5GT0D

Crystal structure of nucleosome complex with human testis-specific histone variants, th2a
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
98
structure length
98
Chain Sequence
KRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Structural analyses of the nucleosome complexes with human testis-specific histone variants, hTh2a and hTh2b
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 33
structure length 98
sequence length 98
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5gt0D00
4H9NA 2HIOA 3AZLC 1P3KD 2F8NG 2YFVB 2BYKB 3AYWB 3REIC 4J8WB 3AZIA 1HQ3D 5JRGC 1M18D 4ZUXA 4XZQB 4H9SC 3B6FB 5DNMA 4XUJC 5BT1D 2HUEC 3MVDB 1P3LD 5AY8B 1P3KA 3X1TD 5B1LB 3AN2D 1KX3B 5JA4B 1HQ3A 5GSUC 3MGRD 1M18A 3WAAB 4LD9D 4J8WA 3AZNC 3KWQD 4KGCD 4HGAB 4KHAB 1ID3D 1P3MC 1P3ID 4XZQA 1P3FC 1P3LA 5DNNC 5AV9B 3B6FA 3TU4C 3X1TA 3AN2A 1P3OD 2LY8A 1U35D 3MVDA 1BFMA 5AY8A 5AV5B 3AZHD 5B1LA 3A6NC 1M19C 3MGRA 5B32B 4LD9A 3RELC 5B33B 1F66D 3KWQA 5BNVA 4KGCA 3MGSC 1ZLAB 1ID3A 2HIOC 1BH9A 3UTBD 3MNNB 3KXBD 2F8NK 4H9PB 4KHAA 3AV1B 1P3OA 5F99B 1U35A 3AZJD 4E44A 3AZIC 3AZHA 2AROD 4Z66B 4ZUXC 4NE6A 5AV5A 3AZED 5B32A 4G91C 3AV2B 3UTBA 3KUYB 3KXBA 4YS3D 2AROA 3LZ0D 3X1SD 3AZGB 4J8WC 4YM6D 5B40D 3W97D 4H9OB 1KX4D 5B2ID 4XZQC 1P3LC 3B6FC 4Z5TB 5AV6B 3AN2C 3VH5T 3MVDC 5AY8C 5B1LC 3REID 1KX5B 2F8ND 1KX3C 4LD9C 1TZYB 3X1SA 5JRGD 4YM6A 3KWQC 3WAAC 5B40A 3W97A 3AZGA 4WU9D 1KX4A 4XUJD 5B2IA 4J8UB 2RVQC 1P3OC 4H9OA 1U35C 1BH8B 2FJ7B 5AV9C 4J8XD 3AZHC 3REIA 5B32G 4WU8D 4ZBJB 2NZDB 3W99B 5GSUD 4WNNB 5AV5C 4NE3A 1KX5A 3AZND 1ULYA 4H9SA 5B32C 5CPKB 5B33C 3W96B 4WU9A 5B0ZB 1P3FD 5DNND 1ZLAC 3TU4D 5B0YB 1B6WA 1P3BB 4J8XA 3MNNC 3AV1C 5F99C 4WU8A 3A6ND 1M19D 3RELD 4Z2MG 3AZNA 3W99A 3MGSD 2HIOD 3REHD 3AFAB 5DNNA 5G49B 3TU4A 5AV8B 5B31G 3X1SC 5B0YA 3A6NA 4ZUXD 4YM6C 4WV4B 3RELA 5B40C 3AZGC 5CPJB 3R45B 4CAYA 3NQJA 3X1UB 3MGPB 1S32B 3REHA 2PYOB 4AWLB 4Z5TC 3X1VB 5E5AB 5AV6C 4DRBA 5AVBB 3AYWD 4J8VB 1KX5C 4J8WD 5AV8A 1TZYC 3C1CB 4WU9C 4XZQD 3B6FD 3AZKB 4J8UC 4KUDB 3X1UA 4J8XC 3MVDD 5AY8D 1S32A 5B1LD 4WU8C 2FJ7C 3C1BB 2YFVA 1KX3D 2BYKA 3AYWA 5E5AA 4ZBJC 2NZDC 3W99C 4G92B 3WAAD 3WTPB 3AZMB 5CPKC 3W96C 2RVQD 5B0ZC 5KDMB 4UUZB 5GT3B 5AV9D 5B0YC 2CV5B 3AZKA 3REJB 1KX3A 5JA4A 5AV5D 3B6GB 3C1BA 3WAAA 5B32D 5GXQB 4QLCB 5B33D 3REHC 3LZ1B 3LELB 1ZLAD 3AZMA 5BS7A 3AFAC 5AV9A 3MNND 3AV1D 1P34B 5F99D 5AV8C 4UUZA 2CV5A 2BYMB 4Z66D 1AOIB 5B33A 5CPJC 5B1MB 4X23B 3X1UC 3MGPC 3AV2D 1ZLAA 1S32C 4JJNB 3LJAB 3KUYD 1P3PB 4AWLC 3MNNA 4H9PA 5B31B 3X1VC 1KU5A 5E5AC 3AYWC 5F99A 3AV1A 1P3AB 5B2JB 5CHLB 5AVBC 5B31D 4Z66A 4J8VC 3AZGD 1M1AB 3NQUB 1P3GB 3UTAB 1R4VA 1AOIA 3WKJB 3AV2A 4Z5TD 5AV6D 5B1MA 4X23A 3KUYA 3AZKC 4KUDC 2IO5B 4H9QB 4EO5B 1TAFB 1WWIA 3LJAA 1KX5D 1P3PA 3C1BC 4R8PB 5B31A 1TZYD 1P3AA 2F8NH 5B2JA 4G92C 4HGAC 3WTPC 3W98B 3AZMC 4J8UD 5BS7C 2NQBB 3AZLB 1JFIB 3NQUA 4Z5TA 5AV6A 3MGQB 3UTAA 2FJ7D 5GT3C 3WKJA 2CV5C 5B24B 3REJC 2NZDD 3W99D 1TZYA 5CPIB 4M6BA 1N1JB 1B67A 1Q9CA 1HTAA 4QLCC 5CPKD 3W96D 5B0ZD 3O62B 3LZ1C 4J8UA 3LELC 3AZFB 3W98A 5B0YD 1BH8A 2FJ7A 2NQBA 1P3BD 5CP6B 5BNXB 1JFIA 4Z66C 3REKB 1P34C 2NZDA 5GT0B 4WNNA 5B24A 5FUGB 1AOIC 3AV2C 5CPKA 3W96A 1P3MB 3VH6T 5B0ZA 5B1MC 4X23C 3KUYC 3AFAD 3KSYA 3V9RB 4JJNC 3WA9B 3O62A 3LJAC 1P3BA 1P3PC 5AV8D 5B31C 3AZFA 3B0CW 3UT9B 1P3AC 3B0DB 5B2JC 5CP6A 5CPJD 4H9NB 3X1UD 1M1AC 1P3GC 3MGPD 1S32D 3UTAC 2PYOD 3AFAA 3WKJC 5G49A 3X1VD 1EQZB 5E5AD 3AZIB 2IO5C 4EO5C 5AVCB 5AVBD 2JSSA 4J8VD 3VH5A 4R8PC 5DNMB 5CPJA 3UT9A 3R45A 3C1CD 1P3KB 3MGPA 3W98C 2PYOA 3AZKD 4KUDD 2NQBC 3X1VA 3MGQC 1HQ3B 1M18B 3C1BD 5AVBA 1EQZA 5B24C 4J8VA 1F1EA 1WWSA 5CPIC 5AVCA 3WTPD 3C1CA 1P3LB 3AZMD 3X1TB 3AN2B 3O62C 4KUDA 1P3BC 5GT3D 3AZFC 2CV5D 3MGRB 4LD9B 3REJD 5CP6C 4NFTA 3REKC 1H3OB 5BNVB 3KWQB 3B6GD 4KGCB 5GT0C 1ID3B 1BH9B 4NE5A 5GXQD 4QLCD 3WTPA 1P3IB 3LZ1D 3LELD 1P3OB 1U35B 4CSRB 5KDMA 3AZHB 5GT3A 4DRAA 1P34D 3WA9C 3REJA 3VH6A 1F66B 3UT9C 3B6GA 3B0DC 4WZSB 1AOID 5GXQA 4QLCA 3UTBB 1H3OA 5B1MD 4X23D 3KXBB 3LZ1A 3LELA 2PYOC 1P3IA 3AZJB 4JJND 4Z2MH 3LJAD 2AROB 1P3PD 2L5AA 1P34A 1EQZC 4CSRA 5C3IB 1P3AD 5B2JD 5AVCC 3AZEB 2BYMA 2CWEA 3C1CC 3B0BA 1F66A 1M1AD 5DNMC 1P3GD 3UTAD 4YS3B 1P3KC 3WKJD 4JJNA 3LZ0B 3X1SB 3AZJA 4YM6B 1HQ3C 1M18C 5B40B 3W97B 4R8PD 1KX4B 5B2IB 1M1AA 3WTPE 3AZEA 1P3GA 5BT1C 3W98D 2NQBD 3X1TC 3REIB 3AZLD 2F8NB 3MGQD 5JRGB 4YS3A 3VH5W 4H9QA 1TAFA 5B24D 3LZ0A 3MGRC 3B6GC 4R8PA 4WU9B 5GXQC 4XUJB 5CPID 4KGCC 2HUEB 1ID3C 1P3IC 3O62D 4J8XB 3AZLA 4WU8B 3MGQA 3AZFD 5GSUB 2YFWB 5CP6D 3AZNB 2F8NA 3REKD 5JRGA 5GT0D 1F66C 5CPIA 1N1JA 1P3FB 5DNNB 3TU4B 4XUJA 3UTBC 1P3MD 3KXBC 3B0CT 3A6NB 3AZJC 1M19B 3WA9D 2AROC 4H9RB 3RELB 5BNXA 3REKA 4CAYB 3NQJB 5C3IC 5GSUA 1A7WA 3UT9D 5BO0B 5GT0A 3MGSB 2YFWA 2HIOB 3REHB 3AZEC 5FUGA 4E45A 1P3MA 1P3FA 4YS3C 4ZUXB 3V9RA 3VH6W 1EQZD 3AZID 3LZ0C 3WA9A 5AVCD 1M19A 4G91B 4H9RA 3W97C 1KX4C 5DNMD 5B2IC 3MGSA 5BO0A
chains in the Genus database with same CATH superfamily
4H9NA 2Y2QA 2HIOA 3AZLC 1P3KD 2F8NG 2YFVB 2BYKB 2XD5A 3EPJA 3REIC 3AYWB 3EPHA 4J8WB 3AZIA 1HQ3D 5JRGC 1M18D 4ZUXA 4XZQB 4H9SC 3B6FB 2JCHA 5DNMA 4XUJC 5BT1D 2HUEC 3MVDB 1P3LD 5AY8B 1P3KA 3X1TD 5B1LB 3AN2D 2Y2JA 1KX3B 5JA4B 1HQ3A 5GSUC 3MGRD 1M18A 3WAAB 4LD9D 4J8WA 3AZNC 3KWQD 4KGCD 4HGAB 4KHAB 1ID3D 1P3MC 1P3ID 4XZQA 1P3FC 1P3LA 5DNNC 5AV9B 3B6FA 3TU4C 3X1TA 3AN2A 1P3OD 2LY8A 1U35D 3MVDA 1BFMA 5AY8A 5AV5B 3AZHD 5B1LA 3A6NC 1M19C 3MGRA 5B32B 4LD9A 3RELC 5B33B 1F66D 3KWQA 5BNVA 4KGCA 3MGSC 2ZY3A 1ZLAB 1ID3A 2HIOC 1BH9A 3UTBD 3MNNB 3KXBD 2F8NK 4H9PB 4KHAA 3AV1B 1P3OA 5F99B 1U35A 3AZJD 4E44A 3AZIC 3AZHA 2AROD 4Z66B 4ZUXC 4NE6A 5AV5A 3AZED 5B32A 4G91C 3AV2B 3UTBA 3KUYB 2FFFB 3KXBA 3A1IA 4YS3D 2AROA 3LZ0D 3X1SD 3AZGB 4J8WC 4YM6D 5B40D 3W97D 4H9OB 1KX4D 5B2ID 4XZQC 1P3LC 3B6FC 4Z5TB 5AV6B 3AN2C 3VH5T 3MVDC 5AY8C 5B1LC 3REID 1KX5B 2F8ND 1Z2CB 1KX3C 4LD9C 1TZYB 3X1SA 5JRGD 4YM6A 3KWQC 3WAAC 5B40A 2Y2GA 3W97A 3AZGA 4WU9D 1KX4A 4XUJD 5B2IA 4J8UB 2RVQC 1P3OC 4H9OA 1U35C 1BH8B 2Y2OA 2FJ7B 2Y2PA 5AV9C 4J8XD 3AZHC 3REIA 5B32G 4WU8D 4ZBJB 2NZDB 3W99B 5GSUD 4WNNB 5AV5C 4NE3A 1KX5A 3AZND 1ULYA 4H9SA 5B32C 3AL0C 5CPKB 5B33C 3W96B 4WU9A 5B0ZB 1P3FD 2XD1A 5DNND 1ZLAC 3TU4D 5B0YB 1B6WA 1P3BB 4J8XA 3MNNC 3AV1C 5F99C 4WU8A 3A6ND 1M19D 3RELD 4Z2MG 3AZNA 3W99A 3MGSD 2HIOD 3REHD 3AFAB 5DNNA 5G49B 3TU4A 5AV8B 5B31G 3X1SC 5B0YA 3A6NA 4ZUXD 2Y2KA 4YM6C 4WV4B 3RELA 5B40C 3AZGC 5CPJB 3R45B 4CAYA 3NQJA 3X1UB 3MGPB 1S32B 1T3UA 3REHA 2PYOB 4AWLB 4Z5TC 3X1VB 5E5AB 5AV6C 4DRBA 5AVBB 3AYWD 4J8VB 1KX5C 4J8WD 3IP4C 5AV8A 1TZYC 3C1CB 4WU9C 4XZQD 3H0LC 3B6FD 4WJ3C 3H0RC 4J8UC 3AZKB 4KUDB 3X1UA 4J8XC 3MVDD 5AY8D 1S32A 5B1LD 4WU8C 2FJ7C 3C1BB 2YFVA 1KX3D 2BYKA 3AYWA 5E5AA 4ZBJC 2NZDC 3W99C 4G92B 3WAAD 3WTPB 3AZMB 5CPKC 3W96C 3EG5B 2RVQD 5B0ZC 3F6TA 2Y2NA 5KDMB 4UUZB 5GT3B 5AV9D 5B0YC 2CV5B 3AZKA 3REJB 1KX3A 5JA4A 5AV5D 3B6GB 3C1BA 3WAAA 5B32D 5GXQB 4QLCB 5B33D 3REHC 3LZ1B 3LELB 1ZLAD 2F2AC 2DF4C 3AZMA 5BS7A 3AFAC 5AV9A 3MNND 3AV1D 1P34B 5F99D 2Y2IA 5AV8C 4UUZA 2BG1A 2BYMB 4Z66D 2CV5A 1AOIB 2Y2HA 5B33A 1PZRA 5CPJC 5B1MB 4X23B 3X1UC 3MGPC 3AV2D 1ZLAA 1S32C 4JJNB 3LJAB 2UWXA 3KUYD 1P3PB 4AWLC 3MNNA 4H9PA 5B31B 3X1VC 1KU5A 5E5AC 3AYWC 5F99A 3AV1A 1P3AB 5B2JB 2Y2MA 5CHLB 5AVBC 5B31D 4Z66A 4J8VC 3AZGD 1M1AB 3NQUB 1P3GB 3UTAB 1R4VA 1AOIA 3WKJB 3AV2A 4Z5TD 5AV6D 5B1MA 3A1KA 4X23A 3KUYA 3AZKC 4KUDC 2IO5B 4H9QB 4EO5B 1TAFB 1WWIA 3LJAA 1KX5D 1P3PA 3C1BC 3EPKA 4R8PB 5B31A 1TZYD 1P3AA 2F8NH 5B2JA 4G92C 4HGAC 3WTPC 3W98B 3AZMC 4J8UD 5BS7C 2NQBB 2VQRA 2ZY4A 3AZLB 3NQUA 4Z5TA 1JFIB 5AV6A 3MGQB 3UTAA 3H0MC 2FJ7D 5GT3C 3WKJA 2W8SA 2CV5C 5B24B 3REJC 2NZDD 3W99D 1TZYA 5CPIB 4M6BA 1N1JB 1B67A 1Q9CA 1HTAA 4QLCC 5CPKD 3W96D 5B0ZD 3O62B 3LZ1C 4J8UA 3LELC 3AZFB 3W98A 5B0YD 1BH8A 2FJ7A 2NQBA 1P3BD 5CP6B 5BNXB 1JFIA 2G5HC 4Z66C 3REKB 1P34C 2NZDA 5GT0B 4WNNA 5B24A 5FUGB 1AOIC 3AV2C 5CPKA 3W96A 1P3MB 3VH6T 5B0ZA 5B1MC 4X23C 3KUYC 3AFAD 2RIQA 3KSYA 3V9RB 4JJNC 3WA9B 3O62A 3LJAC 1P3BA 1P3PC 5AV8D 5B31C 3AZFA 3B0CW 3UT9B 1P3AC 3B0DB 5B2JC 5CP6A 5CPJD 4H9NB 3KFUG 3X1UD 1M1AC 1P3GC 3MGPD 1S32D 3UTAC 2PYOD 3AFAA 3WKJC 5G49A 3X1VD 1EQZB 5E5AD 3AZIB 2IO5C 4EO5C 5AVCB 5AVBD 2JSSA 4J8VD 3VH5A 4R8PC 5DNMB 5CPJA 3UT9A 3R45A 3C1CD 1P3KB 3MGPA 3W98C 3P5JB 2PYOA 3AZKD 4KUDD 2NQBC 2ZY2A 3X1VA 3MGQC 1HQ3B 1M18B 3C1BD 5AVBA 1EQZA 5B24C 4J8VA 3FDDA 1F1EA 1WWSA 5AVCA 5CPIC 3WTPD 3C1CA 1P3LB 3AZMD 3X1TB 3AN2B 3O62C 4UPKA 4KUDA 1P3BC 5GT3D 3AZFC 2CV5D 3MGRB 4LD9B 3REJD 5CP6C 4NFTA 3REKC 1H3OB 5BNVB 3KWQB 3B6GD 4KGCB 5GT0C 1ID3B 1BH9B 4NE5A 5GXQD 4QLCD 3WTPA 2DQNC 1P3IB 3LZ1D 3LELD 1P3OB 1U35B 4CSRB 5KDMA 3AZHB 5GT3A 4DRAA 1P34D 3WA9C 3REJA 3VH6A 1F66B 3UT9C 3B6GA 3B0DC 4WZSB 1AOID 5GXQA 4QLCA 3UTBB 1H3OA 5B1MD 4X23D 3KXBB 3LZ1A 3LELA 2PYOC 1P3IA 3AZJB 4JJND 4Z2MH 3LJAD 2AROB 1P3PD 2L5AA 1P34A 1EQZC 4CSRA 5C3IB 1P3AD 5B2JD 5AVCC 3AZEB 2BYMA 2CWEA 3C1CC 3B0BA 2J8PA 1F66A 1M1AD 5DNMC 1P3GD 3UTAD 4YS3B 1P3KC 3WKJD 4JJNA 3LZ0B 3X1SB 1W2EA 3AZJA 4YM6B 1HQ3C 1M18C 5B40B 3W97B 4R8PD 2Y2LA 1KX4B 5B2IB 4DQYB 1M1AA 3WTPE 3AZEA 1P3GA 5BT1C 3W98D 2NQBD 3X1TC 3REIB 3AZLD 2F8NB 3MGQD 5JRGB 4YS3A 3VH5W 4H9QA 2ZM5A 1TAFA 5B24D 3LZ0A 3MGRC 3B6GC 4R8PA 4WU9B 5GXQC 4XUJB 5CPID 4KGCC 2HUEB 1ID3C 1P3IC 3O62D 4J8XB 3AZLA 4WU8B 3MGQA 3AZFD 5GSUB 2YFWB 5CP6D 3AZNB 2F8NA 3REKD 5JRGA 5GT0D 2JE5A 1F66C 5CPIA 1N1JA 1P3FB 5DNNB 3TU4B 4XUJA 2G5IC 3UTBC 1P3MD 3KXBC 3B0CT 3A6NB 3EPLA 3AZJC 1M19B 3WA9D 2AROC 4H9RB 3RELB 5BNXA 3REKA 4CAYB 3NQJB 5C3IC 5GSUA 1A7WA 3UT9D 5BO0B 5GT0A 3MGSB 2YFWA 2HIOB 3REHB 3AZEC 5FUGA 4E45A 1P3MA 1P3FA 4YS3C 4ZUXB 3V9RA 3VH6W 1EQZD 3AZID 3LZ0C 3WA9A 5AVCD 1M19A 4G91B 4H9RA 3W97C 1KX4C 5DNMD 5B2IC 3MGSA 5BO0A 2ZY5A
chains in the Genus database with same CATH topology
4H9NA 2Y2QA 2HIOA 3AZLC 1P3KD 2F8NG 2YFVB 2BYKB 2XD5A 3EPJA 3REIC 3AYWB 3EPHA 4J8WB 3AZIA 1HQ3D 5JRGC 1M18D 4ZUXA 4XZQB 4H9SC 3B6FB 2JCHA 5DNMA 4XUJC 5BT1D 2HUEC 3MVDB 1P3LD 5AY8B 1P3KA 3X1TD 5B1LB 3AN2D 2Y2JA 1KX3B 5JA4B 1HQ3A 5GSUC 3MGRD 1M18A 3WAAB 4LD9D 4J8WA 3AZNC 3KWQD 4KGCD 4HGAB 4KHAB 1ID3D 1P3MC 1P3ID 4XZQA 1P3FC 1P3LA 5DNNC 5AV9B 3B6FA 3TU4C 3X1TA 3AN2A 1P3OD 2LY8A 1U35D 3MVDA 1BFMA 5AY8A 5AV5B 3AZHD 5B1LA 3A6NC 1M19C 3MGRA 5B32B 4LD9A 3RELC 5B33B 1F66D 3KWQA 5BNVA 4KGCA 3MGSC 2ZY3A 1ZLAB 1ID3A 2HIOC 1BH9A 3UTBD 3MNNB 3KXBD 2F8NK 4H9PB 4KHAA 3AV1B 1P3OA 5F99B 1U35A 3AZJD 4E44A 3AZIC 3AZHA 2AROD 4Z66B 4ZUXC 4NE6A 5AV5A 3AZED 5B32A 4G91C 3AV2B 3UTBA 3KUYB 2FFFB 3KXBA 3A1IA 4YS3D 2AROA 3LZ0D 3X1SD 3AZGB 4J8WC 4YM6D 5B40D 3W97D 4H9OB 1KX4D 5B2ID 4XZQC 1P3LC 3B6FC 4Z5TB 5AV6B 3AN2C 3VH5T 3MVDC 5AY8C 5B1LC 3REID 1KX5B 2F8ND 1Z2CB 1KX3C 4LD9C 1TZYB 3X1SA 5JRGD 4YM6A 3KWQC 3WAAC 5B40A 2Y2GA 3W97A 3AZGA 4WU9D 1KX4A 4XUJD 5B2IA 4J8UB 2RVQC 1P3OC 4H9OA 1U35C 1BH8B 2Y2OA 2FJ7B 2Y2PA 5AV9C 4J8XD 3AZHC 3REIA 5B32G 4WU8D 4ZBJB 2NZDB 3W99B 5GSUD 4WNNB 5AV5C 4NE3A 1KX5A 3AZND 1ULYA 4H9SA 5B32C 3AL0C 5CPKB 5B33C 3W96B 4WU9A 5B0ZB 1P3FD 2XD1A 5DNND 1ZLAC 3TU4D 5B0YB 1B6WA 1P3BB 4J8XA 3MNNC 3AV1C 5F99C 4WU8A 3A6ND 1M19D 3RELD 4Z2MG 3AZNA 3W99A 3MGSD 2HIOD 3REHD 3AFAB 5DNNA 5G49B 3TU4A 5AV8B 5B31G 3X1SC 5B0YA 3A6NA 4ZUXD 2Y2KA 4YM6C 4WV4B 3RELA 5B40C 3AZGC 5CPJB 3R45B 4CAYA 3NQJA 3X1UB 3MGPB 1S32B 1T3UA 3REHA 2PYOB 4AWLB 4Z5TC 3X1VB 5E5AB 5AV6C 4DRBA 5AVBB 3AYWD 4J8VB 1KX5C 4J8WD 3IP4C 5AV8A 1TZYC 3C1CB 4WU9C 4XZQD 3H0LC 3B6FD 4WJ3C 3H0RC 4J8UC 3AZKB 4KUDB 3X1UA 4J8XC 3MVDD 5AY8D 1S32A 5B1LD 4WU8C 2FJ7C 3C1BB 2YFVA 1KX3D 2BYKA 3AYWA 5E5AA 4ZBJC 2NZDC 3W99C 4G92B 3WAAD 3WTPB 3AZMB 5CPKC 3W96C 3EG5B 2RVQD 5B0ZC 3F6TA 2Y2NA 5KDMB 4UUZB 5GT3B 5AV9D 5B0YC 2CV5B 3AZKA 3REJB 1KX3A 5JA4A 5AV5D 3B6GB 3C1BA 3WAAA 5B32D 5GXQB 4QLCB 5B33D 3REHC 3LZ1B 3LELB 1ZLAD 2F2AC 2DF4C 3AZMA 5BS7A 3AFAC 5AV9A 3MNND 3AV1D 1P34B 5F99D 2Y2IA 5AV8C 4UUZA 2BG1A 2BYMB 4Z66D 2CV5A 1AOIB 2Y2HA 5B33A 1PZRA 5CPJC 5B1MB 4X23B 3X1UC 3MGPC 3AV2D 1ZLAA 1S32C 4JJNB 3LJAB 2UWXA 3KUYD 1P3PB 4AWLC 3MNNA 4H9PA 5B31B 3X1VC 1KU5A 5E5AC 3AYWC 5F99A 3AV1A 1P3AB 5B2JB 2Y2MA 5CHLB 5AVBC 5B31D 4Z66A 4J8VC 3AZGD 1M1AB 3NQUB 1P3GB 3UTAB 1R4VA 1AOIA 3WKJB 3AV2A 4Z5TD 5AV6D 5B1MA 3A1KA 4X23A 3KUYA 3AZKC 4KUDC 2IO5B 4H9QB 4EO5B 1TAFB 1WWIA 3LJAA 1KX5D 1P3PA 3C1BC 3EPKA 4R8PB 5B31A 1TZYD 1P3AA 2F8NH 5B2JA 4G92C 4HGAC 3WTPC 3W98B 3AZMC 4J8UD 5BS7C 2NQBB 2VQRA 2ZY4A 3AZLB 3NQUA 4Z5TA 1JFIB 5AV6A 3MGQB 3UTAA 3H0MC 2FJ7D 5GT3C 3WKJA 2W8SA 2CV5C 5B24B 3REJC 2NZDD 3W99D 1TZYA 5CPIB 4M6BA 1N1JB 1B67A 1Q9CA 1HTAA 4QLCC 5CPKD 3W96D 5B0ZD 3O62B 3LZ1C 4J8UA 3LELC 3AZFB 3W98A 5B0YD 1BH8A 2FJ7A 2NQBA 1P3BD 5CP6B 5BNXB 1JFIA 2G5HC 4Z66C 3REKB 1P34C 2NZDA 5GT0B 4WNNA 5B24A 5FUGB 1AOIC 3AV2C 5CPKA 3W96A 1P3MB 3VH6T 5B0ZA 5B1MC 4X23C 3KUYC 3AFAD 2RIQA 3KSYA 3V9RB 4JJNC 3WA9B 3O62A 3LJAC 1P3BA 1P3PC 5AV8D 5B31C 3AZFA 3B0CW 3UT9B 1P3AC 3B0DB 5B2JC 5CP6A 5CPJD 4H9NB 3KFUG 3X1UD 1M1AC 1P3GC 3MGPD 1S32D 3UTAC 2PYOD 3AFAA 3WKJC 5G49A 3X1VD 1EQZB 5E5AD 3AZIB 2IO5C 4EO5C 5AVCB 5AVBD 2JSSA 4J8VD 3VH5A 4R8PC 5DNMB 5CPJA 3UT9A 3R45A 3C1CD 1P3KB 3MGPA 3W98C 3P5JB 2PYOA 3AZKD 4KUDD 2NQBC 2ZY2A 3X1VA 3MGQC 1HQ3B 1M18B 3C1BD 5AVBA 1EQZA 5B24C 4J8VA 3FDDA 1F1EA 1WWSA 5AVCA 5CPIC 3WTPD 3C1CA 1P3LB 3AZMD 3X1TB 3AN2B 3O62C 4UPKA 4KUDA 1P3BC 5GT3D 3AZFC 2CV5D 3MGRB 4LD9B 3REJD 5CP6C 4NFTA 3REKC 1H3OB 5BNVB 3KWQB 3B6GD 4KGCB 5GT0C 1ID3B 1BH9B 4NE5A 5GXQD 4QLCD 3WTPA 2DQNC 1P3IB 3LZ1D 3LELD 1P3OB 1U35B 4CSRB 5KDMA 3AZHB 5GT3A 4DRAA 1P34D 3WA9C 3REJA 3VH6A 1F66B 3UT9C 3B6GA 3B0DC 4WZSB 1AOID 5GXQA 4QLCA 3UTBB 1H3OA 5B1MD 4X23D 3KXBB 3LZ1A 3LELA 2PYOC 1P3IA 3AZJB 4JJND 4Z2MH 3LJAD 2AROB 1P3PD 2L5AA 1P34A 1EQZC 4CSRA 5C3IB 1P3AD 5B2JD 5AVCC 3AZEB 2BYMA 2CWEA 3C1CC 3B0BA 2J8PA 1F66A 1M1AD 5DNMC 1P3GD 3UTAD 4YS3B 1P3KC 3WKJD 4JJNA 3LZ0B 3X1SB 1W2EA 3AZJA 4YM6B 1HQ3C 1M18C 5B40B 3W97B 4R8PD 2Y2LA 1KX4B 5B2IB 4DQYB 1M1AA 3WTPE 3AZEA 1P3GA 5BT1C 3W98D 2NQBD 3X1TC 3REIB 3AZLD 2F8NB 3MGQD 5JRGB 4YS3A 3VH5W 4H9QA 2ZM5A 1TAFA 5B24D 3LZ0A 3MGRC 3B6GC 4R8PA 4WU9B 5GXQC 4XUJB 5CPID 4KGCC 2HUEB 1ID3C 1P3IC 3O62D 4J8XB 3AZLA 4WU8B 3MGQA 3AZFD 5GSUB 2YFWB 5CP6D 3AZNB 2F8NA 3REKD 5JRGA 5GT0D 2JE5A 1F66C 5CPIA 1N1JA 1P3FB 5DNNB 3TU4B 4XUJA 2G5IC 3UTBC 1P3MD 3KXBC 3B0CT 3A6NB 3EPLA 3AZJC 1M19B 3WA9D 2AROC 4H9RB 3RELB 5BNXA 3REKA 4CAYB 3NQJB 5C3IC 5GSUA 1A7WA 3UT9D 5BO0B 5GT0A 3MGSB 2YFWA 2HIOB 3REHB 3AZEC 5FUGA 4E45A 1P3MA 1P3FA 4YS3C 4ZUXB 3V9RA 3VH6W 1EQZD 3AZID 3LZ0C 3WA9A 5AVCD 1M19A 4G91B 4H9RA 3W97C 1KX4C 5DNMD 5B2IC 3MGSA 5BO0A 2ZY5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H9N A;  2HIO A;  3AZL C;  1P3K D;  2F8N G;  2YFV B;  2BYK B;  3AYW B;  3REI C;  4J8W B;  3AZI A;  1HQ3 D;  5JRG C;  1M18 D;  4ZUX A;  4XZQ B;  4H9S C;  3B6F B;  5DNM A;  4XUJ C;  5BT1 D;  2HUE C;  3MVD B;  1P3L D;  5AY8 B;  1P3K A;  3X1T D;  5B1L B;  3AN2 D;  1KX3 B;  5JA4 B;  1HQ3 A;  5GSU C;  3MGR D;  1M18 A;  3WAA B;  4LD9 D;  4J8W A;  3AZN C;  3KWQ D;  4KGC D;  4HGA B;  4KHA B;  1ID3 D;  1P3M C;  1P3I D;  4XZQ A;  1P3F C;  1P3L A;  5DNN C;  5AV9 B;  3B6F A;  3TU4 C;  3X1T A;  3AN2 A;  1P3O D;  2LY8 A;  1U35 D;  3MVD A;  1BFM A;  5AY8 A;  5AV5 B;  3AZH D;  5B1L A;  3A6N C;  1M19 C;  3MGR A;  5B32 B;  4LD9 A;  3REL C;  5B33 B;  1F66 D;  3KWQ A;  5BNV A;  4KGC A;  3MGS C;  1ZLA B;  1ID3 A;  2HIO C;  1BH9 A;  3UTB D;  3MNN B;  3KXB D;  2F8N K;  4H9P B;  4KHA A;  3AV1 B;  1P3O A;  5F99 B;  1U35 A;  3AZJ D;  4E44 A;  3AZI C;  3AZH A;  2ARO D;  4Z66 B;  4ZUX C;  4NE6 A;  5AV5 A;  3AZE D;  5B32 A;  4G91 C;  3AV2 B;  3UTB A;  3KUY B;  3KXB A;  4YS3 D;  2ARO A;  3LZ0 D;  3X1S D;  3AZG B;  4J8W C;  4YM6 D;  5B40 D;  3W97 D;  4H9O B;  1KX4 D;  5B2I D;  4XZQ C;  1P3L C;  3B6F C;  4Z5T B;  5AV6 B;  3AN2 C;  3VH5 T;  3MVD C;  5AY8 C;  5B1L C;  3REI D;  1KX5 B;  2F8N D;  1KX3 C;  4LD9 C;  1TZY B;  3X1S A;  5JRG D;  4YM6 A;  3KWQ C;  3WAA C;  5B40 A;  3W97 A;  3AZG A;  4WU9 D;  1KX4 A;  4XUJ D;  5B2I A;  4J8U B;  2RVQ C;  1P3O C;  4H9O A;  1U35 C;  1BH8 B;  2FJ7 B;  5AV9 C;  4J8X D;  3AZH C;  3REI A;  5B32 G;  4WU8 D;  4ZBJ B;  2NZD B;  3W99 B;  5GSU D;  4WNN B;  5AV5 C;  4NE3 A;  1KX5 A;  3AZN D;  1ULY A;  4H9S A;  5B32 C;  5CPK B;  5B33 C;  3W96 B;  4WU9 A;  5B0Z B;  1P3F D;  5DNN D;  1ZLA C;  3TU4 D;  5B0Y B;  1B6W A;  1P3B B;  4J8X A;  3MNN C;  3AV1 C;  5F99 C;  4WU8 A;  3A6N D;  1M19 D;  3REL D;  4Z2M G;  3AZN A;  3W99 A;  3MGS D;  2HIO D;  3REH D;  3AFA B;  5DNN A;  5G49 B;  3TU4 A;  5AV8 B;  5B31 G;  3X1S C;  5B0Y A;  3A6N A;  4ZUX D;  4YM6 C;  4WV4 B;  3REL A;  5B40 C;  3AZG C;  5CPJ B;  3R45 B;  4CAY A;  3NQJ A;  3X1U B;  3MGP B;  1S32 B;  3REH A;  2PYO B;  4AWL B;  4Z5T C;  3X1V B;  5E5A B;  5AV6 C;  4DRB A;  5AVB B;  3AYW D;  4J8V B;  1KX5 C;  4J8W D;  5AV8 A;  1TZY C;  3C1C B;  4WU9 C;  4XZQ D;  3B6F D;  3AZK B;  4J8U C;  4KUD B;  3X1U A;  4J8X C;  3MVD D;  5AY8 D;  1S32 A;  5B1L D;  4WU8 C;  2FJ7 C;  3C1B B;  2YFV A;  1KX3 D;  2BYK A;  3AYW A;  5E5A A;  4ZBJ C;  2NZD C;  3W99 C;  4G92 B;  3WAA D;  3WTP B;  3AZM B;  5CPK C;  3W96 C;  2RVQ D;  5B0Z C;  5KDM B;  4UUZ B;  5GT3 B;  5AV9 D;  5B0Y C;  2CV5 B;  3AZK A;  3REJ B;  1KX3 A;  5JA4 A;  5AV5 D;  3B6G B;  3C1B A;  3WAA A;  5B32 D;  5GXQ B;  4QLC B;  5B33 D;  3REH C;  3LZ1 B;  3LEL B;  1ZLA D;  3AZM A;  5BS7 A;  3AFA C;  5AV9 A;  3MNN D;  3AV1 D;  1P34 B;  5F99 D;  5AV8 C;  4UUZ A;  2CV5 A;  2BYM B;  4Z66 D;  1AOI B;  5B33 A;  5CPJ C;  5B1M B;  4X23 B;  3X1U C;  3MGP C;  3AV2 D;  1ZLA A;  1S32 C;  4JJN B;  3LJA B;  3KUY D;  1P3P B;  4AWL C;  3MNN A;  4H9P A;  5B31 B;  3X1V C;  1KU5 A;  5E5A C;  3AYW C;  5F99 A;  3AV1 A;  1P3A B;  5B2J B;  5CHL B;  5AVB C;  5B31 D;  4Z66 A;  4J8V C;  3AZG D;  1M1A B;  3NQU B;  1P3G B;  3UTA B;  1R4V A;  1AOI A;  3WKJ B;  3AV2 A;  4Z5T D;  5AV6 D;  5B1M A;  4X23 A;  3KUY A;  3AZK C;  4KUD C;  2IO5 B;  4H9Q B;  4EO5 B;  1TAF B;  1WWI A;  3LJA A;  1KX5 D;  1P3P A;  3C1B C;  4R8P B;  5B31 A;  1TZY D;  1P3A A;  2F8N H;  5B2J A;  4G92 C;  4HGA C;  3WTP C;  3W98 B;  3AZM C;  4J8U D;  5BS7 C;  2NQB B;  3AZL B;  1JFI B;  3NQU A;  4Z5T A;  5AV6 A;  3MGQ B;  3UTA A;  2FJ7 D;  5GT3 C;  3WKJ A;  2CV5 C;  5B24 B;  3REJ C;  2NZD D;  3W99 D;  1TZY A;  5CPI B;  4M6B A;  1N1J B;  1B67 A;  1Q9C A;  1HTA A;  4QLC C;  5CPK D;  3W96 D;  5B0Z D;  3O62 B;  3LZ1 C;  4J8U A;  3LEL C;  3AZF B;  3W98 A;  5B0Y D;  1BH8 A;  2FJ7 A;  2NQB A;  1P3B D;  5CP6 B;  5BNX B;  1JFI A;  4Z66 C;  3REK B;  1P34 C;  2NZD A;  5GT0 B;  4WNN A;  5B24 A;  5FUG B;  1AOI C;  3AV2 C;  5CPK A;  3W96 A;  1P3M B;  3VH6 T;  5B0Z A;  5B1M C;  4X23 C;  3KUY C;  3AFA D;  3KSY A;  3V9R B;  4JJN C;  3WA9 B;  3O62 A;  3LJA C;  1P3B A;  1P3P C;  5AV8 D;  5B31 C;  3AZF A;  3B0C W;  3UT9 B;  1P3A C;  3B0D B;  5B2J C;  5CP6 A;  5CPJ D;  4H9N B;  3X1U D;  1M1A C;  1P3G C;  3MGP D;  1S32 D;  3UTA C;  2PYO D;  3AFA A;  3WKJ C;  5G49 A;  3X1V D;  1EQZ B;  5E5A D;  3AZI B;  2IO5 C;  4EO5 C;  5AVC B;  5AVB D;  2JSS A;  4J8V D;  3VH5 A;  4R8P C;  5DNM B;  5CPJ A;  3UT9 A;  3R45 A;  3C1C D;  1P3K B;  3MGP A;  3W98 C;  2PYO A;  3AZK D;  4KUD D;  2NQB C;  3X1V A;  3MGQ C;  1HQ3 B;  1M18 B;  3C1B D;  5AVB A;  1EQZ A;  5B24 C;  4J8V A;  1F1E A;  1WWS A;  5CPI C;  5AVC A;  3WTP D;  3C1C A;  1P3L B;  3AZM D;  3X1T B;  3AN2 B;  3O62 C;  4KUD A;  1P3B C;  5GT3 D;  3AZF C;  2CV5 D;  3MGR B;  4LD9 B;  3REJ D;  5CP6 C;  4NFT A;  3REK C;  1H3O B;  5BNV B;  3KWQ B;  3B6G D;  4KGC B;  5GT0 C;  1ID3 B;  1BH9 B;  4NE5 A;  5GXQ D;  4QLC D;  3WTP A;  1P3I B;  3LZ1 D;  3LEL D;  1P3O B;  1U35 B;  4CSR B;  5KDM A;  3AZH B;  5GT3 A;  4DRA A;  1P34 D;  3WA9 C;  3REJ A;  3VH6 A;  1F66 B;  3UT9 C;  3B6G A;  3B0D C;  4WZS B;  1AOI D;  5GXQ A;  4QLC A;  3UTB B;  1H3O A;  5B1M D;  4X23 D;  3KXB B;  3LZ1 A;  3LEL A;  2PYO C;  1P3I A;  3AZJ B;  4JJN D;  4Z2M H;  3LJA D;  2ARO B;  1P3P D;  2L5A A;  1P34 A;  1EQZ C;  4CSR A;  5C3I B;  1P3A D;  5B2J D;  5AVC C;  3AZE B;  2BYM A;  2CWE A;  3C1C C;  3B0B A;  1F66 A;  1M1A D;  5DNM C;  1P3G D;  3UTA D;  4YS3 B;  1P3K C;  3WKJ D;  4JJN A;  3LZ0 B;  3X1S B;  3AZJ A;  4YM6 B;  1HQ3 C;  1M18 C;  5B40 B;  3W97 B;  4R8P D;  1KX4 B;  5B2I B;  1M1A A;  3WTP E;  3AZE A;  1P3G A;  5BT1 C;  3W98 D;  2NQB D;  3X1T C;  3REI B;  3AZL D;  2F8N B;  3MGQ D;  5JRG B;  4YS3 A;  3VH5 W;  4H9Q A;  1TAF A;  5B24 D;  3LZ0 A;  3MGR C;  3B6G C;  4R8P A;  4WU9 B;  5GXQ C;  4XUJ B;  5CPI D;  4KGC C;  2HUE B;  1ID3 C;  1P3I C;  3O62 D;  4J8X B;  3AZL A;  4WU8 B;  3MGQ A;  3AZF D;  5GSU B;  2YFW B;  5CP6 D;  3AZN B;  2F8N A;  3REK D;  5JRG A;  5GT0 D;  1F66 C;  5CPI A;  1N1J A;  1P3F B;  5DNN B;  3TU4 B;  4XUJ A;  3UTB C;  1P3M D;  3KXB C;  3B0C T;  3A6N B;  3AZJ C;  1M19 B;  3WA9 D;  2ARO C;  4H9R B;  3REL B;  5BNX A;  3REK A;  4CAY B;  3NQJ B;  5C3I C;  5GSU A;  1A7W A;  3UT9 D;  5BO0 B;  5GT0 A;  3MGS B;  2YFW A;  2HIO B;  3REH B;  3AZE C;  5FUG A;  4E45 A;  1P3M A;  1P3F A;  4YS3 C;  4ZUX B;  3V9R A;  3VH6 W;  1EQZ D;  3AZI D;  3LZ0 C;  3WA9 A;  5AVC D;  1M19 A;  4G91 B;  4H9R A;  3W97 C;  1KX4 C;  5DNM D;  5B2I C;  3MGS A;  5BO0 A; 
#chains in the Genus database with same CATH topology
 4H9N A;  2Y2Q A;  2HIO A;  3AZL C;  1P3K D;  2F8N G;  2YFV B;  2BYK B;  2XD5 A;  3EPJ A;  3REI C;  3AYW B;  3EPH A;  4J8W B;  3AZI A;  1HQ3 D;  5JRG C;  1M18 D;  4ZUX A;  4XZQ B;  4H9S C;  3B6F B;  2JCH A;  5DNM A;  4XUJ C;  5BT1 D;  2HUE C;  3MVD B;  1P3L D;  5AY8 B;  1P3K A;  3X1T D;  5B1L B;  3AN2 D;  2Y2J A;  1KX3 B;  5JA4 B;  1HQ3 A;  5GSU C;  3MGR D;  1M18 A;  3WAA B;  4LD9 D;  4J8W A;  3AZN C;  3KWQ D;  4KGC D;  4HGA B;  4KHA B;  1ID3 D;  1P3M C;  1P3I D;  4XZQ A;  1P3F C;  1P3L A;  5DNN C;  5AV9 B;  3B6F A;  3TU4 C;  3X1T A;  3AN2 A;  1P3O D;  2LY8 A;  1U35 D;  3MVD A;  1BFM A;  5AY8 A;  5AV5 B;  3AZH D;  5B1L A;  3A6N C;  1M19 C;  3MGR A;  5B32 B;  4LD9 A;  3REL C;  5B33 B;  1F66 D;  3KWQ A;  5BNV A;  4KGC A;  3MGS C;  2ZY3 A;  1ZLA B;  1ID3 A;  2HIO C;  1BH9 A;  3UTB D;  3MNN B;  3KXB D;  2F8N K;  4H9P B;  4KHA A;  3AV1 B;  1P3O A;  5F99 B;  1U35 A;  3AZJ D;  4E44 A;  3AZI C;  3AZH A;  2ARO D;  4Z66 B;  4ZUX C;  4NE6 A;  5AV5 A;  3AZE D;  5B32 A;  4G91 C;  3AV2 B;  3UTB A;  3KUY B;  2FFF B;  3KXB A;  3A1I A;  4YS3 D;  2ARO A;  3LZ0 D;  3X1S D;  3AZG B;  4J8W C;  4YM6 D;  5B40 D;  3W97 D;  4H9O B;  1KX4 D;  5B2I D;  4XZQ C;  1P3L C;  3B6F C;  4Z5T B;  5AV6 B;  3AN2 C;  3VH5 T;  3MVD C;  5AY8 C;  5B1L C;  3REI D;  1KX5 B;  2F8N D;  1Z2C B;  1KX3 C;  4LD9 C;  1TZY B;  3X1S A;  5JRG D;  4YM6 A;  3KWQ C;  3WAA C;  5B40 A;  2Y2G A;  3W97 A;  3AZG A;  4WU9 D;  1KX4 A;  4XUJ D;  5B2I A;  4J8U B;  2RVQ C;  1P3O C;  4H9O A;  1U35 C;  1BH8 B;  2Y2O A;  2FJ7 B;  2Y2P A;  5AV9 C;  4J8X D;  3AZH C;  3REI A;  5B32 G;  4WU8 D;  4ZBJ B;  2NZD B;  3W99 B;  5GSU D;  4WNN B;  5AV5 C;  4NE3 A;  1KX5 A;  3AZN D;  1ULY A;  4H9S A;  5B32 C;  3AL0 C;  5CPK B;  5B33 C;  3W96 B;  4WU9 A;  5B0Z B;  1P3F D;  2XD1 A;  5DNN D;  1ZLA C;  3TU4 D;  5B0Y B;  1B6W A;  1P3B B;  4J8X A;  3MNN C;  3AV1 C;  5F99 C;  4WU8 A;  3A6N D;  1M19 D;  3REL D;  4Z2M G;  3AZN A;  3W99 A;  3MGS D;  2HIO D;  3REH D;  3AFA B;  5DNN A;  5G49 B;  3TU4 A;  5AV8 B;  5B31 G;  3X1S C;  5B0Y A;  3A6N A;  4ZUX D;  2Y2K A;  4YM6 C;  4WV4 B;  3REL A;  5B40 C;  3AZG C;  5CPJ B;  3R45 B;  4CAY A;  3NQJ A;  3X1U B;  3MGP B;  1S32 B;  1T3U A;  3REH A;  2PYO B;  4AWL B;  4Z5T C;  3X1V B;  5E5A B;  5AV6 C;  4DRB A;  5AVB B;  3AYW D;  4J8V B;  1KX5 C;  4J8W D;  3IP4 C;  5AV8 A;  1TZY C;  3C1C B;  4WU9 C;  4XZQ D;  3H0L C;  3B6F D;  4WJ3 C;  3H0R C;  4J8U C;  3AZK B;  4KUD B;  3X1U A;  4J8X C;  3MVD D;  5AY8 D;  1S32 A;  5B1L D;  4WU8 C;  2FJ7 C;  3C1B B;  2YFV A;  1KX3 D;  2BYK A;  3AYW A;  5E5A A;  4ZBJ C;  2NZD C;  3W99 C;  4G92 B;  3WAA D;  3WTP B;  3AZM B;  5CPK C;  3W96 C;  3EG5 B;  2RVQ D;  5B0Z C;  3F6T A;  2Y2N A;  5KDM B;  4UUZ B;  5GT3 B;  5AV9 D;  5B0Y C;  2CV5 B;  3AZK A;  3REJ B;  1KX3 A;  5JA4 A;  5AV5 D;  3B6G B;  3C1B A;  3WAA A;  5B32 D;  5GXQ B;  4QLC B;  5B33 D;  3REH C;  3LZ1 B;  3LEL B;  1ZLA D;  2F2A C;  2DF4 C;  3AZM A;  5BS7 A;  3AFA C;  5AV9 A;  3MNN D;  3AV1 D;  1P34 B;  5F99 D;  2Y2I A;  5AV8 C;  4UUZ A;  2BG1 A;  2BYM B;  4Z66 D;  2CV5 A;  1AOI B;  2Y2H A;  5B33 A;  1PZR A;  5CPJ C;  5B1M B;  4X23 B;  3X1U C;  3MGP C;  3AV2 D;  1ZLA A;  1S32 C;  4JJN B;  3LJA B;  2UWX A;  3KUY D;  1P3P B;  4AWL C;  3MNN A;  4H9P A;  5B31 B;  3X1V C;  1KU5 A;  5E5A C;  3AYW C;  5F99 A;  3AV1 A;  1P3A B;  5B2J B;  2Y2M A;  5CHL B;  5AVB C;  5B31 D;  4Z66 A;  4J8V C;  3AZG D;  1M1A B;  3NQU B;  1P3G B;  3UTA B;  1R4V A;  1AOI A;  3WKJ B;  3AV2 A;  4Z5T D;  5AV6 D;  5B1M A;  3A1K A;  4X23 A;  3KUY A;  3AZK C;  4KUD C;  2IO5 B;  4H9Q B;  4EO5 B;  1TAF B;  1WWI A;  3LJA A;  1KX5 D;  1P3P A;  3C1B C;  3EPK A;  4R8P B;  5B31 A;  1TZY D;  1P3A A;  2F8N H;  5B2J A;  4G92 C;  4HGA C;  3WTP C;  3W98 B;  3AZM C;  4J8U D;  5BS7 C;  2NQB B;  2VQR A;  2ZY4 A;  3AZL B;  3NQU A;  4Z5T A;  1JFI B;  5AV6 A;  3MGQ B;  3UTA A;  3H0M C;  2FJ7 D;  5GT3 C;  3WKJ A;  2W8S A;  2CV5 C;  5B24 B;  3REJ C;  2NZD D;  3W99 D;  1TZY A;  5CPI B;  4M6B A;  1N1J B;  1B67 A;  1Q9C A;  1HTA A;  4QLC C;  5CPK D;  3W96 D;  5B0Z D;  3O62 B;  3LZ1 C;  4J8U A;  3LEL C;  3AZF B;  3W98 A;  5B0Y D;  1BH8 A;  2FJ7 A;  2NQB A;  1P3B D;  5CP6 B;  5BNX B;  1JFI A;  2G5H C;  4Z66 C;  3REK B;  1P34 C;  2NZD A;  5GT0 B;  4WNN A;  5B24 A;  5FUG B;  1AOI C;  3AV2 C;  5CPK A;  3W96 A;  1P3M B;  3VH6 T;  5B0Z A;  5B1M C;  4X23 C;  3KUY C;  3AFA D;  2RIQ A;  3KSY A;  3V9R B;  4JJN C;  3WA9 B;  3O62 A;  3LJA C;  1P3B A;  1P3P C;  5AV8 D;  5B31 C;  3AZF A;  3B0C W;  3UT9 B;  1P3A C;  3B0D B;  5B2J C;  5CP6 A;  5CPJ D;  4H9N B;  3KFU G;  3X1U D;  1M1A C;  1P3G C;  3MGP D;  1S32 D;  3UTA C;  2PYO D;  3AFA A;  3WKJ C;  5G49 A;  3X1V D;  1EQZ B;  5E5A D;  3AZI B;  2IO5 C;  4EO5 C;  5AVC B;  5AVB D;  2JSS A;  4J8V D;  3VH5 A;  4R8P C;  5DNM B;  5CPJ A;  3UT9 A;  3R45 A;  3C1C D;  1P3K B;  3MGP A;  3W98 C;  3P5J B;  2PYO A;  3AZK D;  4KUD D;  2NQB C;  2ZY2 A;  3X1V A;  3MGQ C;  1HQ3 B;  1M18 B;  3C1B D;  5AVB A;  1EQZ A;  5B24 C;  4J8V A;  3FDD A;  1F1E A;  1WWS A;  5AVC A;  5CPI C;  3WTP D;  3C1C A;  1P3L B;  3AZM D;  3X1T B;  3AN2 B;  3O62 C;  4UPK A;  4KUD A;  1P3B C;  5GT3 D;  3AZF C;  2CV5 D;  3MGR B;  4LD9 B;  3REJ D;  5CP6 C;  4NFT A;  3REK C;  1H3O B;  5BNV B;  3KWQ B;  3B6G D;  4KGC B;  5GT0 C;  1ID3 B;  1BH9 B;  4NE5 A;  5GXQ D;  4QLC D;  3WTP A;  2DQN C;  1P3I B;  3LZ1 D;  3LEL D;  1P3O B;  1U35 B;  4CSR B;  5KDM A;  3AZH B;  5GT3 A;  4DRA A;  1P34 D;  3WA9 C;  3REJ A;  3VH6 A;  1F66 B;  3UT9 C;  3B6G A;  3B0D C;  4WZS B;  1AOI D;  5GXQ A;  4QLC A;  3UTB B;  1H3O A;  5B1M D;  4X23 D;  3KXB B;  3LZ1 A;  3LEL A;  2PYO C;  1P3I A;  3AZJ B;  4JJN D;  4Z2M H;  3LJA D;  2ARO B;  1P3P D;  2L5A A;  1P34 A;  1EQZ C;  4CSR A;  5C3I B;  1P3A D;  5B2J D;  5AVC C;  3AZE B;  2BYM A;  2CWE A;  3C1C C;  3B0B A;  2J8P A;  1F66 A;  1M1A D;  5DNM C;  1P3G D;  3UTA D;  4YS3 B;  1P3K C;  3WKJ D;  4JJN A;  3LZ0 B;  3X1S B;  1W2E A;  3AZJ A;  4YM6 B;  1HQ3 C;  1M18 C;  5B40 B;  3W97 B;  4R8P D;  2Y2L A;  1KX4 B;  5B2I B;  4DQY B;  1M1A A;  3WTP E;  3AZE A;  1P3G A;  5BT1 C;  3W98 D;  2NQB D;  3X1T C;  3REI B;  3AZL D;  2F8N B;  3MGQ D;  5JRG B;  4YS3 A;  3VH5 W;  4H9Q A;  2ZM5 A;  1TAF A;  5B24 D;  3LZ0 A;  3MGR C;  3B6G C;  4R8P A;  4WU9 B;  5GXQ C;  4XUJ B;  5CPI D;  4KGC C;  2HUE B;  1ID3 C;  1P3I C;  3O62 D;  4J8X B;  3AZL A;  4WU8 B;  3MGQ A;  3AZF D;  5GSU B;  2YFW B;  5CP6 D;  3AZN B;  2F8N A;  3REK D;  5JRG A;  5GT0 D;  2JE5 A;  1F66 C;  5CPI A;  1N1J A;  1P3F B;  5DNN B;  3TU4 B;  4XUJ A;  2G5I C;  3UTB C;  1P3M D;  3KXB C;  3B0C T;  3A6N B;  3EPL A;  3AZJ C;  1M19 B;  3WA9 D;  2ARO C;  4H9R B;  3REL B;  5BNX A;  3REK A;  4CAY B;  3NQJ B;  5C3I C;  5GSU A;  1A7W A;  3UT9 D;  5BO0 B;  5GT0 A;  3MGS B;  2YFW A;  2HIO B;  3REH B;  3AZE C;  5FUG A;  4E45 A;  1P3M A;  1P3F A;  4YS3 C;  4ZUX B;  3V9R A;  3VH6 W;  1EQZ D;  3AZI D;  3LZ0 C;  3WA9 A;  5AVC D;  1M19 A;  4G91 B;  4H9R A;  3W97 C;  1KX4 C;  5DNM D;  5B2I C;  3MGS A;  5BO0 A;  2ZY5 A; 
#chains in the Genus database with same CATH homology
 4H9N A;  2Y2Q A;  2HIO A;  3AZL C;  1P3K D;  2F8N G;  2YFV B;  2BYK B;  2XD5 A;  3EPJ A;  3REI C;  3AYW B;  3EPH A;  4J8W B;  3AZI A;  1HQ3 D;  5JRG C;  1M18 D;  4ZUX A;  4XZQ B;  4H9S C;  3B6F B;  2JCH A;  5DNM A;  4XUJ C;  5BT1 D;  2HUE C;  3MVD B;  1P3L D;  5AY8 B;  1P3K A;  3X1T D;  5B1L B;  3AN2 D;  2Y2J A;  1KX3 B;  5JA4 B;  1HQ3 A;  5GSU C;  3MGR D;  1M18 A;  3WAA B;  4LD9 D;  4J8W A;  3AZN C;  3KWQ D;  4KGC D;  4HGA B;  4KHA B;  1ID3 D;  1P3M C;  1P3I D;  4XZQ A;  1P3F C;  1P3L A;  5DNN C;  5AV9 B;  3B6F A;  3TU4 C;  3X1T A;  3AN2 A;  1P3O D;  2LY8 A;  1U35 D;  3MVD A;  1BFM A;  5AY8 A;  5AV5 B;  3AZH D;  5B1L A;  3A6N C;  1M19 C;  3MGR A;  5B32 B;  4LD9 A;  3REL C;  5B33 B;  1F66 D;  3KWQ A;  5BNV A;  4KGC A;  3MGS C;  2ZY3 A;  1ZLA B;  1ID3 A;  2HIO C;  1BH9 A;  3UTB D;  3MNN B;  3KXB D;  2F8N K;  4H9P B;  4KHA A;  3AV1 B;  1P3O A;  5F99 B;  1U35 A;  3AZJ D;  4E44 A;  3AZI C;  3AZH A;  2ARO D;  4Z66 B;  4ZUX C;  4NE6 A;  5AV5 A;  3AZE D;  5B32 A;  4G91 C;  3AV2 B;  3UTB A;  3KUY B;  2FFF B;  3KXB A;  3A1I A;  4YS3 D;  2ARO A;  3LZ0 D;  3X1S D;  3AZG B;  4J8W C;  4YM6 D;  5B40 D;  3W97 D;  4H9O B;  1KX4 D;  5B2I D;  4XZQ C;  1P3L C;  3B6F C;  4Z5T B;  5AV6 B;  3AN2 C;  3VH5 T;  3MVD C;  5AY8 C;  5B1L C;  3REI D;  1KX5 B;  2F8N D;  1Z2C B;  1KX3 C;  4LD9 C;  1TZY B;  3X1S A;  5JRG D;  4YM6 A;  3KWQ C;  3WAA C;  5B40 A;  2Y2G A;  3W97 A;  3AZG A;  4WU9 D;  1KX4 A;  4XUJ D;  5B2I A;  4J8U B;  2RVQ C;  1P3O C;  4H9O A;  1U35 C;  1BH8 B;  2Y2O A;  2FJ7 B;  2Y2P A;  5AV9 C;  4J8X D;  3AZH C;  3REI A;  5B32 G;  4WU8 D;  4ZBJ B;  2NZD B;  3W99 B;  5GSU D;  4WNN B;  5AV5 C;  4NE3 A;  1KX5 A;  3AZN D;  1ULY A;  4H9S A;  5B32 C;  3AL0 C;  5CPK B;  5B33 C;  3W96 B;  4WU9 A;  5B0Z B;  1P3F D;  2XD1 A;  5DNN D;  1ZLA C;  3TU4 D;  5B0Y B;  1B6W A;  1P3B B;  4J8X A;  3MNN C;  3AV1 C;  5F99 C;  4WU8 A;  3A6N D;  1M19 D;  3REL D;  4Z2M G;  3AZN A;  3W99 A;  3MGS D;  2HIO D;  3REH D;  3AFA B;  5DNN A;  5G49 B;  3TU4 A;  5AV8 B;  5B31 G;  3X1S C;  5B0Y A;  3A6N A;  4ZUX D;  2Y2K A;  4YM6 C;  4WV4 B;  3REL A;  5B40 C;  3AZG C;  5CPJ B;  3R45 B;  4CAY A;  3NQJ A;  3X1U B;  3MGP B;  1S32 B;  1T3U A;  3REH A;  2PYO B;  4AWL B;  4Z5T C;  3X1V B;  5E5A B;  5AV6 C;  4DRB A;  5AVB B;  3AYW D;  4J8V B;  1KX5 C;  4J8W D;  3IP4 C;  5AV8 A;  1TZY C;  3C1C B;  4WU9 C;  4XZQ D;  3H0L C;  3B6F D;  4WJ3 C;  3H0R C;  4J8U C;  3AZK B;  4KUD B;  3X1U A;  4J8X C;  3MVD D;  5AY8 D;  1S32 A;  5B1L D;  4WU8 C;  2FJ7 C;  3C1B B;  2YFV A;  1KX3 D;  2BYK A;  3AYW A;  5E5A A;  4ZBJ C;  2NZD C;  3W99 C;  4G92 B;  3WAA D;  3WTP B;  3AZM B;  5CPK C;  3W96 C;  3EG5 B;  2RVQ D;  5B0Z C;  3F6T A;  2Y2N A;  5KDM B;  4UUZ B;  5GT3 B;  5AV9 D;  5B0Y C;  2CV5 B;  3AZK A;  3REJ B;  1KX3 A;  5JA4 A;  5AV5 D;  3B6G B;  3C1B A;  3WAA A;  5B32 D;  5GXQ B;  4QLC B;  5B33 D;  3REH C;  3LZ1 B;  3LEL B;  1ZLA D;  2F2A C;  2DF4 C;  3AZM A;  5BS7 A;  3AFA C;  5AV9 A;  3MNN D;  3AV1 D;  1P34 B;  5F99 D;  2Y2I A;  5AV8 C;  4UUZ A;  2BG1 A;  2BYM B;  4Z66 D;  2CV5 A;  1AOI B;  2Y2H A;  5B33 A;  1PZR A;  5CPJ C;  5B1M B;  4X23 B;  3X1U C;  3MGP C;  3AV2 D;  1ZLA A;  1S32 C;  4JJN B;  3LJA B;  2UWX A;  3KUY D;  1P3P B;  4AWL C;  3MNN A;  4H9P A;  5B31 B;  3X1V C;  1KU5 A;  5E5A C;  3AYW C;  5F99 A;  3AV1 A;  1P3A B;  5B2J B;  2Y2M A;  5CHL B;  5AVB C;  5B31 D;  4Z66 A;  4J8V C;  3AZG D;  1M1A B;  3NQU B;  1P3G B;  3UTA B;  1R4V A;  1AOI A;  3WKJ B;  3AV2 A;  4Z5T D;  5AV6 D;  5B1M A;  3A1K A;  4X23 A;  3KUY A;  3AZK C;  4KUD C;  2IO5 B;  4H9Q B;  4EO5 B;  1TAF B;  1WWI A;  3LJA A;  1KX5 D;  1P3P A;  3C1B C;  3EPK A;  4R8P B;  5B31 A;  1TZY D;  1P3A A;  2F8N H;  5B2J A;  4G92 C;  4HGA C;  3WTP C;  3W98 B;  3AZM C;  4J8U D;  5BS7 C;  2NQB B;  2VQR A;  2ZY4 A;  3AZL B;  3NQU A;  4Z5T A;  1JFI B;  5AV6 A;  3MGQ B;  3UTA A;  3H0M C;  2FJ7 D;  5GT3 C;  3WKJ A;  2W8S A;  2CV5 C;  5B24 B;  3REJ C;  2NZD D;  3W99 D;  1TZY A;  5CPI B;  4M6B A;  1N1J B;  1B67 A;  1Q9C A;  1HTA A;  4QLC C;  5CPK D;  3W96 D;  5B0Z D;  3O62 B;  3LZ1 C;  4J8U A;  3LEL C;  3AZF B;  3W98 A;  5B0Y D;  1BH8 A;  2FJ7 A;  2NQB A;  1P3B D;  5CP6 B;  5BNX B;  1JFI A;  2G5H C;  4Z66 C;  3REK B;  1P34 C;  2NZD A;  5GT0 B;  4WNN A;  5B24 A;  5FUG B;  1AOI C;  3AV2 C;  5CPK A;  3W96 A;  1P3M B;  3VH6 T;  5B0Z A;  5B1M C;  4X23 C;  3KUY C;  3AFA D;  2RIQ A;  3KSY A;  3V9R B;  4JJN C;  3WA9 B;  3O62 A;  3LJA C;  1P3B A;  1P3P C;  5AV8 D;  5B31 C;  3AZF A;  3B0C W;  3UT9 B;  1P3A C;  3B0D B;  5B2J C;  5CP6 A;  5CPJ D;  4H9N B;  3KFU G;  3X1U D;  1M1A C;  1P3G C;  3MGP D;  1S32 D;  3UTA C;  2PYO D;  3AFA A;  3WKJ C;  5G49 A;  3X1V D;  1EQZ B;  5E5A D;  3AZI B;  2IO5 C;  4EO5 C;  5AVC B;  5AVB D;  2JSS A;  4J8V D;  3VH5 A;  4R8P C;  5DNM B;  5CPJ A;  3UT9 A;  3R45 A;  3C1C D;  1P3K B;  3MGP A;  3W98 C;  3P5J B;  2PYO A;  3AZK D;  4KUD D;  2NQB C;  2ZY2 A;  3X1V A;  3MGQ C;  1HQ3 B;  1M18 B;  3C1B D;  5AVB A;  1EQZ A;  5B24 C;  4J8V A;  3FDD A;  1F1E A;  1WWS A;  5AVC A;  5CPI C;  3WTP D;  3C1C A;  1P3L B;  3AZM D;  3X1T B;  3AN2 B;  3O62 C;  4UPK A;  4KUD A;  1P3B C;  5GT3 D;  3AZF C;  2CV5 D;  3MGR B;  4LD9 B;  3REJ D;  5CP6 C;  4NFT A;  3REK C;  1H3O B;  5BNV B;  3KWQ B;  3B6G D;  4KGC B;  5GT0 C;  1ID3 B;  1BH9 B;  4NE5 A;  5GXQ D;  4QLC D;  3WTP A;  2DQN C;  1P3I B;  3LZ1 D;  3LEL D;  1P3O B;  1U35 B;  4CSR B;  5KDM A;  3AZH B;  5GT3 A;  4DRA A;  1P34 D;  3WA9 C;  3REJ A;  3VH6 A;  1F66 B;  3UT9 C;  3B6G A;  3B0D C;  4WZS B;  1AOI D;  5GXQ A;  4QLC A;  3UTB B;  1H3O A;  5B1M D;  4X23 D;  3KXB B;  3LZ1 A;  3LEL A;  2PYO C;  1P3I A;  3AZJ B;  4JJN D;  4Z2M H;  3LJA D;  2ARO B;  1P3P D;  2L5A A;  1P34 A;  1EQZ C;  4CSR A;  5C3I B;  1P3A D;  5B2J D;  5AVC C;  3AZE B;  2BYM A;  2CWE A;  3C1C C;  3B0B A;  2J8P A;  1F66 A;  1M1A D;  5DNM C;  1P3G D;  3UTA D;  4YS3 B;  1P3K C;  3WKJ D;  4JJN A;  3LZ0 B;  3X1S B;  1W2E A;  3AZJ A;  4YM6 B;  1HQ3 C;  1M18 C;  5B40 B;  3W97 B;  4R8P D;  2Y2L A;  1KX4 B;  5B2I B;  4DQY B;  1M1A A;  3WTP E;  3AZE A;  1P3G A;  5BT1 C;  3W98 D;  2NQB D;  3X1T C;  3REI B;  3AZL D;  2F8N B;  3MGQ D;  5JRG B;  4YS3 A;  3VH5 W;  4H9Q A;  2ZM5 A;  1TAF A;  5B24 D;  3LZ0 A;  3MGR C;  3B6G C;  4R8P A;  4WU9 B;  5GXQ C;  4XUJ B;  5CPI D;  4KGC C;  2HUE B;  1ID3 C;  1P3I C;  3O62 D;  4J8X B;  3AZL A;  4WU8 B;  3MGQ A;  3AZF D;  5GSU B;  2YFW B;  5CP6 D;  3AZN B;  2F8N A;  3REK D;  5JRG A;  5GT0 D;  2JE5 A;  1F66 C;  5CPI A;  1N1J A;  1P3F B;  5DNN B;  3TU4 B;  4XUJ A;  2G5I C;  3UTB C;  1P3M D;  3KXB C;  3B0C T;  3A6N B;  3EPL A;  3AZJ C;  1M19 B;  3WA9 D;  2ARO C;  4H9R B;  3REL B;  5BNX A;  3REK A;  4CAY B;  3NQJ B;  5C3I C;  5GSU A;  1A7W A;  3UT9 D;  5BO0 B;  5GT0 A;  3MGS B;  2YFW A;  2HIO B;  3REH B;  3AZE C;  5FUG A;  4E45 A;  1P3M A;  1P3F A;  4YS3 C;  4ZUX B;  3V9R A;  3VH6 W;  1EQZ D;  3AZI D;  3LZ0 C;  3WA9 A;  5AVC D;  1M19 A;  4G91 B;  4H9R A;  3W97 C;  1KX4 C;  5DNM D;  5B2I C;  3MGS A;  5BO0 A;  2ZY5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...