU8 C;  1BH8 B;  3X1U D;  1EQZ A;  2ZY4 A;  3VH5 W;  1HQ3 B;  2Y2O A;  4Z5T C;  1F1E A;  3MNN B;  3WAA C;  3KXB B;  2BYK A;  5B40 A;  2HIO B;  3AZJ D;  3AZH A;  3A6N A;  3MVD B;  4KUD C;  3REJ A;  3UTA C;  1M18 B;  1AOI D;  2PYO B;  1HTA A;  4H9O B;  3WA9 D;  1P3F B;  1F66 B;  5B2I B;  1ID3 D;  4QLC C;  4WNN B;  2ARO A;  3X1S A;  3AZF D;  4J8X C;  5GT3 B;  3WTP D;  3O62 D;  5DNN B;  3LZ0 B;  5DNM B;  3AZM B;  4Z2M G;  5B32 D;  5B32 G;  4WU8 B;  5CPJ C;  4KHA B;  5CPI D;  4AWL C;  3KWQ D;  5BS7 C;  1M19 D;  5BNX A;  5AY8 C;  4Z5T B;  1P3B C;  3AZK C;  2JSS A;  3WAA B;  3B0C W;  5B31 C;  3AN2 D;  1ZLA D;  3AZI D;  5GSU C;  5AVB D;  4J8X A;  3KUY D;  4KUD B;  3UTA B;  4XZQ C;  1TAF A;  5E5A A;  1BFM A;  1TZY A;  4WV4 B;  1HQ3 D;  4QLC B;  3MGR D;  3X1V A;  2FJ7 D;  3MNN D;  1S32 A;  3VH6 A;  4XUJ A;  5F99 A;  5B24 C;  3KXB D;  4J8V D;  2HIO D;  1KX3 D;  4LD9 D;  1KX5 A;  4DRB A;  5KDM B;  2CV5 A;  3AZN A;  1M18 D;  4DQY B;  1EQZ D;  4WU9 A;  2PYO D;  3B6F C;  1B6W A;  3MGP A;  5CPJ B;  1P3L A;  4H9P A;  5AV6 A;  4AWL B;  5B40 D;  2LY8 A;  3X1U C;  5AY8 B;  5AV9 A;  3A6N D;  3AZK B;  3REJ D;  1Q9C A;  5DNM D;  3LEL A;  5B31 B;  2BYM B;  2CWE A;  5GSU B;  4NE3 A;  3AZJ C;  1N1J B;  2ARO D;  4XZQ B;  3X1S D;  3C1B A;  2NQB C;  3REK C;  1AOI C;  5B24 B;  1U35 A;  4H9Q B;  3WA9 C;  4JJN A;  5GXQ A;  1ID3 C;  3AZF C;  4H9R B;  1JFI A;  3B6F B;  1P3P A;  3O62 C;  1KU5 A;  4J8W A;  3H0L C;  5B0Y A;  2Y2I A;  5JRG A;  2HUE C;  3VH6 W;  2NQB A;  3X1U B;  4J8X D;  3AZG A;  5CPI C;  5B1M A;  1M19 C;  3F6T A;  1P3M C;  3R45 B;  4NE6 A;  3AV2 C;  4H9S A;  3UT9 C;  5E5A D;  1TZY D;  3X1V D;  1ZLA C;  3AN2 C;  3AZJ B;  1S32 D;  3AZI C;  5AVB C;  5F99 D;  3KUY C;  4CAY A;  3P5J B;  3REK B;  1P3B D;  1AOI B;  2CV5 D;  3AZN D;  4KGC A;  5B0Z C;  3WA9 B;  4WU9 D;  3MGP D;  1ID3 B;  3MGR C;  2FJ7 C;  1P3L D;  3AZF B;  4J8V C;  5AV6 D;  4UUZ B;  3X1T A;  1KX3 C;  4LD9 C;  3AFA A;  3O62 B;  5AV9 D;  1EQZ C;  1P3I A;  3LEL D;  2HUE B;  2YFW B;  3NQJ A;  5CPI B;  3WKJ A;  1ULY A;  1M19 B;  2IO5 C;  5B40 C;  1P3M B;  3AZH C;  3A6N C;  3AV2 B;  3UT9 B;  3C1B D;  3AZE A;  3REJ C;  3V9R B;  1ZLA B;  3AN2 B;  2NZD A;  3AZI B;  5AVB B;  3KUY B;  3TU4 A;  1U35 D;  3NQU B;  5G49 B;  5B33 A;  4JJN D;  3AZL A;  2VQR A;  5GXQ D;  3LZ1 A;  2ARO C;  5B0Z B;  3X1S C;  2RVQ D;  1BH9 A;  2FJ7 B;  3MGR B;  5JA4 B;  4J8W D;  2F8N A;  4J8V B;  5BNV A;  1KX3 B;  4LD9 B;  5JRG D;  5GT0 A;  2NQB D;  4Z2M H;  3AZG D;  3REK D;  1EQZ B;  4NFT A;  4E45 A;  5C3I C;  5AV5 A;  2BYK B;  2IO5 B;  5B40 B;  3AZH B;  3B6G A;  4ZBJ C;  3A6N B;  2G5I C;  3W99 A;  3REJ B;  3FDD A;  4ZUX A;  3EPH A;  3B0D C;  5E5A C;  1TZY C;  3X1V C;  1S32 C;  3W96 A;  2ARO B;  4XUJ C;  5F99 C;  3X1S B;  1P3M D;  3W98 A;  3MGS A;  3AV2 D;  3UT9 D;  1KX5 C;  3AFA D;  2CV5 C;  3AZN C;  4M6B A;  4WU9 C;  3H0R C;  3MGP C;  2YFV A;  4DRA A;  3B0B A;  1R4V A;  4E44 A;  1P3L C;  2Y2G A;  5AV6 C;  3WKJ D;  5B0Z D;  2F8N K;  4J8U A;  5BNX B;  5AV9 C;  4YM6 A;  5C3I B;  3AZE D;  2Y2M A;  3LEL C;  1P34 A;  2NZD D;  4ZBJ B;  4J8X B;  3TU4 D;  5B33 D;  3AZL D;  3LZ1 D;  2RIQ A;  3B0D B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...