5GT0D

Crystal structure of nucleosome complex with human testis-specific histone variants, th2a
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
98
structure length
98
Chain Sequence
KRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Structural analyses of the nucleosome complexes with human testis-specific histone variants, hTh2a and hTh2b
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 33
structure length 98
sequence length 98
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5gt0D00
3REID 4J8UC 5AV8D 1P3OA 1F66C 3AZMB 5CPKB 5GT0C 4H9QA 3B0CW 3MGQB 3X1VB 1P3KD 1M18A 1P3AA 1JFIA 3B0CT 1M1AB 5B1MA 3LELA 5DNNA 3W98D 3LZ1C 5DNMD 5B2JA 3AZJB 3A6NA 3REJC 5B31C 5B0ZB 4XUJA 4AWLC 4J8WD 2NQBA 4LD9C 2NZDC 3W97B 5B2IA 3KXBB 1KX4D 3RELA 5CPIB 3MGPC 2CV5B 4WU9D 3C1CD 1ID3A 1KU5A 5FUGB 3AV1C 1EQZA 1TZYA 3KWQD 1P3FD 5E5AC 4ZBJB 4EO5B 4X23B 1KX5D 5AVCB 3WTPA 5F99C 1P3BA 3AZFA 3AZGB 5B33B 5AY8B 3UT9B 2HIOA 3VH5A 3B6FA 3UTBD 3AZHC 2YFVB 5G49B 3B6GB 3MGSC 1P3GD 5CPID 1P3MC 4H9NB 1A7WA 1P3KA 2LY8A 2BYKA 4CSRB 4NE6A 4NE3A 3C1BC 3WTPE 1BH9B 3VH5T 3WKJB 4G91C 3AN2D 1P3PD 1P3OB 4G92B 5DNMA 5AV6C 1U35C 1KX3D 1M18B 1KX4A 1JFIB 4WU9A 4ZUXB 3W99C 5B1MB 3LELB 3MVDD 3AFAD 5DNNB 3MGRC 3MNNC 5CP6C 3UTAD 1P3FA 4Z2MG 5B2JB 4J8VA 2NQBB 4XUJB 3NQUA 4HGAB 5B2IB 3RELB 3KUYC 5BNVA 5B32D 1ID3B 3AZEA 3LJAC 3LZ0D 4QLCC 5GXQC 5BO0A 1F1EA 4WU8A 5B24D 4NFTA 1P3OD 3AZKD 5AV9A 3UTBA 1M19C 1P3IC 3WTPB 1P3BB 1M18D 1P3GA 1P3AD 3W96A 3X1UC 3AZLC 3X1TA 1P3LC 5GT3A 3AZFB 4KUDD 5B0YB 1F66A 1HTAA 4Z66D 5B40C 3X1SB 5DNND 5GT0A 1AOIC 3B6FB 3AN2A 5B2JD 3REIB 3A6ND 1P3PA 3B0DB 3O62C 1KX3A 1P3KB 4M6BA 1ID3D 2FJ7C 3LZ1A 1EQZD 1TZYD 4E44A 5B31A 4LD9A 2HUEC 3AFAA 3W98B 3R45A 5DNMB 4YM6C 1KX4B 3AV1A 1B67A 3WTPD 3AYWC 1P34C 4WU9B 4YS3C 4H9SC 5GSUD 5E5AA 4XZQC 2YFWB 2BYMA 3AV2C 3KWQB 5B1LC 3REKC 4H9PA 4KGCC 4Z5TD 1P3FB 2HIOD 4J8VB 4H9OA 5F99A 5KDMB 3NQUB 3AZMC 5CPKC 3AZKA 5BNVB 5JRGD 3X1VC 3MGQC 3KSYA 5C3IB 5BO0B 5CPJD 4KUDA 1M1AC 2IO5B 4Z66A 1BH8A 3MGSA 4J8XC 3UTBB 3AZJC 1HQ3D 5B0ZC 3W97C 3KXBC 4UUZA 2CV5C 3C1BA 1P3GB 3W96B 5GT3B 1F66B 1U35A 3AN2B 4EO5C 4J8VD 1P3PB 4X23C 3AZND 1KX3B 5AVCC 3W99A 1BFMA 4Z2MH 3AZED 2AROC 5CP6A 5GSUA 4KHAA 4WU8D 5BT1D 5B31B 3AZGC 3MVDB 3AFAB 3WA9C 2PYOC 5B33C 5AVBC 5AY8C 4Z5TA 3R45B 3REHD 3KUYA 3UT9C 3UTAB 5B32G 3AZID 5AV9D 3V9RA 4JJND 3LJAA 5GXQA 3B6GC 5AV5D 5JRGA 4R8PD 5JA4B 1ZLAD 5B32B 3W96D 3X1TD 5GT3D 2BYMB 3LZ0B 3NQJA 4J8UD 1F66D 4H9PB 5CPJA 1TAFB 1H3OA 5GT0D 3WKJC 1M19A 5B24B 3WAAC 3TU4C 5F99B 4G92C 3AZKB 3AZLA 3B0BA 3X1UA 1HQ3A 1P3LA 4H9QB 1M18C 5B40A 1P3AB 3LZ1D 1AOIA 4ZUXC 4KUDB 5B1MC 3LELC 1Q9CA 5B31D 3REJD 4Z66B 4LD9D 2NZDD 2NQBC 5BS7A 3A6NB 4XUJC 4HGAC 5B2IC 2FJ7A 3RELC 3AV1D 3AZNA 2L5AA 1ID3C 5E5AD 2F8NH 2RVQC 1EQZB 1TZYB 4YM6A 1N1JA 5F99D 3REHA 3AYWA 1P34A 2F8NA 3AZIA 4JJNA 4XZQA 3AV2A 5AV5A 4R8PA 3REKA 1P3BC 1ZLAA 1S32C 5GSUB 3AZFC 5B0YC 3AZHD 4J8UA 3AZMA 3X1SC 5CPKA 4Z5TB 2HIOB 3MGSD 3B6FC 3REIC 1P3MD 5AV8C 5JRGB 3C1BD 1M1AA 1P3KC 3NQJB 2BYKB 5CPJB 1H3OB 4J8XA 3AZJA 5AV6D 3REJA 1U35D 2NZDA 3W98C 4DRBA 5DNMC 3MGPA 1HQ3B 4J8WC 4H9RA 1KX4C 5FUGA 3W99D 5B40B 4WU9C 3MGRD 3C1CC 1AOIB 5CP6D 4WNNA 4WZSB 4X23A 3KWQC 1P3FC 3KUYD 5AVCA 1KX5C 1ULYA 4E45A 3LJAD 2AROA 5GXQD 4QLCD 2CWEA 3AZNB 3WA9A 2PYOA 5B33A 5AVBA 5AY8A 5C3IC 3AZEB 4WU8B 3AZHA 1M19D 1P3ID 3REHB 3AYWB 3AZIB 3UTBC 5AV9B 3AZLD 3X1UD 1P3MA 1P3LD 4JJNB 5AV5B 4R8PB 4CSRA 1ZLAB 1P3GC 5CPIC 5B40D 1BH9A 3X1TB 1AOID 3TU4A 3WAAA 4J8UB 3VH6W 5GT0B 5AV6A 3AN2C 3O62D 1P3PC 4ZBJC 3VH6T 2FJ7D 4ZUXA 1KX3C 5B31G 3MGRA 3LZ1B 3MNNA 4J8XB 3REJB 3AFAC 3MVDC 4YM6D 4AWLB 4LD9B 2NZDB 3UTAC 2F8ND 3AYWD 3MGPB 1P34D 4YS3D 4H9RB 4XZQD 3AV1B 3AV2D 4QLCA 5B1LD 3REKD 5B32C 4KGCD 4WNNB 5E5AB 3LZ0C 3AZMD 5CPKD 5B24C 4H9OB 1P3IA 3MGQD 3X1VD 1P3OC 3AZKC 1S32A 4CAYA 2AROB 5BNXA 5B0YA 1M1AD 3WA9B 2PYOB 3X1SA 5AVBB 1P3AC 4KUDC 4J8XD 3REIA 3AZHB 5AV8A 3AZJD 5B0ZD 4Z66C 1BH8B 5DNNC 3W97D 3KXBD 3MGSB 2CV5D 5B2JC 3O62A 2JSSA 3A6NC 3MGPD 3VH5W 1P3MB 4UUZB 3C1BB 3WAAB 3TU4B 4G91B 3W98A 4X23D 1EQZC 1TZYC 5AV6B 1U35B 4J8WA 5AVCD 4YS3A 3C1CA 4H9SA 1R4VA 2AROD 3W99B 2YFWA 3WTPC 3AZGD 3KWQA 1WWSA 5B1LA 2PYOD 3MGRB 5B33D 3WA9D 5AVBD 1B6WA 5AY8D 3MNNB 5CP6B 5GSUC 3UT9D 4KGCA 4KHAB 1KX5A 5KDMA 4Z5TC 3KUYB 2HIOC 3B6GD 3MGQA 3X1VA 3V9RB 3B0DC 3LJAB 5GXQB 5JRGC 4QLCB 1WWIA 3WKJD 3WAAD 3TU4D 5CPJC 1M19B 5B0ZA 1P3IB 3W97A 3KXBA 1S32B 5CPIA 4CAYB 2CV5A 1HQ3C 3X1UB 3AZLB 1P3LB 4ZUXD 5BNXB 5B1MD 3LELD 3MNND 2NQBD 5AV8B 4XUJD 2F8NK 5B2ID 3RELD 5BS7C 3O62B 4J8VC 2RVQD 2FJ7B 3AZNC 4DRAA 3MVDA 3AZGA 2HUEB 3AZEC 2F8NG 3UT9A 3UTAA 4WU8C 5BT1C 4J8WB 4YM6B 2YFVA 2IO5C 5G49A 3REHC 1N1JB 2F8NB 1P34B 5JA4A 1P3BD 3AZIC 5B32A 3C1CB 4YS3B 5AV9C 1S32D 3B6GA 5CHLB 4H9NA 4JJNC 3VH6A 4XZQB 3AZFD 3LZ0A 3AV2B 5B0YD 4NE5A 4R8PC 5B1LB 5AV5C 3REKB 1TAFA 1ZLAC 4WV4B 3X1SD 3W96C 3X1TC 4KGCB 3WKJA 5GT3C 5B24A 3B6FD 1KX5B
chains in the Genus database with same CATH superfamily
3REID 4J8UC 5AV8D 1P3OA 1F66C 3AZMB 5CPKB 5GT0C 2ZM5A 4H9QA 3B0CW 2UWXA 3MGQB 3X1VB 1P3KD 1M18A 1P3AA 1JFIA 3B0CT 1M1AB 5B1MA 3LELA 5DNNA 3W98D 2FFFB 3LZ1C 5DNMD 5B2JA 3AZJB 3A6NA 3REJC 5B31C 3EG5B 4XUJA 5B0ZB 4J8WD 4AWLC 4LD9C 2NZDC 3W97B 5B2IA 3KXBB 1KX4D 3RELA 5CPIB 3MGPC 2CV5B 4WU9D 3C1CD 1ID3A 1KU5A 5FUGB 3AV1C 1EQZA 1TZYA 3KWQD 1P3FD 5E5AC 4ZBJB 4EO5B 4X23B 1KX5D 3H0LC 5AVCB 3WTPA 5F99C 1P3BA 3AZFA 3AZGB 2ZY5A 5B33B 5AY8B 3UT9B 2HIOA 3VH5A 3B6FA 3UTBD 3AZHC 2YFVB 5G49B 3B6GB 3MGSC 1P3GD 5CPID 1P3MC 4H9NB 1A7WA 1P3KA 2LY8A 2BYKA 4CSRB 4NE6A 4NE3A 3C1BC 3WTPE 3AL0C 1BH9B 3VH5T 3WKJB 4G91C 3AN2D 3A1IA 1P3PD 1P3OB 4G92B 2Y2JA 5DNMA 5AV6C 1U35C 1KX3D 1M18B 1KX4A 2Y2MA 1JFIB 4WU9A 4ZUXB 3W99C 5B1MB 3LELB 3MVDD 3AFAD 5DNNB 3MGRC 3MNNC 5CP6C 3UTAD 1P3FA 4Z2MG 5B2JB 4J8VA 2NQBB 4XUJB 3NQUA 4HGAB 5B2IB 2ZY4A 3RELB 3KUYC 5BNVA 5B32D 1ID3B 3AZEA 3LJAC 3LZ0D 4QLCC 5GXQC 5BO0A 1F1EA 4WU8A 5B24D 2F2AC 4NFTA 1P3OD 1W2EA 5AV9A 3UTBA 3AZKD 1M19C 1P3IC 3WTPB 1P3BB 1M18D 1P3GA 1P3AD 3W96A 3X1UC 3AZLC 3X1TA 1P3LC 5GT3A 3AZFB 4KUDD 5B0YB 1F66A 1HTAA 4Z66D 5B40C 3X1SB 5DNND 5GT0A 1AOIC 3B6FB 3P5JB 3AN2A 5B2JD 3REIB 3A6ND 1P3PA 3B0DB 1PZRA 2DQNC 3O62C 1KX3A 1P3KB 4M6BA 1ID3D 2FJ7C 3LZ1A 1EQZD 1TZYD 4E44A 4WJ3C 5B31A 4LD9A 2HUEC 3AFAA 3W98B 2ZY3A 3R45A 5DNMB 4YM6C 1KX4B 3AV1A 1B67A 3WTPD 3AYWC 1P34C 4WU9B 4YS3C 4H9SC 5GSUD 5E5AA 4XZQC 2YFWB 2BYMA 3AV2C 3KWQB 5B1LC 3REKC 3H0MC 4H9PA 4KGCC 4Z5TD 1P3FB 2HIOD 4J8VB 2Y2PA 4H9OA 5F99A 5KDMB 3NQUB 3AZMC 5CPKC 3AZKA 5BNVB 5JRGD 3X1VC 3MGQC 3KSYA 5C3IB 5BO0B 5CPJD 4KUDA 1M1AC 2IO5B 4Z66A 1BH8A 3MGSA 4J8XC 3UTBB 3AZJC 1HQ3D 5B0ZC 2RIQA 3W97C 3KXBC 4UUZA 2CV5C 3C1BA 1P3GB 3W96B 5GT3B 2J8PA 1F66B 1U35A 3AN2B 4EO5C 4J8VD 1P3PB 4X23C 3AZND 1KX3B 5AVCC 3W99A 1BFMA 4Z2MH 3AZED 2AROC 5CP6A 5GSUA 4KHAA 4WU8D 5BT1D 5B31B 3AZGC 3MVDB 3AFAB 3WA9C 2PYOC 5B33C 5AVBC 5AY8C 4Z5TA 3R45B 3REHD 3KUYA 3UT9C 3UTAB 5B32G 3AZID 5AV9D 2Y2KA 3V9RA 4JJND 3FDDA 3LJAA 5GXQA 3B6GC 5AV5D 5JRGA 4R8PD 5JA4B 1ZLAD 5B32B 3W96D 3X1TD 5GT3D 2BYMB 3LZ0B 3NQJA 4J8UD 1F66D 4H9PB 5CPJA 1TAFB 1H3OA 5GT0D 3WKJC 1M19A 5B24B 3WAAC 3TU4C 2G5IC 5F99B 4G92C 3AZKB 3AZLA 3B0BA 3X1UA 1HQ3A 1P3LA 4H9QB 3EPKA 1M18C 2XD5A 3EPLA 5B40A 1Z2CB 1P3AB 3LZ1D 1AOIA 4ZUXC 4KUDB 5B1MC 3LELC 1Q9CA 5B31D 3REJD 4Z66B 4LD9D 2NZDD 2NQBC 5BS7A 3A6NB 4XUJC 2Y2HA 4HGAC 5B2IC 2FJ7A 3RELC 3AV1D 3AZNA 2L5AA 1ID3C 5E5AD 2F8NH 2RVQC 1EQZB 1TZYB 4YM6A 4UPKA 1N1JA 5F99D 3REHA 3AYWA 1P34A 2F8NA 2NQBA 3AZIA 4JJNA 2BG1A 4XZQA 3H0RC 3AV2A 5AV5A 4R8PA 3REKA 1P3BC 1ZLAA 1S32C 3WA9D 2W8SA 5GSUB 3AZFC 5B0YC 2Y2LA 3AZHD 4J8UA 3AZMA 3X1SC 5CPKA 2JE5A 4Z5TB 2HIOB 3MGSD 3B6FC 3REIC 1P3MD 5AV8C 5JRGB 3C1BD 1M1AA 1P3KC 3NQJB 2BYKB 5CPJB 3EPHA 1H3OB 4J8XA 3AZJA 5AV6D 3REJA 1U35D 2NZDA 3W98C 4DRBA 5DNMC 3MGPA 1HQ3B 4J8WC 4H9RA 3KFUG 1KX4C 5FUGA 3W99D 5B40B 4WU9C 3MGRD 3C1CC 1AOIB 5CP6D 4WNNA 4WZSB 4X23A 3KWQC 1P3FC 3KUYD 5AVCA 1KX5C 1ULYA 4E45A 3LJAD 2AROA 5GXQD 4QLCD 2CWEA 3AZNB 3WA9A 2PYOA 5B33A 5AVBA 5AY8A 5C3IC 3AZEB 4WU8B 3AZHA 1M19D 1P3ID 3F6TA 3REHB 3AYWB 3AZIB 3UTBC 5AV9B 3AZLD 3X1UD 1P3MA 1P3LD 4JJNB 5AV5B 4R8PB 4CSRA 1ZLAB 1P3GC 5CPIC 5B40D 1BH9A 3X1TB 1AOID 3TU4A 3WAAA 4J8UB 3VH6W 2Y2OA 5GT0B 5AV6A 3AN2C 3O62D 1P3PC 4ZBJC 3VH6T 2VQRA 2FJ7D 4ZUXA 1KX3C 5B31G 2Y2QA 3MGRA 3LZ1B 3MNNA 4J8XB 3REJB 3AFAC 3MVDC 4YM6D 4AWLB 4LD9B 2NZDB 3UTAC 2F8ND 3AYWD 3MGPB 1P34D 4YS3D 4H9RB 2XD1A 4XZQD 3AV1B 3AV2D 4QLCA 5B1LD 3REKD 5B32C 4KGCD 4WNNB 5E5AB 3LZ0C 3AZMD 5CPKD 5B24C 4H9OB 1P3IA 3MGQD 3X1VD 2Y2IA 1P3OC 3AZKC 1S32A 4CAYA 2AROB 5BNXA 5B0YA 1M1AD 3WA9B 2PYOB 3X1SA 5AVBB 1P3AC 4KUDC 4J8XD 3REIA 1T3UA 5AV8A 3AZHB 5B0ZD 4Z66C 3AZJD 1BH8B 5DNNC 3W97D 2Y2NA 3KXBD 3MGSB 2CV5D 5B2JC 3O62A 2JSSA 3A6NC 3MGPD 2DF4C 3VH5W 1P3MB 4UUZB 3C1BB 3WAAB 3TU4B 4G91B 3W98A 4X23D 1EQZC 3IP4C 1TZYC 5AV6B 1U35B 4J8WA 5AVCD 4YS3A 3C1CA 4H9SA 1R4VA 2AROD 3W99B 2YFWA 3WTPC 3AZGD 3KWQA 1WWSA 5B1LA 2PYOD 3MGRB 2G5HC 5B33D 5AVBD 1B6WA 5AY8D 3MNNB 5CP6B 5GSUC 3UT9D 4KGCA 4KHAB 1KX5A 5KDMA 4Z5TC 3KUYB 2HIOC 3B6GD 2Y2GA 3MGQA 3X1VA 3V9RB 3B0DC 3LJAB 5GXQB 5JRGC 4QLCB 1WWIA 4DQYB 3WKJD 3WAAD 3TU4D 5CPJC 1M19B 5B0ZA 1P3IB 3W97A 3KXBA 1S32B 5CPIA 4CAYB 2CV5A 1HQ3C 3X1UB 3AZLB 1P3LB 4ZUXD 5BNXB 3A1KA 5B1MD 3LELD 3EPJA 3MNND 2NQBD 5AV8B 4XUJD 2F8NK 2JCHA 5B2ID 3RELD 5BS7C 3O62B 4J8VC 2RVQD 2FJ7B 3AZNC 2ZY2A 4DRAA 3MVDA 3AZGA 2HUEB 3AZEC 2F8NG 3UT9A 3UTAA 4WU8C 5BT1C 4J8WB 4YM6B 2YFVA 2IO5C 5G49A 3REHC 1N1JB 2F8NB 1P34B 5JA4A 1P3BD 3AZIC 5B32A 3C1CB 4YS3B 5AV9C 1S32D 3B6GA 5CHLB 4H9NA 4JJNC 3VH6A 4XZQB 3AZFD 3LZ0A 3AV2B 5B0YD 5AV5C 4NE5A 4R8PC 5B1LB 3REKB 1TAFA 1ZLAC 4WV4B 3X1SD 3W96C 3X1TC 4KGCB 3WKJA 5GT3C 5B24A 3B6FD 1KX5B
chains in the Genus database with same CATH topology
3REID 4J8UC 5AV8D 1P3OA 1F66C 3AZMB 5CPKB 5GT0C 2ZM5A 4H9QA 3B0CW 2UWXA 3MGQB 3X1VB 1P3KD 1M18A 1P3AA 1JFIA 3B0CT 1M1AB 5B1MA 3LELA 5DNNA 3W98D 2FFFB 3LZ1C 5DNMD 5B2JA 3AZJB 3A6NA 3REJC 5B31C 3EG5B 4XUJA 5B0ZB 4J8WD 4AWLC 4LD9C 2NZDC 3W97B 5B2IA 3KXBB 1KX4D 3RELA 5CPIB 3MGPC 2CV5B 4WU9D 3C1CD 1ID3A 1KU5A 5FUGB 3AV1C 1EQZA 1TZYA 3KWQD 1P3FD 5E5AC 4ZBJB 4EO5B 4X23B 1KX5D 3H0LC 5AVCB 3WTPA 5F99C 1P3BA 3AZFA 3AZGB 2ZY5A 5B33B 5AY8B 3UT9B 2HIOA 3VH5A 3B6FA 3UTBD 3AZHC 2YFVB 5G49B 3B6GB 3MGSC 1P3GD 5CPID 1P3MC 4H9NB 1A7WA 1P3KA 2LY8A 2BYKA 4CSRB 4NE6A 4NE3A 3C1BC 3WTPE 3AL0C 1BH9B 3VH5T 3WKJB 4G91C 3AN2D 3A1IA 1P3PD 1P3OB 4G92B 2Y2JA 5DNMA 5AV6C 1U35C 1KX3D 1M18B 1KX4A 2Y2MA 1JFIB 4WU9A 4ZUXB 3W99C 5B1MB 3LELB 3MVDD 3AFAD 5DNNB 3MGRC 3MNNC 5CP6C 3UTAD 1P3FA 4Z2MG 5B2JB 4J8VA 2NQBB 4XUJB 3NQUA 4HGAB 5B2IB 2ZY4A 3RELB 3KUYC 5BNVA 5B32D 1ID3B 3AZEA 3LJAC 3LZ0D 4QLCC 5GXQC 5BO0A 1F1EA 4WU8A 5B24D 2F2AC 4NFTA 1P3OD 1W2EA 5AV9A 3UTBA 3AZKD 1M19C 1P3IC 3WTPB 1P3BB 1M18D 1P3GA 1P3AD 3W96A 3X1UC 3AZLC 3X1TA 1P3LC 5GT3A 3AZFB 4KUDD 5B0YB 1F66A 1HTAA 4Z66D 5B40C 3X1SB 5DNND 5GT0A 1AOIC 3B6FB 3P5JB 3AN2A 5B2JD 3REIB 3A6ND 1P3PA 3B0DB 1PZRA 2DQNC 3O62C 1KX3A 1P3KB 4M6BA 1ID3D 2FJ7C 3LZ1A 1EQZD 1TZYD 4E44A 4WJ3C 5B31A 4LD9A 2HUEC 3AFAA 3W98B 2ZY3A 3R45A 5DNMB 4YM6C 1KX4B 3AV1A 1B67A 3WTPD 3AYWC 1P34C 4WU9B 4YS3C 4H9SC 5GSUD 5E5AA 4XZQC 2YFWB 2BYMA 3AV2C 3KWQB 5B1LC 3REKC 3H0MC 4H9PA 4KGCC 4Z5TD 1P3FB 2HIOD 4J8VB 2Y2PA 4H9OA 5F99A 5KDMB 3NQUB 3AZMC 5CPKC 3AZKA 5BNVB 5JRGD 3X1VC 3MGQC 3KSYA 5C3IB 5BO0B 5CPJD 4KUDA 1M1AC 2IO5B 4Z66A 1BH8A 3MGSA 4J8XC 3UTBB 3AZJC 1HQ3D 5B0ZC 2RIQA 3W97C 3KXBC 4UUZA 2CV5C 3C1BA 1P3GB 3W96B 5GT3B 2J8PA 1F66B 1U35A 3AN2B 4EO5C 4J8VD 1P3PB 4X23C 3AZND 1KX3B 5AVCC 3W99A 1BFMA 4Z2MH 3AZED 2AROC 5CP6A 5GSUA 4KHAA 4WU8D 5BT1D 5B31B 3AZGC 3MVDB 3AFAB 3WA9C 2PYOC 5B33C 5AVBC 5AY8C 4Z5TA 3R45B 3REHD 3KUYA 3UT9C 3UTAB 5B32G 3AZID 5AV9D 2Y2KA 3V9RA 4JJND 3FDDA 3LJAA 5GXQA 3B6GC 5AV5D 5JRGA 4R8PD 5JA4B 1ZLAD 5B32B 3W96D 3X1TD 5GT3D 2BYMB 3LZ0B 3NQJA 4J8UD 1F66D 4H9PB 5CPJA 1TAFB 1H3OA 5GT0D 3WKJC 1M19A 5B24B 3WAAC 3TU4C 2G5IC 5F99B 4G92C 3AZKB 3AZLA 3B0BA 3X1UA 1HQ3A 1P3LA 4H9QB 3EPKA 1M18C 2XD5A 3EPLA 5B40A 1Z2CB 1P3AB 3LZ1D 1AOIA 4ZUXC 4KUDB 5B1MC 3LELC 1Q9CA 5B31D 3REJD 4Z66B 4LD9D 2NZDD 2NQBC 5BS7A 3A6NB 4XUJC 2Y2HA 4HGAC 5B2IC 2FJ7A 3RELC 3AV1D 3AZNA 2L5AA 1ID3C 5E5AD 2F8NH 2RVQC 1EQZB 1TZYB 4YM6A 4UPKA 1N1JA 5F99D 3REHA 3AYWA 1P34A 2F8NA 2NQBA 3AZIA 4JJNA 2BG1A 4XZQA 3H0RC 3AV2A 5AV5A 4R8PA 3REKA 1P3BC 1ZLAA 1S32C 3WA9D 2W8SA 5GSUB 3AZFC 5B0YC 2Y2LA 3AZHD 4J8UA 3AZMA 3X1SC 5CPKA 2JE5A 4Z5TB 2HIOB 3MGSD 3B6FC 3REIC 1P3MD 5AV8C 5JRGB 3C1BD 1M1AA 1P3KC 3NQJB 2BYKB 5CPJB 3EPHA 1H3OB 4J8XA 3AZJA 5AV6D 3REJA 1U35D 2NZDA 3W98C 4DRBA 5DNMC 3MGPA 1HQ3B 4J8WC 4H9RA 3KFUG 1KX4C 5FUGA 3W99D 5B40B 4WU9C 3MGRD 3C1CC 1AOIB 5CP6D 4WNNA 4WZSB 4X23A 3KWQC 1P3FC 3KUYD 5AVCA 1KX5C 1ULYA 4E45A 3LJAD 2AROA 5GXQD 4QLCD 2CWEA 3AZNB 3WA9A 2PYOA 5B33A 5AVBA 5AY8A 5C3IC 3AZEB 4WU8B 3AZHA 1M19D 1P3ID 3F6TA 3REHB 3AYWB 3AZIB 3UTBC 5AV9B 3AZLD 3X1UD 1P3MA 1P3LD 4JJNB 5AV5B 4R8PB 4CSRA 1ZLAB 1P3GC 5CPIC 5B40D 1BH9A 3X1TB 1AOID 3TU4A 3WAAA 4J8UB 3VH6W 2Y2OA 5GT0B 5AV6A 3AN2C 3O62D 1P3PC 4ZBJC 3VH6T 2VQRA 2FJ7D 4ZUXA 1KX3C 5B31G 2Y2QA 3MGRA 3LZ1B 3MNNA 4J8XB 3REJB 3AFAC 3MVDC 4YM6D 4AWLB 4LD9B 2NZDB 3UTAC 2F8ND 3AYWD 3MGPB 1P34D 4YS3D 4H9RB 2XD1A 4XZQD 3AV1B 3AV2D 4QLCA 5B1LD 3REKD 5B32C 4KGCD 4WNNB 5E5AB 3LZ0C 3AZMD 5CPKD 5B24C 4H9OB 1P3IA 3MGQD 3X1VD 2Y2IA 1P3OC 3AZKC 1S32A 4CAYA 2AROB 5BNXA 5B0YA 1M1AD 3WA9B 2PYOB 3X1SA 5AVBB 1P3AC 4KUDC 4J8XD 3REIA 1T3UA 5AV8A 3AZHB 5B0ZD 4Z66C 3AZJD 1BH8B 5DNNC 3W97D 2Y2NA 3KXBD 3MGSB 2CV5D 5B2JC 3O62A 2JSSA 3A6NC 3MGPD 2DF4C 3VH5W 1P3MB 4UUZB 3C1BB 3WAAB 3TU4B 4G91B 3W98A 4X23D 1EQZC 3IP4C 1TZYC 5AV6B 1U35B 4J8WA 5AVCD 4YS3A 3C1CA 4H9SA 1R4VA 2AROD 3W99B 2YFWA 3WTPC 3AZGD 3KWQA 1WWSA 5B1LA 2PYOD 3MGRB 2G5HC 5B33D 5AVBD 1B6WA 5AY8D 3MNNB 5CP6B 5GSUC 3UT9D 4KGCA 4KHAB 1KX5A 5KDMA 4Z5TC 3KUYB 2HIOC 3B6GD 2Y2GA 3MGQA 3X1VA 3V9RB 3B0DC 3LJAB 5GXQB 5JRGC 4QLCB 1WWIA 4DQYB 3WKJD 3WAAD 3TU4D 5CPJC 1M19B 5B0ZA 1P3IB 3W97A 3KXBA 1S32B 5CPIA 4CAYB 2CV5A 1HQ3C 3X1UB 3AZLB 1P3LB 4ZUXD 5BNXB 3A1KA 5B1MD 3LELD 3EPJA 3MNND 2NQBD 5AV8B 4XUJD 2F8NK 2JCHA 5B2ID 3RELD 5BS7C 3O62B 4J8VC 2RVQD 2FJ7B 3AZNC 2ZY2A 4DRAA 3MVDA 3AZGA 2HUEB 3AZEC 2F8NG 3UT9A 3UTAA 4WU8C 5BT1C 4J8WB 4YM6B 2YFVA 2IO5C 5G49A 3REHC 1N1JB 2F8NB 1P34B 5JA4A 1P3BD 3AZIC 5B32A 3C1CB 4YS3B 5AV9C 1S32D 3B6GA 5CHLB 4H9NA 4JJNC 3VH6A 4XZQB 3AZFD 3LZ0A 3AV2B 5B0YD 5AV5C 4NE5A 4R8PC 5B1LB 3REKB 1TAFA 1ZLAC 4WV4B 3X1SD 3W96C 3X1TC 4KGCB 3WKJA 5GT3C 5B24A 3B6FD 1KX5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3REI D;  4J8U C;  5AV8 D;  1P3O A;  1F66 C;  3AZM B;  5CPK B;  5GT0 C;  4H9Q A;  3B0C W;  3MGQ B;  3X1V B;  1P3K D;  1M18 A;  1P3A A;  1JFI A;  3B0C T;  1M1A B;  5B1M A;  3LEL A;  5DNN A;  3W98 D;  3LZ1 C;  5DNM D;  5B2J A;  3AZJ B;  3A6N A;  3REJ C;  5B31 C;  5B0Z B;  4XUJ A;  4AWL C;  4J8W D;  2NQB A;  4LD9 C;  2NZD C;  3W97 B;  5B2I A;  3KXB B;  1KX4 D;  3REL A;  5CPI B;  3MGP C;  2CV5 B;  4WU9 D;  3C1C D;  1ID3 A;  1KU5 A;  5FUG B;  3AV1 C;  1EQZ A;  1TZY A;  3KWQ D;  1P3F D;  5E5A C;  4ZBJ B;  4EO5 B;  4X23 B;  1KX5 D;  5AVC B;  3WTP A;  5F99 C;  1P3B A;  3AZF A;  3AZG B;  5B33 B;  5AY8 B;  3UT9 B;  2HIO A;  3VH5 A;  3B6F A;  3UTB D;  3AZH C;  2YFV B;  5G49 B;  3B6G B;  3MGS C;  1P3G D;  5CPI D;  1P3M C;  4H9N B;  1A7W A;  1P3K A;  2LY8 A;  2BYK A;  4CSR B;  4NE6 A;  4NE3 A;  3C1B C;  3WTP E;  1BH9 B;  3VH5 T;  3WKJ B;  4G91 C;  3AN2 D;  1P3P D;  1P3O B;  4G92 B;  5DNM A;  5AV6 C;  1U35 C;  1KX3 D;  1M18 B;  1KX4 A;  1JFI B;  4WU9 A;  4ZUX B;  3W99 C;  5B1M B;  3LEL B;  3MVD D;  3AFA D;  5DNN B;  3MGR C;  3MNN C;  5CP6 C;  3UTA D;  1P3F A;  4Z2M G;  5B2J B;  4J8V A;  2NQB B;  4XUJ B;  3NQU A;  4HGA B;  5B2I B;  3REL B;  3KUY C;  5BNV A;  5B32 D;  1ID3 B;  3AZE A;  3LJA C;  3LZ0 D;  4QLC C;  5GXQ C;  5BO0 A;  1F1E A;  4WU8 A;  5B24 D;  4NFT A;  1P3O D;  3AZK D;  5AV9 A;  3UTB A;  1M19 C;  1P3I C;  3WTP B;  1P3B B;  1M18 D;  1P3G A;  1P3A D;  3W96 A;  3X1U C;  3AZL C;  3X1T A;  1P3L C;  5GT3 A;  3AZF B;  4KUD D;  5B0Y B;  1F66 A;  1HTA A;  4Z66 D;  5B40 C;  3X1S B;  5DNN D;  5GT0 A;  1AOI C;  3B6F B;  3AN2 A;  5B2J D;  3REI B;  3A6N D;  1P3P A;  3B0D B;  3O62 C;  1KX3 A;  1P3K B;  4M6B A;  1ID3 D;  2FJ7 C;  3LZ1 A;  1EQZ D;  1TZY D;  4E44 A;  5B31 A;  4LD9 A;  2HUE C;  3AFA A;  3W98 B;  3R45 A;  5DNM B;  4YM6 C;  1KX4 B;  3AV1 A;  1B67 A;  3WTP D;  3AYW C;  1P34 C;  4WU9 B;  4YS3 C;  4H9S C;  5GSU D;  5E5A A;  4XZQ C;  2YFW B;  2BYM A;  3AV2 C;  3KWQ B;  5B1L C;  3REK C;  4H9P A;  4KGC C;  4Z5T D;  1P3F B;  2HIO D;  4J8V B;  4H9O A;  5F99 A;  5KDM B;  3NQU B;  3AZM C;  5CPK C;  3AZK A;  5BNV B;  5JRG D;  3X1V C;  3MGQ C;  3KSY A;  5C3I B;  5BO0 B;  5CPJ D;  4KUD A;  1M1A C;  2IO5 B;  4Z66 A;  1BH8 A;  3MGS A;  4J8X C;  3UTB B;  3AZJ C;  1HQ3 D;  5B0Z C;  3W97 C;  3KXB C;  4UUZ A;  2CV5 C;  3C1B A;  1P3G B;  3W96 B;  5GT3 B;  1F66 B;  1U35 A;  3AN2 B;  4EO5 C;  4J8V D;  1P3P B;  4X23 C;  3AZN D;  1KX3 B;  5AVC C;  3W99 A;  1BFM A;  4Z2M H;  3AZE D;  2ARO C;  5CP6 A;  5GSU A;  4KHA A;  4WU8 D;  5BT1 D;  5B31 B;  3AZG C;  3MVD B;  3AFA B;  3WA9 C;  2PYO C;  5B33 C;  5AVB C;  5AY8 C;  4Z5T A;  3R45 B;  3REH D;  3KUY A;  3UT9 C;  3UTA B;  5B32 G;  3AZI D;  5AV9 D;  3V9R A;  4JJN D;  3LJA A;  5GXQ A;  3B6G C;  5AV5 D;  5JRG A;  4R8P D;  5JA4 B;  1ZLA D;  5B32 B;  3W96 D;  3X1T D;  5GT3 D;  2BYM B;  3LZ0 B;  3NQJ A;  4J8U D;  1F66 D;  4H9P B;  5CPJ A;  1TAF B;  1H3O A;  5GT0 D;  3WKJ C;  1M19 A;  5B24 B;  3WAA C;  3TU4 C;  5F99 B;  4G92 C;  3AZK B;  3AZL A;  3B0B A;  3X1U A;  1HQ3 A;  1P3L A;  4H9Q B;  1M18 C;  5B40 A;  1P3A B;  3LZ1 D;  1AOI A;  4ZUX C;  4KUD B;  5B1M C;  3LEL C;  1Q9C A;  5B31 D;  3REJ D;  4Z66 B;  4LD9 D;  2NZD D;  2NQB C;  5BS7 A;  3A6N B;  4XUJ C;  4HGA C;  5B2I C;  2FJ7 A;  3REL C;  3AV1 D;  3AZN A;  2L5A A;  1ID3 C;  5E5A D;  2F8N H;  2RVQ C;  1EQZ B;  1TZY B;  4YM6 A;  1N1J A;  5F99 D;  3REH A;  3AYW A;  1P34 A;  2F8N A;  3AZI A;  4JJN A;  4XZQ A;  3AV2 A;  5AV5 A;  4R8P A;  3REK A;  1P3B C;  1ZLA A;  1S32 C;  5GSU B;  3AZF C;  5B0Y C;  3AZH D;  4J8U A;  3AZM A;  3X1S C;  5CPK A;  4Z5T B;  2HIO B;  3MGS D;  3B6F C;  3REI C;  1P3M D;  5AV8 C;  5JRG B;  3C1B D;  1M1A A;  1P3K C;  3NQJ B;  2BYK B;  5CPJ B;  1H3O B;  4J8X A;  3AZJ A;  5AV6 D;  3REJ A;  1U35 D;  2NZD A;  3W98 C;  4DRB A;  5DNM C;  3MGP A;  1HQ3 B;  4J8W C;  4H9R A;  1KX4 C;  5FUG A;  3W99 D;  5B40 B;  4WU9 C;  3MGR D;  3C1C C;  1AOI B;  5CP6 D;  4WNN A;  4WZS B;  4X23 A;  3KWQ C;  1P3F C;  3KUY D;  5AVC A;  1KX5 C;  1ULY A;  4E45 A;  3LJA D;  2ARO A;  5GXQ D;  4QLC D;  2CWE A;  3AZN B;  3WA9 A;  2PYO A;  5B33 A;  5AVB A;  5AY8 A;  5C3I C;  3AZE B;  4WU8 B;  3AZH A;  1M19 D;  1P3I D;  3REH B;  3AYW B;  3AZI B;  3UTB C;  5AV9 B;  3AZL D;  3X1U D;  1P3M A;  1P3L D;  4JJN B;  5AV5 B;  4R8P B;  4CSR A;  1ZLA B;  1P3G C;  5CPI C;  5B40 D;  1BH9 A;  3X1T B;  1AOI D;  3TU4 A;  3WAA A;  4J8U B;  3VH6 W;  5GT0 B;  5AV6 A;  3AN2 C;  3O62 D;  1P3P C;  4ZBJ C;  3VH6 T;  2FJ7 D;  4ZUX A;  1KX3 C;  5B31 G;  3MGR A;  3LZ1 B;  3MNN A;  4J8X B;  3REJ B;  3AFA C;  3MVD C;  4YM6 D;  4AWL B;  4LD9 B;  2NZD B;  3UTA C;  2F8N D;  3AYW D;  3MGP B;  1P34 D;  4YS3 D;  4H9R B;  4XZQ D;  3AV1 B;  3AV2 D;  4QLC A;  5B1L D;  3REK D;  5B32 C;  4KGC D;  4WNN B;  5E5A B;  3LZ0 C;  3AZM D;  5CPK D;  5B24 C;  4H9O B;  1P3I A;  3MGQ D;  3X1V D;  1P3O C;  3AZK C;  1S32 A;  4CAY A;  2ARO B;  5BNX A;  5B0Y A;  1M1A D;  3WA9 B;  2PYO B;  3X1S A;  5AVB B;  1P3A C;  4KUD C;  4J8X D;  3REI A;  3AZH B;  5AV8 A;  3AZJ D;  5B0Z D;  4Z66 C;  1BH8 B;  5DNN C;  3W97 D;  3KXB D;  3MGS B;  2CV5 D;  5B2J C;  3O62 A;  2JSS A;  3A6N C;  3MGP D;  3VH5 W;  1P3M B;  4UUZ B;  3C1B B;  3WAA B;  3TU4 B;  4G91 B;  3W98 A;  4X23 D;  1EQZ C;  1TZY C;  5AV6 B;  1U35 B;  4J8W A;  5AVC D;  4YS3 A;  3C1C A;  4H9S A;  1R4V A;  2ARO D;  3W99 B;  2YFW A;  3WTP C;  3AZG D;  3KWQ A;  1WWS A;  5B1L A;  2PYO D;  3MGR B;  5B33 D;  3WA9 D;  5AVB D;  1B6W A;  5AY8 D;  3MNN B;  5CP6 B;  5GSU C;  3UT9 D;  4KGC A;  4KHA B;  1KX5 A;  5KDM A;  4Z5T C;  3KUY B;  2HIO C;  3B6G D;  3MGQ A;  3X1V A;  3V9R B;  3B0D C;  3LJA B;  5GXQ B;  5JRG C;  4QLC B;  1WWI A;  3WKJ D;  3WAA D;  3TU4 D;  5CPJ C;  1M19 B;  5B0Z A;  1P3I B;  3W97 A;  3KXB A;  1S32 B;  5CPI A;  4CAY B;  2CV5 A;  1HQ3 C;  3X1U B;  3AZL B;  1P3L B;  4ZUX D;  5BNX B;  5B1M D;  3LEL D;  3MNN D;  2NQB D;  5AV8 B;  4XUJ D;  2F8N K;  5B2I D;  3REL D;  5BS7 C;  3O62 B;  4J8V C;  2RVQ D;  2FJ7 B;  3AZN C;  4DRA A;  3MVD A;  3AZG A;  2HUE B;  3AZE C;  2F8N G;  3UT9 A;  3UTA A;  4WU8 C;  5BT1 C;  4J8W B;  4YM6 B;  2YFV A;  2IO5 C;  5G49 A;  3REH C;  1N1J B;  2F8N B;  1P34 B;  5JA4 A;  1P3B D;  3AZI C;  5B32 A;  3C1C B;  4YS3 B;  5AV9 C;  1S32 D;  3B6G A;  5CHL B;  4H9N A;  4JJN C;  3VH6 A;  4XZQ B;  3AZF D;  3LZ0 A;  3AV2 B;  5B0Y D;  4NE5 A;  4R8P C;  5B1L B;  5AV5 C;  3REK B;  1TAF A;  1ZLA C;  4WV4 B;  3X1S D;  3W96 C;  3X1T C;  4KGC B;  3WKJ A;  5GT3 C;  5B24 A;  3B6F D;  1KX5 B; 
#chains in the Genus database with same CATH topology
 3REI D;  4J8U C;  5AV8 D;  1P3O A;  1F66 C;  3AZM B;  5CPK B;  5GT0 C;  2ZM5 A;  4H9Q A;  3B0C W;  2UWX A;  3MGQ B;  3X1V B;  1P3K D;  1M18 A;  1P3A A;  1JFI A;  3B0C T;  1M1A B;  5B1M A;  3LEL A;  5DNN A;  3W98 D;  2FFF B;  3LZ1 C;  5DNM D;  5B2J A;  3AZJ B;  3A6N A;  3REJ C;  5B31 C;  3EG5 B;  4XUJ A;  5B0Z B;  4J8W D;  4AWL C;  4LD9 C;  2NZD C;  3W97 B;  5B2I A;  3KXB B;  1KX4 D;  3REL A;  5CPI B;  3MGP C;  2CV5 B;  4WU9 D;  3C1C D;  1ID3 A;  1KU5 A;  5FUG B;  3AV1 C;  1EQZ A;  1TZY A;  3KWQ D;  1P3F D;  5E5A C;  4ZBJ B;  4EO5 B;  4X23 B;  1KX5 D;  3H0L C;  5AVC B;  3WTP A;  5F99 C;  1P3B A;  3AZF A;  3AZG B;  2ZY5 A;  5B33 B;  5AY8 B;  3UT9 B;  2HIO A;  3VH5 A;  3B6F A;  3UTB D;  3AZH C;  2YFV B;  5G49 B;  3B6G B;  3MGS C;  1P3G D;  5CPI D;  1P3M C;  4H9N B;  1A7W A;  1P3K A;  2LY8 A;  2BYK A;  4CSR B;  4NE6 A;  4NE3 A;  3C1B C;  3WTP E;  3AL0 C;  1BH9 B;  3VH5 T;  3WKJ B;  4G91 C;  3AN2 D;  3A1I A;  1P3P D;  1P3O B;  4G92 B;  2Y2J A;  5DNM A;  5AV6 C;  1U35 C;  1KX3 D;  1M18 B;  1KX4 A;  2Y2M A;  1JFI B;  4WU9 A;  4ZUX B;  3W99 C;  5B1M B;  3LEL B;  3MVD D;  3AFA D;  5DNN B;  3MGR C;  3MNN C;  5CP6 C;  3UTA D;  1P3F A;  4Z2M G;  5B2J B;  4J8V A;  2NQB B;  4XUJ B;  3NQU A;  4HGA B;  5B2I B;  2ZY4 A;  3REL B;  3KUY C;  5BNV A;  5B32 D;  1ID3 B;  3AZE A;  3LJA C;  3LZ0 D;  4QLC C;  5GXQ C;  5BO0 A;  1F1E A;  4WU8 A;  5B24 D;  2F2A C;  4NFT A;  1P3O D;  1W2E A;  5AV9 A;  3UTB A;  3AZK D;  1M19 C;  1P3I C;  3WTP B;  1P3B B;  1M18 D;  1P3G A;  1P3A D;  3W96 A;  3X1U C;  3AZL C;  3X1T A;  1P3L C;  5GT3 A;  3AZF B;  4KUD D;  5B0Y B;  1F66 A;  1HTA A;  4Z66 D;  5B40 C;  3X1S B;  5DNN D;  5GT0 A;  1AOI C;  3B6F B;  3P5J B;  3AN2 A;  5B2J D;  3REI B;  3A6N D;  1P3P A;  3B0D B;  1PZR A;  2DQN C;  3O62 C;  1KX3 A;  1P3K B;  4M6B A;  1ID3 D;  2FJ7 C;  3LZ1 A;  1EQZ D;  1TZY D;  4E44 A;  4WJ3 C;  5B31 A;  4LD9 A;  2HUE C;  3AFA A;  3W98 B;  2ZY3 A;  3R45 A;  5DNM B;  4YM6 C;  1KX4 B;  3AV1 A;  1B67 A;  3WTP D;  3AYW C;  1P34 C;  4WU9 B;  4YS3 C;  4H9S C;  5GSU D;  5E5A A;  4XZQ C;  2YFW B;  2BYM A;  3AV2 C;  3KWQ B;  5B1L C;  3REK C;  3H0M C;  4H9P A;  4KGC C;  4Z5T D;  1P3F B;  2HIO D;  4J8V B;  2Y2P A;  4H9O A;  5F99 A;  5KDM B;  3NQU B;  3AZM C;  5CPK C;  3AZK A;  5BNV B;  5JRG D;  3X1V C;  3MGQ C;  3KSY A;  5C3I B;  5BO0 B;  5CPJ D;  4KUD A;  1M1A C;  2IO5 B;  4Z66 A;  1BH8 A;  3MGS A;  4J8X C;  3UTB B;  3AZJ C;  1HQ3 D;  5B0Z C;  2RIQ A;  3W97 C;  3KXB C;  4UUZ A;  2CV5 C;  3C1B A;  1P3G B;  3W96 B;  5GT3 B;  2J8P A;  1F66 B;  1U35 A;  3AN2 B;  4EO5 C;  4J8V D;  1P3P B;  4X23 C;  3AZN D;  1KX3 B;  5AVC C;  3W99 A;  1BFM A;  4Z2M H;  3AZE D;  2ARO C;  5CP6 A;  5GSU A;  4KHA A;  4WU8 D;  5BT1 D;  5B31 B;  3AZG C;  3MVD B;  3AFA B;  3WA9 C;  2PYO C;  5B33 C;  5AVB C;  5AY8 C;  4Z5T A;  3R45 B;  3REH D;  3KUY A;  3UT9 C;  3UTA B;  5B32 G;  3AZI D;  5AV9 D;  2Y2K A;  3V9R A;  4JJN D;  3FDD A;  3LJA A;  5GXQ A;  3B6G C;  5AV5 D;  5JRG A;  4R8P D;  5JA4 B;  1ZLA D;  5B32 B;  3W96 D;  3X1T D;  5GT3 D;  2BYM B;  3LZ0 B;  3NQJ A;  4J8U D;  1F66 D;  4H9P B;  5CPJ A;  1TAF B;  1H3O A;  5GT0 D;  3WKJ C;  1M19 A;  5B24 B;  3WAA C;  3TU4 C;  2G5I C;  5F99 B;  4G92 C;  3AZK B;  3AZL A;  3B0B A;  3X1U A;  1HQ3 A;  1P3L A;  4H9Q B;  3EPK A;  1M18 C;  2XD5 A;  3EPL A;  5B40 A;  1Z2C B;  1P3A B;  3LZ1 D;  1AOI A;  4ZUX C;  4KUD B;  5B1M C;  3LEL C;  1Q9C A;  5B31 D;  3REJ D;  4Z66 B;  4LD9 D;  2NZD D;  2NQB C;  5BS7 A;  3A6N B;  4XUJ C;  2Y2H A;  4HGA C;  5B2I C;  2FJ7 A;  3REL C;  3AV1 D;  3AZN A;  2L5A A;  1ID3 C;  5E5A D;  2F8N H;  2RVQ C;  1EQZ B;  1TZY B;  4YM6 A;  4UPK A;  1N1J A;  5F99 D;  3REH A;  3AYW A;  1P34 A;  2F8N A;  2NQB A;  3AZI A;  4JJN A;  2BG1 A;  4XZQ A;  3H0R C;  3AV2 A;  5AV5 A;  4R8P A;  3REK A;  1P3B C;  1ZLA A;  1S32 C;  3WA9 D;  2W8S A;  5GSU B;  3AZF C;  5B0Y C;  2Y2L A;  3AZH D;  4J8U A;  3AZM A;  3X1S C;  5CPK A;  2JE5 A;  4Z5T B;  2HIO B;  3MGS D;  3B6F C;  3REI C;  1P3M D;  5AV8 C;  5JRG B;  3C1B D;  1M1A A;  1P3K C;  3NQJ B;  2BYK B;  5CPJ B;  3EPH A;  1H3O B;  4J8X A;  3AZJ A;  5AV6 D;  3REJ A;  1U35 D;  2NZD A;  3W98 C;  4DRB A;  5DNM C;  3MGP A;  1HQ3 B;  4J8W C;  4H9R A;  3KFU G;  1KX4 C;  5FUG A;  3W99 D;  5B40 B;  4WU9 C;  3MGR D;  3C1C C;  1AOI B;  5CP6 D;  4WNN A;  4WZS B;  4X23 A;  3KWQ C;  1P3F C;  3KUY D;  5AVC A;  1KX5 C;  1ULY A;  4E45 A;  3LJA D;  2ARO A;  5GXQ D;  4QLC D;  2CWE A;  3AZN B;  3WA9 A;  2PYO A;  5B33 A;  5AVB A;  5AY8 A;  5C3I C;  3AZE B;  4WU8 B;  3AZH A;  1M19 D;  1P3I D;  3F6T A;  3REH B;  3AYW B;  3AZI B;  3UTB C;  5AV9 B;  3AZL D;  3X1U D;  1P3M A;  1P3L D;  4JJN B;  5AV5 B;  4R8P B;  4CSR A;  1ZLA B;  1P3G C;  5CPI C;  5B40 D;  1BH9 A;  3X1T B;  1AOI D;  3TU4 A;  3WAA A;  4J8U B;  3VH6 W;  2Y2O A;  5GT0 B;  5AV6 A;  3AN2 C;  3O62 D;  1P3P C;  4ZBJ C;  3VH6 T;  2VQR A;  2FJ7 D;  4ZUX A;  1KX3 C;  5B31 G;  2Y2Q A;  3MGR A;  3LZ1 B;  3MNN A;  4J8X B;  3REJ B;  3AFA C;  3MVD C;  4YM6 D;  4AWL B;  4LD9 B;  2NZD B;  3UTA C;  2F8N D;  3AYW D;  3MGP B;  1P34 D;  4YS3 D;  4H9R B;  2XD1 A;  4XZQ D;  3AV1 B;  3AV2 D;  4QLC A;  5B1L D;  3REK D;  5B32 C;  4KGC D;  4WNN B;  5E5A B;  3LZ0 C;  3AZM D;  5CPK D;  5B24 C;  4H9O B;  1P3I A;  3MGQ D;  3X1V D;  2Y2I A;  1P3O C;  3AZK C;  1S32 A;  4CAY A;  2ARO B;  5BNX A;  5B0Y A;  1M1A D;  3WA9 B;  2PYO B;  3X1S A;  5AVB B;  1P3A C;  4KUD C;  4J8X D;  3REI A;  1T3U A;  5AV8 A;  3AZH B;  5B0Z D;  4Z66 C;  3AZJ D;  1BH8 B;  5DNN C;  3W97 D;  2Y2N A;  3KXB D;  3MGS B;  2CV5 D;  5B2J C;  3O62 A;  2JSS A;  3A6N C;  3MGP D;  2DF4 C;  3VH5 W;  1P3M B;  4UUZ B;  3C1B B;  3WAA B;  3TU4 B;  4G91 B;  3W98 A;  4X23 D;  1EQZ C;  3IP4 C;  1TZY C;  5AV6 B;  1U35 B;  4J8W A;  5AVC D;  4YS3 A;  3C1C A;  4H9S A;  1R4V A;  2ARO D;  3W99 B;  2YFW A;  3WTP C;  3AZG D;  3KWQ A;  1WWS A;  5B1L A;  2PYO D;  3MGR B;  2G5H C;  5B33 D;  5AVB D;  1B6W A;  5AY8 D;  3MNN B;  5CP6 B;  5GSU C;  3UT9 D;  4KGC A;  4KHA B;  1KX5 A;  5KDM A;  4Z5T C;  3KUY B;  2HIO C;  3B6G D;  2Y2G A;  3MGQ A;  3X1V A;  3V9R B;  3B0D C;  3LJA B;  5GXQ B;  5JRG C;  4QLC B;  1WWI A;  4DQY B;  3WKJ D;  3WAA D;  3TU4 D;  5CPJ C;  1M19 B;  5B0Z A;  1P3I B;  3W97 A;  3KXB A;  1S32 B;  5CPI A;  4CAY B;  2CV5 A;  1HQ3 C;  3X1U B;  3AZL B;  1P3L B;  4ZUX D;  5BNX B;  3A1K A;  5B1M D;  3LEL D;  3EPJ A;  3MNN D;  2NQB D;  5AV8 B;  4XUJ D;  2F8N K;  2JCH A;  5B2I D;  3REL D;  5BS7 C;  3O62 B;  4J8V C;  2RVQ D;  2FJ7 B;  3AZN C;  2ZY2 A;  4DRA A;  3MVD A;  3AZG A;  2HUE B;  3AZE C;  2F8N G;  3UT9 A;  3UTA A;  4WU8 C;  5BT1 C;  4J8W B;  4YM6 B;  2YFV A;  2IO5 C;  5G49 A;  3REH C;  1N1J B;  2F8N B;  1P34 B;  5JA4 A;  1P3B D;  3AZI C;  5B32 A;  3C1C B;  4YS3 B;  5AV9 C;  1S32 D;  3B6G A;  5CHL B;  4H9N A;  4JJN C;  3VH6 A;  4XZQ B;  3AZF D;  3LZ0 A;  3AV2 B;  5B0Y D;  5AV5 C;  4NE5 A;  4R8P C;  5B1L B;  3REK B;  1TAF A;  1ZLA C;  4WV4 B;  3X1S D;  3W96 C;  3X1T C;  4KGC B;  3WKJ A;  5GT3 C;  5B24 A;  3B6F D;  1KX5 B; 
#chains in the Genus database with same CATH homology
 3REI D;  4J8U C;  5AV8 D;  1P3O A;  1F66 C;  3AZM B;  5CPK B;  5GT0 C;  2ZM5 A;  4H9Q A;  3B0C W;  2UWX A;  3MGQ B;  3X1V B;  1P3K D;  1M18 A;  1P3A A;  1JFI A;  3B0C T;  1M1A B;  5B1M A;  3LEL A;  5DNN A;  3W98 D;  2FFF B;  3LZ1 C;  5DNM D;  5B2J A;  3AZJ B;  3A6N A;  3REJ C;  5B31 C;  3EG5 B;  4XUJ A;  5B0Z B;  4J8W D;  4AWL C;  4LD9 C;  2NZD C;  3W97 B;  5B2I A;  3KXB B;  1KX4 D;  3REL A;  5CPI B;  3MGP C;  2CV5 B;  4WU9 D;  3C1C D;  1ID3 A;  1KU5 A;  5FUG B;  3AV1 C;  1EQZ A;  1TZY A;  3KWQ D;  1P3F D;  5E5A C;  4ZBJ B;  4EO5 B;  4X23 B;  1KX5 D;  3H0L C;  5AVC B;  3WTP A;  5F99 C;  1P3B A;  3AZF A;  3AZG B;  2ZY5 A;  5B33 B;  5AY8 B;  3UT9 B;  2HIO A;  3VH5 A;  3B6F A;  3UTB D;  3AZH C;  2YFV B;  5G49 B;  3B6G B;  3MGS C;  1P3G D;  5CPI D;  1P3M C;  4H9N B;  1A7W A;  1P3K A;  2LY8 A;  2BYK A;  4CSR B;  4NE6 A;  4NE3 A;  3C1B C;  3WTP E;  3AL0 C;  1BH9 B;  3VH5 T;  3WKJ B;  4G91 C;  3AN2 D;  3A1I A;  1P3P D;  1P3O B;  4G92 B;  2Y2J A;  5DNM A;  5AV6 C;  1U35 C;  1KX3 D;  1M18 B;  1KX4 A;  2Y2M A;  1JFI B;  4WU9 A;  4ZUX B;  3W99 C;  5B1M B;  3LEL B;  3MVD D;  3AFA D;  5DNN B;  3MGR C;  3MNN C;  5CP6 C;  3UTA D;  1P3F A;  4Z2M G;  5B2J B;  4J8V A;  2NQB B;  4XUJ B;  3NQU A;  4HGA B;  5B2I B;  2ZY4 A;  3REL B;  3KUY C;  5BNV A;  5B32 D;  1ID3 B;  3AZE A;  3LJA C;  3LZ0 D;  4QLC C;  5GXQ C;  5BO0 A;  1F1E A;  4WU8 A;  5B24 D;  2F2A C;  4NFT A;  1P3O D;  1W2E A;  5AV9 A;  3UTB A;  3AZK D;  1M19 C;  1P3I C;  3WTP B;  1P3B B;  1M18 D;  1P3G A;  1P3A D;  3W96 A;  3X1U C;  3AZL C;  3X1T A;  1P3L C;  5GT3 A;  3AZF B;  4KUD D;  5B0Y B;  1F66 A;  1HTA A;  4Z66 D;  5B40 C;  3X1S B;  5DNN D;  5GT0 A;  1AOI C;  3B6F B;  3P5J B;  3AN2 A;  5B2J D;  3REI B;  3A6N D;  1P3P A;  3B0D B;  1PZR A;  2DQN C;  3O62 C;  1KX3 A;  1P3K B;  4M6B A;  1ID3 D;  2FJ7 C;  3LZ1 A;  1EQZ D;  1TZY D;  4E44 A;  4WJ3 C;  5B31 A;  4LD9 A;  2HUE C;  3AFA A;  3W98 B;  2ZY3 A;  3R45 A;  5DNM B;  4YM6 C;  1KX4 B;  3AV1 A;  1B67 A;  3WTP D;  3AYW C;  1P34 C;  4WU9 B;  4YS3 C;  4H9S C;  5GSU D;  5E5A A;  4XZQ C;  2YFW B;  2BYM A;  3AV2 C;  3KWQ B;  5B1L C;  3REK C;  3H0M C;  4H9P A;  4KGC C;  4Z5T D;  1P3F B;  2HIO D;  4J8V B;  2Y2P A;  4H9O A;  5F99 A;  5KDM B;  3NQU B;  3AZM C;  5CPK C;  3AZK A;  5BNV B;  5JRG D;  3X1V C;  3MGQ C;  3KSY A;  5C3I B;  5BO0 B;  5CPJ D;  4KUD A;  1M1A C;  2IO5 B;  4Z66 A;  1BH8 A;  3MGS A;  4J8X C;  3UTB B;  3AZJ C;  1HQ3 D;  5B0Z C;  2RIQ A;  3W97 C;  3KXB C;  4UUZ A;  2CV5 C;  3C1B A;  1P3G B;  3W96 B;  5GT3 B;  2J8P A;  1F66 B;  1U35 A;  3AN2 B;  4EO5 C;  4J8V D;  1P3P B;  4X23 C;  3AZN D;  1KX3 B;  5AVC C;  3W99 A;  1BFM A;  4Z2M H;  3AZE D;  2ARO C;  5CP6 A;  5GSU A;  4KHA A;  4WU8 D;  5BT1 D;  5B31 B;  3AZG C;  3MVD B;  3AFA B;  3WA9 C;  2PYO C;  5B33 C;  5AVB C;  5AY8 C;  4Z5T A;  3R45 B;  3REH D;  3KUY A;  3UT9 C;  3UTA B;  5B32 G;  3AZI D;  5AV9 D;  2Y2K A;  3V9R A;  4JJN D;  3FDD A;  3LJA A;  5GXQ A;  3B6G C;  5AV5 D;  5JRG A;  4R8P D;  5JA4 B;  1ZLA D;  5B32 B;  3W96 D;  3X1T D;  5GT3 D;  2BYM B;  3LZ0 B;  3NQJ A;  4J8U D;  1F66 D;  4H9P B;  5CPJ A;  1TAF B;  1H3O A;  5GT0 D;  3WKJ C;  1M19 A;  5B24 B;  3WAA C;  3TU4 C;  2G5I C;  5F99 B;  4G92 C;  3AZK B;  3AZL A;  3B0B A;  3X1U A;  1HQ3 A;  1P3L A;  4H9Q B;  3EPK A;  1M18 C;  2XD5 A;  3EPL A;  5B40 A;  1Z2C B;  1P3A B;  3LZ1 D;  1AOI A;  4ZUX C;  4KUD B;  5B1M C;  3LEL C;  1Q9C A;  5B31 D;  3REJ D;  4Z66 B;  4LD9 D;  2NZD D;  2NQB C;  5BS7 A;  3A6N B;  4XUJ C;  2Y2H A;  4HGA C;  5B2I C;  2FJ7 A;  3REL C;  3AV1 D;  3AZN A;  2L5A A;  1ID3 C;  5E5A D;  2F8N H;  2RVQ C;  1EQZ B;  1TZY B;  4YM6 A;  4UPK A;  1N1J A;  5F99 D;  3REH A;  3AYW A;  1P34 A;  2F8N A;  2NQB A;  3AZI A;  4JJN A;  2BG1 A;  4XZQ A;  3H0R C;  3AV2 A;  5AV5 A;  4R8P A;  3REK A;  1P3B C;  1ZLA A;  1S32 C;  3WA9 D;  2W8S A;  5GSU B;  3AZF C;  5B0Y C;  2Y2L A;  3AZH D;  4J8U A;  3AZM A;  3X1S C;  5CPK A;  2JE5 A;  4Z5T B;  2HIO B;  3MGS D;  3B6F C;  3REI C;  1P3M D;  5AV8 C;  5JRG B;  3C1B D;  1M1A A;  1P3K C;  3NQJ B;  2BYK B;  5CPJ B;  3EPH A;  1H3O B;  4J8X A;  3AZJ A;  5AV6 D;  3REJ A;  1U35 D;  2NZD A;  3W98 C;  4DRB A;  5DNM C;  3MGP A;  1HQ3 B;  4J8W C;  4H9R A;  3KFU G;  1KX4 C;  5FUG A;  3W99 D;  5B40 B;  4WU9 C;  3MGR D;  3C1C C;  1AOI B;  5CP6 D;  4WNN A;  4WZS B;  4X23 A;  3KWQ C;  1P3F C;  3KUY D;  5AVC A;  1KX5 C;  1ULY A;  4E45 A;  3LJA D;  2ARO A;  5GXQ D;  4QLC D;  2CWE A;  3AZN B;  3WA9 A;  2PYO A;  5B33 A;  5AVB A;  5AY8 A;  5C3I C;  3AZE B;  4WU8 B;  3AZH A;  1M19 D;  1P3I D;  3F6T A;  3REH B;  3AYW B;  3AZI B;  3UTB C;  5AV9 B;  3AZL D;  3X1U D;  1P3M A;  1P3L D;  4JJN B;  5AV5 B;  4R8P B;  4CSR A;  1ZLA B;  1P3G C;  5CPI C;  5B40 D;  1BH9 A;  3X1T B;  1AOI D;  3TU4 A;  3WAA A;  4J8U B;  3VH6 W;  2Y2O A;  5GT0 B;  5AV6 A;  3AN2 C;  3O62 D;  1P3P C;  4ZBJ C;  3VH6 T;  2VQR A;  2FJ7 D;  4ZUX A;  1KX3 C;  5B31 G;  2Y2Q A;  3MGR A;  3LZ1 B;  3MNN A;  4J8X B;  3REJ B;  3AFA C;  3MVD C;  4YM6 D;  4AWL B;  4LD9 B;  2NZD B;  3UTA C;  2F8N D;  3AYW D;  3MGP B;  1P34 D;  4YS3 D;  4H9R B;  2XD1 A;  4XZQ D;  3AV1 B;  3AV2 D;  4QLC A;  5B1L D;  3REK D;  5B32 C;  4KGC D;  4WNN B;  5E5A B;  3LZ0 C;  3AZM D;  5CPK D;  5B24 C;  4H9O B;  1P3I A;  3MGQ D;  3X1V D;  2Y2I A;  1P3O C;  3AZK C;  1S32 A;  4CAY A;  2ARO B;  5BNX A;  5B0Y A;  1M1A D;  3WA9 B;  2PYO B;  3X1S A;  5AVB B;  1P3A C;  4KUD C;  4J8X D;  3REI A;  1T3U A;  5AV8 A;  3AZH B;  5B0Z D;  4Z66 C;  3AZJ D;  1BH8 B;  5DNN C;  3W97 D;  2Y2N A;  3KXB D;  3MGS B;  2CV5 D;  5B2J C;  3O62 A;  2JSS A;  3A6N C;  3MGP D;  2DF4 C;  3VH5 W;  1P3M B;  4UUZ B;  3C1B B;  3WAA B;  3TU4 B;  4G91 B;  3W98 A;  4X23 D;  1EQZ C;  3IP4 C;  1TZY C;  5AV6 B;  1U35 B;  4J8W A;  5AVC D;  4YS3 A;  3C1C A;  4H9S A;  1R4V A;  2ARO D;  3W99 B;  2YFW A;  3WTP C;  3AZG D;  3KWQ A;  1WWS A;  5B1L A;  2PYO D;  3MGR B;  2G5H C;  5B33 D;  5AVB D;  1B6W A;  5AY8 D;  3MNN B;  5CP6 B;  5GSU C;  3UT9 D;  4KGC A;  4KHA B;  1KX5 A;  5KDM A;  4Z5T C;  3KUY B;  2HIO C;  3B6G D;  2Y2G A;  3MGQ A;  3X1V A;  3V9R B;  3B0D C;  3LJA B;  5GXQ B;  5JRG C;  4QLC B;  1WWI A;  4DQY B;  3WKJ D;  3WAA D;  3TU4 D;  5CPJ C;  1M19 B;  5B0Z A;  1P3I B;  3W97 A;  3KXB A;  1S32 B;  5CPI A;  4CAY B;  2CV5 A;  1HQ3 C;  3X1U B;  3AZL B;  1P3L B;  4ZUX D;  5BNX B;  3A1K A;  5B1M D;  3LEL D;  3EPJ A;  3MNN D;  2NQB D;  5AV8 B;  4XUJ D;  2F8N K;  2JCH A;  5B2I D;  3REL D;  5BS7 C;  3O62 B;  4J8V C;  2RVQ D;  2FJ7 B;  3AZN C;  2ZY2 A;  4DRA A;  3MVD A;  3AZG A;  2HUE B;  3AZE C;  2F8N G;  3UT9 A;  3UTA A;  4WU8 C;  5BT1 C;  4J8W B;  4YM6 B;  2YFV A;  2IO5 C;  5G49 A;  3REH C;  1N1J B;  2F8N B;  1P34 B;  5JA4 A;  1P3B D;  3AZI C;  5B32 A;  3C1C B;  4YS3 B;  5AV9 C;  1S32 D;  3B6G A;  5CHL B;  4H9N A;  4JJN C;  3VH6 A;  4XZQ B;  3AZF D;  3LZ0 A;  3AV2 B;  5B0Y D;  5AV5 C;  4NE5 A;  4R8P C;  5B1L B;  3REK B;  1TAF A;  1ZLA C;  4WV4 B;  3X1S D;  3W96 C;  3X1T C;  4KGC B;  3WKJ A;  5GT3 C;  5B24 A;  3B6F D;  1KX5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...