5GT0D

Crystal structure of nucleosome complex with human testis-specific histone variants, th2a
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
98
structure length
98
Chain Sequence
KRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Structural analyses of the nucleosome complexes with human testis-specific histone variants, hTh2a and hTh2b
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 98
sequence length 98
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5gt0D00
3WA9A 4WU9C 2RVQD 3AN2B 1P3PB 3AN2C 1KX4C 2CV5A 2HIOD 3UTBB 4JJNC 1ZLAA 2PYOB 5AV9D 4KUDD 5AV8B 3MGSA 4Z5TB 1ID3C 3VH5W 3A6NC 3W97D 3MGQB 3AZGB 1AOIA 3AYWA 3AZLD 1P3PD 4X23C 5E5AB 4XZQB 5FUGB 5B31A 5GSUB 5B24A 4H9PA 1H3OB 3MGPA 5GSUC 3W98B 3AZFB 1P3BB 1U35B 4QLCB 5CPIB 3B6GC 5B1LD 5GT3D 5E5AD 1TZYC 1KX3A 2BYKB 4YS3B 3W96C 3X1SD 3VH5A 3KXBD 2FJ7C 5BT1D 5B33A 3LJAA 3AZFD 4J8WC 5B2JC 5DNNB 1S32D 2L5AA 3AZKA 5CPJA 1P3GC 5B32C 3AZND 1P3LD 2NQBA 5KDMB 3AZJA 5AVCB 3AZED 3REJD 1P3IB 5GT0C 5AVCC 1F66B 4YS3D 4LD9D 3REID 2F8NB 4H9SA 5GXQA 4Z66A 5DNMC 3C1CB 3O62C 5B40B 5CHLB 3MVDB 1KX5A 5AV5D 3AV1B 3X1TB 3REHA 1P3AB 3WTPB 3LZ1D 3AZMB 3WTPE 3AZHA 3X1VA 1P3KB 3MGSC 1M19D 5B40D 3MNNA 5BO0A 5CP6D 4WU8D 3NQUB 5BNVA 3X1TD 3WKJB 3KWQD 5BS7A 3AYWC 2F8NK 4Z2MH 3RELD 4M6BA 3B6FA 1P3MD 4J8UC 3W99D 5B1MD 4H9RA 5JRGC 5B24C 3MGPC 5B2ID 3B0DC 1HQ3D 5BNXB 3AFAB 3MGRB 3UT9B 4WU9A 4WZSB 3AN2A 1P34C 4NFTA 4J8XB 4JJNA 3UTBA 4WNNB 5CPKB 1M1AB 3LELD 5AV8A 2BYMB 3KUYD 4Z5TA 4J8VB 3WAAB 3LJAC 3AZGA 3MGRD 4R8PB 3AZKC 2NQBC 5AY8D 4J8XD 4XZQA 5AV6C 5CPKD 5B0YC 4H9SC 5GXQC 5GSUA 4Z66C 1R4VA 3W98A 1P3BA 4CAYB 2JSSA 3B6GA 1U35A 4QLCA 5CPIA 4R8PD 1EQZB 4YM6D 1KX5C 1P3OD 2BYKA 3W96A 4NE3A 4ZBJB 4ZBJC 2HUEB 1N1JB 4J8WA 1P3GA 3X1VC 3AZHC 5B32A 5AVBD 5KDMA 3MNNC 5AVCA 4ZUXC 1P3IA 1F66A 2F8NA 5B33D 4H9QB 2RVQC 4H9NB 5BS7C 2YFVA 4HGAB 3C1CA 2HIOC 3TU4D 5CPJD 5AV9B 4KUDB 1P3FB 3AZJD 4G91C 5F99D 3MVDA 3REKD 3W97C 3AZLB 1P3AA 1P3PC 3VH6T 2F8NG 3AZMA 4E45A 3UTBC 2NZDB 2PYOC 1P3KA 1P3FD 5AV8C 3W96B 4Z5TC 1JFIB 3NQUA 3MGQC 3AZGC 3WKJA 5B1LB 5GT3B 1TAFB 4NE6A 5E5AC 3LZ0D 4J8UA 3X1SB 3KXBB 5JRGA 2NZDD 4XZQC 5B0ZB 5BT1C 3W98C 3AZFC 1P3BC 3AFAA 3UT9A 3AV2D 1S32B 1U35C 5CPIC 4QLCC 3X1UD 3AZNB 1P3LB 3AZEB 3AZNC 1P34A 3REJB 4LD9B 5C3IB 4KGCB 3REIB 1M1AA 4YS3C 1M18D 4G92B 5B0ZD 4J8VA 4WU9D 1KX4D 5G49B 5DNNC 5AV5B 2IO5B 5AV6A 1P3IC 1ID3D 1WWIA 5B0YA 1F66C 3A6ND 4KGCD 3KSYA 3LZ1B 3C1CC 4X23D 4AWLB 1M19B 4DRAA 1EQZA 5CP6B 4WU8B 5B40C 3MVDC 3R45B 3KWQB 3AV1C 3X1TC 3V9RA 1Q9CA 1P3AC 3RELB 3WTPC 3C1BB 1P3MB 3B6GD 3W99B 5B1MB 3AZMC 3AZIB 1TZYD 1P3KC 5B2IB 3UTAD 4XUJD 4ZUXA 1HQ3B 2FJ7D 3B0CT 4NE5A 2AROB 3WKJC 4H9NA 5B2JD 2HIOA 1P3GD 3C1BD 4EO5B 3LELB 4H9OB 5AV9A 4KUDA 3AZID 3KUYB 3KUYC 5GT0D 3WA9B 3W97A 5DNMD 3MGRC 2AROD 3AFAC 1F1EA 3UT9C 2CV5B 3AZLA 1P3PA 5AY8B 3O62D 4J8XC 1M1AC 5CPKC 2PYOA 1B67A 1BH8B 3WA9D 3WAAC 4J8VC 3MGQA 1JFIA 1AOIB 2F8NH 2CV5D 5B1LA 4R8PC 5GT3A 4YM6B 5E5AA 1ZLAD 1TAFA 1P3OB 3MGSD 5FUGA 3X1SA 5JA4B 3KXBA 1H3OA 3AZFA 1AOID 3AYWD 4KHAB 1S32A 5AVBB 3AZNA 4J8UD 1P3LA 4CSRB 3AZEA 1EQZC 4LD9A 2YFWB 5B31D 4YS3A 3REIA 5B24D 3MGPD 5B33B 3B0BA 2HUEC 3TU4B 5CPJB 3VH5T 5DNNA 5G49A 3AZJB 5F99B 1KX3D 3REKB 1HTAA 3LJAD 3LZ1A 4HGAC 3AZKD 5AV9C 4KUDC 2NQBD 1P3FC 5B40A 3REHB 1B6WA 3AV1A 3X1TA 5GXQD 3R45A 4Z66D 3KWQA 3AZLC 3RELA 3LZ0B 3WTPA 4Z2MG 1P3MA 3W99A 5B1MA 2NZDC 5BO0B 1BH9B 1KX5D 5BNVB 5B2IA 1HQ3A 3REHD 3AV2B 3AV2C 3X1UB 3B6FB 5B1LC 5GT3C 3AZHD 3X1VD 3LELA 4H9OA 1M18B 3X1SC 3KXBC 3MNND 3KUYA 1M18C 4WU9B 5B0ZC 3MGRA 5BNXA 1KX4B 1S32C 4JJNB 3B6FD 1P3LC 5AY8A 3AZEC 4J8XA 3REJC 1ID3B 4WNNA 3NQJB 5C3IC 3A6NB 3REIC 5CPKA 4KGCC 2BYMA 1BH8A 4G92C 3WAAA 4X23B 3AN2D 1BFMA 4R8PA 4YM6A 4JJND 3UTBD 5AV5C 1P3OA 2PYOD 5AV8D 2IO5C 4Z5TD 5JA4A 1KU5A 3MGQD 3AZGD 3B6GB 3LZ1C 2CWEA 4CAYA 4KHAA 1TZYB 5AVBA 3UTAB 3VH6W 4XUJB 4AWLC 3UTAC 4CSRA 1M19C 4XUJC 5CP6C 4XZQD 4WU8C 2FJ7B 2YFWA 4UUZB 5GSUD 5B31G 3KWQC 3W98D 1P3BD 4J8WB 1N1JA 5B2JB 3RELC 1P3GB 3TU4A 5B32B 4QLCD 5CPID 3C1BC 1U35D 1P3MC 3W99C 5B1MC 3AZIC 5GT0B 5F99A 3W96D 2LY8A 5B2IC 3REKA 5DNMB 1HQ3C 2YFVB 2AROC 4H9QA 4E44A 4J8WD 3O62B 5DNND 5B32D 4EO5C 3VH6A 3LELC 1P3FA 1ULYA 1WWSA 4DRBA 5AVCD 1P3ID 1F66D 3WA9C 2F8ND 3C1CD 4LD9C 2CV5C 1ZLAB 3LZ0A 1ZLAC 5AY8C 3MGSB 2NZDA 1BH9A 3MVDD 3AV1D 3AYWB 1AOIC 3AV2A 1A7WA 1P3AD 3X1UA 3WTPD 4J8UB 4YM6C 5JRGB 3AZMD 5B31B 5B31C 5B24B 4H9PB 3MGPB 1P3KD 3B0DB 1P3OC 1M18A 5B0ZA 3WKJD 1KX4A 1P34B 1KX3B 5AVBC 1KX3C 3REJA 5JRGD 4KGCA 1ID3A 3NQJA 3A6NA 3LJAB 5B33C 3AFAD 3UT9D 3AZKB 3B0CW 4X23A 3TU4C 5CPJC 2NQBB 1P34D 3AZJC 5AV6B 5B0YB 5AV5A 5F99C 1M1AD 3REKC 5GXQB 4Z66B 4J8VD 3WAAD 1KX5B 1TZYA 3UTAA 1M19A 4XUJA 5CP6A 5AV6D 4WU8A 5B0YD 3V9RB 2FJ7A 3REHC 4UUZA 5B2JA 3AZHB 3X1VB 3LZ0C 3C1BA 3AZIA 3MNNB 1EQZD 4ZUXB 5GT0A 5DNMA 2AROA 4WV4B 2HIOB 3X1UC 3B6FC 4H9RB 3O62A 4G91B 3W97B 5B32G 4ZUXD
chains in the Genus database with same CATH superfamily
3WA9A 4WU9C 2RVQD 3AN2B 1P3PB 3AN2C 1KX4C 2CV5A 2HIOD 3UTBB 2ZM5A 4JJNC 1ZLAA 2PYOB 5AV9D 4KUDD 5AV8B 3MGSA 4Z5TB 1ID3C 3VH5W 3A6NC 3W97D 3MGQB 3AZGB 1AOIA 3AYWA 3AZLD 1P3PD 4X23C 5E5AB 4XZQB 5FUGB 5B31A 5GSUB 5B24A 3H0RC 1H3OB 3IP4C 4H9PA 5GSUC 2VQRA 3MGPA 3AZFB 1P3BB 3W98B 1U35B 4QLCB 5CPIB 3B6GC 5B1LD 5GT3D 5E5AD 1TZYC 1KX3A 2BYKB 4YS3B 3W96C 3X1SD 3VH5A 3KXBD 2FJ7C 5BT1D 5B33A 3LJAA 3AZFD 4J8WC 5B2JC 5DNNB 1S32D 2L5AA 3AZKA 5CPJA 1P3GC 5B32C 3AZND 1P3LD 2NQBA 5KDMB 3AZJA 5AVCB 3AZED 3REJD 1P3IB 5GT0C 5AVCC 1F66B 4YS3D 4LD9D 3REID 2F8NB 4H9SA 5GXQA 4Z66A 5DNMC 2Y2NA 3C1CB 1PZRA 3AL0C 3O62C 5B40B 5CHLB 3MVDB 1KX5A 5AV5D 3AV1B 3X1TB 3H0MC 3REHA 1P3AB 3WTPB 3LZ1D 3AZMB 3WTPE 3AZHA 3X1VA 1P3KB 3MGSC 1M19D 5B40D 3MNNA 5BO0A 5CP6D 4WU8D 3NQUB 5BNVA 3X1TD 3WKJB 3KWQD 5BS7A 3AYWC 2F8NK 4Z2MH 3RELD 4M6BA 3B6FA 1P3MD 4J8UC 3W99D 5B1MD 3EPHA 4H9RA 5JRGC 5B24C 3MGPC 5B2ID 3B0DC 1HQ3D 5BNXB 3AFAB 3MGRB 3UT9B 3A1KA 4WU9A 4WZSB 3AN2A 1P34C 4NFTA 4J8XB 4JJNA 3UTBA 4WNNB 5CPKB 1M1AB 3LELD 5AV8A 2BYMB 3KUYD 4Z5TA 4J8VB 3WAAB 3LJAC 3F6TA 3AZGA 3MGRD 2Y2GA 4R8PB 3AZKC 3EPLA 2NQBC 5AY8D 4J8XD 4XZQA 5AV6C 5CPKD 5B0YC 4H9SC 5GXQC 5GSUA 4Z66C 1R4VA 3W98A 1P3BA 4CAYB 2JSSA 3B6GA 1U35A 4QLCA 5CPIA 4R8PD 1EQZB 4YM6D 1KX5C 1P3OD 2BYKA 3W96A 4NE3A 4ZBJB 4ZBJC 2HUEB 1N1JB 2FFFB 2XD1A 4J8WA 1P3GA 3X1VC 3AZHC 5B32A 5AVBD 5KDMA 3MNNC 5AVCA 2Y2IA 4ZUXC 1P3IA 1F66A 2F8NA 5B33D 4H9QB 2RVQC 4H9NB 5BS7C 2YFVA 4HGAB 3C1CA 2HIOC 3TU4D 5CPJD 5AV9B 4KUDB 1P3FB 3AZJD 4WJ3C 4G91C 5F99D 1Z2CB 3MVDA 3REKD 3W97C 3AZLB 1P3AA 1P3PC 3VH6T 2F8NG 3AZMA 4E45A 3UTBC 2NZDB 2PYOC 1P3KA 1P3FD 5AV8C 3W96B 4Z5TC 1JFIB 3NQUA 3MGQC 3AZGC 3WKJA 5B1LB 5GT3B 1TAFB 3EG5B 4NE6A 5E5AC 3LZ0D 4J8UA 3X1SB 3KXBB 5JRGA 2NZDD 4XZQC 2Y2QA 5B0ZB 5BT1C 3W98C 3AZFC 1P3BC 3AFAA 3UT9A 2Y2OA 3AV2D 1S32B 1U35C 5CPIC 4QLCC 3X1UD 3AZNB 1P3LB 3AZEB 3AZNC 1P34A 2F2AC 3REJB 4LD9B 5C3IB 4KGCB 3REIB 1M1AA 4YS3C 1M18D 4G92B 5B0ZD 4J8VA 4WU9D 1KX4D 5G49B 2G5HC 5DNNC 2ZY2A 5AV5B 2IO5B 5AV6A 1P3IC 1ID3D 1WWIA 5B0YA 1F66C 3A6ND 4KGCD 3KSYA 3LZ1B 3C1CC 4X23D 4AWLB 1M19B 4DRAA 1EQZA 5CP6B 4WU8B 5B40C 2J8PA 3MVDC 3R45B 3KWQB 3AV1C 3X1TC 3V9RA 1Q9CA 1P3AC 3RELB 3WTPC 3C1BB 1P3MB 3B6GD 3W99B 5B1MB 3AZMC 3AZIB 1TZYD 3EPKA 1P3KC 5B2IB 3UTAD 4XUJD 4ZUXA 1HQ3B 2FJ7D 3B0CT 4NE5A 2AROB 3WKJC 4H9NA 5B2JD 2HIOA 3EPJA 1P3GD 3C1BD 4EO5B 3LELB 4H9OB 5AV9A 4KUDA 2RIQA 3AZID 3KUYB 3KUYC 5GT0D 3WA9B 3W97A 5DNMD 3MGRC 2AROD 3AFAC 1F1EA 3UT9C 2CV5B 3AZLA 1P3PA 5AY8B 3O62D 4J8XC 1M1AC 5CPKC 2PYOA 1B67A 1T3UA 1BH8B 3WA9D 3WAAC 4J8VC 3MGQA 1JFIA 1AOIB 2F8NH 2XD5A 2BG1A 2CV5D 5B1LA 4R8PC 5GT3A 2Y2PA 5E5AA 4YM6B 1ZLAD 1TAFA 1P3OB 3MGSD 5FUGA 3X1SA 5JA4B 3KXBA 1H3OA 3AZFA 1AOID 3AYWD 4KHAB 1S32A 5AVBB 3AZNA 4J8UD 1P3LA 4CSRB 2UWXA 3AZEA 1EQZC 4LD9A 2YFWB 5B31D 4YS3A 3REIA 5B24D 3MGPD 5B33B 3B0BA 2HUEC 3TU4B 3KFUG 5CPJB 2Y2LA 3VH5T 5DNNA 5G49A 3AZJB 5F99B 1KX3D 3REKB 1HTAA 3LJAD 3LZ1A 4HGAC 2Y2MA 3AZKD 5AV9C 4KUDC 2NQBD 1P3FC 5B40A 3REHB 1B6WA 3AV1A 3X1TA 5GXQD 3R45A 4Z66D 3KWQA 3AZLC 3RELA 3LZ0B 3WTPA 4Z2MG 1P3MA 3W99A 5B1MA 2NZDC 5BO0B 1BH9B 1KX5D 5BNVB 5B2IA 1HQ3A 3REHD 3AV2B 3AV2C 3X1UB 3B6FB 5B1LC 5GT3C 3AZHD 3X1VD 3LELA 4H9OA 1M18B 3X1SC 3KXBC 3MNND 3KUYA 1M18C 4WU9B 5B0ZC 2JE5A 3MGRA 5BNXA 1KX4B 1S32C 4JJNB 3B6FD 1P3LC 5AY8A 2JCHA 3AZEC 4J8XA 3REJC 1ID3B 4WNNA 3NQJB 5C3IC 3A6NB 3REIC 5CPKA 4KGCC 2BYMA 1BH8A 2Y2KA 4G92C 3WAAA 4X23B 1W2EA 3AN2D 1BFMA 4R8PA 4YM6A 4JJND 3UTBD 5AV5C 1P3OA 2PYOD 5AV8D 2IO5C 4Z5TD 5JA4A 2DQNC 1KU5A 3MGQD 3AZGD 3B6GB 3LZ1C 4DQYB 3H0LC 2CWEA 4CAYA 4KHAA 1TZYB 5AVBA 3UTAB 3VH6W 4XUJB 4AWLC 3UTAC 4CSRA 1M19C 4XUJC 5CP6C 4XZQD 4WU8C 2FJ7B 2YFWA 2Y2JA 4UUZB 5GSUD 5B31G 3KWQC 3W98D 1P3BD 4J8WB 1N1JA 5B2JB 3RELC 1P3GB 3TU4A 5B32B 4QLCD 5CPID 3C1BC 1U35D 1P3MC 3W99C 5B1MC 3AZIC 5GT0B 5F99A 3W96D 2LY8A 5B2IC 3REKA 5DNMB 1HQ3C 2YFVB 2AROC 4H9QA 4E44A 4J8WD 3O62B 5DNND 5B32D 4EO5C 3VH6A 3LELC 1P3FA 1ULYA 1WWSA 4DRBA 5AVCD 3A1IA 1P3ID 1F66D 3WA9C 2F8ND 2W8SA 3C1CD 4LD9C 2CV5C 1ZLAB 3LZ0A 1ZLAC 5AY8C 3MGSB 2ZY4A 2NZDA 1BH9A 3MVDD 3AV1D 3AYWB 1AOIC 3AV2A 1A7WA 1P3AD 3X1UA 3WTPD 4J8UB 4YM6C 5JRGB 3AZMD 5B31B 5B31C 5B24B 4H9PB 3MGPB 1P3KD 3B0DB 1P3OC 1M18A 2ZY5A 5B0ZA 3WKJD 1KX4A 1P34B 2DF4C 1KX3B 5AVBC 1KX3C 3REJA 5JRGD 4KGCA 1ID3A 3NQJA 3A6NA 3LJAB 5B33C 3AFAD 3UT9D 3AZKB 3B0CW 4X23A 3TU4C 5CPJC 2NQBB 1P34D 3AZJC 5AV6B 5B0YB 5AV5A 5F99C 1M1AD 3REKC 5GXQB 4Z66B 4J8VD 3WAAD 3FDDA 2ZY3A 1KX5B 1TZYA 3UTAA 1M19A 3P5JB 4XUJA 5CP6A 5AV6D 4WU8A 5B0YD 3V9RB 2FJ7A 3REHC 4UUZA 5B2JA 3AZHB 2G5IC 3X1VB 3LZ0C 2Y2HA 3C1BA 3AZIA 3MNNB 1EQZD 4ZUXB 5GT0A 5DNMA 2AROA 4WV4B 2HIOB 3X1UC 3B6FC 4H9RB 3O62A 4UPKA 4G91B 3W97B 5B32G 4ZUXD
chains in the Genus database with same CATH topology
3WA9A 4WU9C 2RVQD 3AN2B 1P3PB 3AN2C 1KX4C 2CV5A 2HIOD 3UTBB 2ZM5A 4JJNC 1ZLAA 2PYOB 5AV9D 4KUDD 5AV8B 3MGSA 4Z5TB 1ID3C 3VH5W 3A6NC 3W97D 3MGQB 3AZGB 1AOIA 3AYWA 3AZLD 1P3PD 4X23C 5E5AB 4XZQB 5FUGB 5B31A 5GSUB 5B24A 3H0RC 1H3OB 3IP4C 4H9PA 5GSUC 2VQRA 3MGPA 3AZFB 1P3BB 3W98B 1U35B 4QLCB 5CPIB 3B6GC 5B1LD 5GT3D 5E5AD 1TZYC 1KX3A 2BYKB 4YS3B 3W96C 3X1SD 3VH5A 3KXBD 2FJ7C 5BT1D 5B33A 3LJAA 3AZFD 4J8WC 5B2JC 5DNNB 1S32D 2L5AA 3AZKA 5CPJA 1P3GC 5B32C 3AZND 1P3LD 2NQBA 5KDMB 3AZJA 5AVCB 3AZED 3REJD 1P3IB 5GT0C 5AVCC 1F66B 4YS3D 4LD9D 3REID 2F8NB 4H9SA 5GXQA 4Z66A 5DNMC 2Y2NA 3C1CB 1PZRA 3AL0C 3O62C 5B40B 5CHLB 3MVDB 1KX5A 5AV5D 3AV1B 3X1TB 3H0MC 3REHA 1P3AB 3WTPB 3LZ1D 3AZMB 3WTPE 3AZHA 3X1VA 1P3KB 3MGSC 1M19D 5B40D 3MNNA 5BO0A 5CP6D 4WU8D 3NQUB 5BNVA 3X1TD 3WKJB 3KWQD 5BS7A 3AYWC 2F8NK 4Z2MH 3RELD 4M6BA 3B6FA 1P3MD 4J8UC 3W99D 5B1MD 3EPHA 4H9RA 5JRGC 5B24C 3MGPC 5B2ID 3B0DC 1HQ3D 5BNXB 3AFAB 3MGRB 3UT9B 3A1KA 4WU9A 4WZSB 3AN2A 1P34C 4NFTA 4J8XB 4JJNA 3UTBA 4WNNB 5CPKB 1M1AB 3LELD 5AV8A 2BYMB 3KUYD 4Z5TA 4J8VB 3WAAB 3LJAC 3F6TA 3AZGA 3MGRD 2Y2GA 4R8PB 3AZKC 3EPLA 2NQBC 5AY8D 4J8XD 4XZQA 5AV6C 5CPKD 5B0YC 4H9SC 5GXQC 5GSUA 4Z66C 1R4VA 3W98A 1P3BA 4CAYB 2JSSA 3B6GA 1U35A 4QLCA 5CPIA 4R8PD 1EQZB 4YM6D 1KX5C 1P3OD 2BYKA 3W96A 4NE3A 4ZBJB 4ZBJC 2HUEB 1N1JB 2FFFB 2XD1A 4J8WA 1P3GA 3X1VC 3AZHC 5B32A 5AVBD 5KDMA 3MNNC 5AVCA 2Y2IA 4ZUXC 1P3IA 1F66A 2F8NA 5B33D 4H9QB 2RVQC 4H9NB 5BS7C 2YFVA 4HGAB 3C1CA 2HIOC 3TU4D 5CPJD 5AV9B 4KUDB 1P3FB 3AZJD 4WJ3C 4G91C 5F99D 1Z2CB 3MVDA 3REKD 3W97C 3AZLB 1P3AA 1P3PC 3VH6T 2F8NG 3AZMA 4E45A 3UTBC 2NZDB 2PYOC 1P3KA 1P3FD 5AV8C 3W96B 4Z5TC 1JFIB 3NQUA 3MGQC 3AZGC 3WKJA 5B1LB 5GT3B 1TAFB 3EG5B 4NE6A 5E5AC 3LZ0D 4J8UA 3X1SB 3KXBB 5JRGA 2NZDD 4XZQC 2Y2QA 5B0ZB 5BT1C 3W98C 3AZFC 1P3BC 3AFAA 3UT9A 2Y2OA 3AV2D 1S32B 1U35C 5CPIC 4QLCC 3X1UD 3AZNB 1P3LB 3AZEB 3AZNC 1P34A 2F2AC 3REJB 4LD9B 5C3IB 4KGCB 3REIB 1M1AA 4YS3C 1M18D 4G92B 5B0ZD 4J8VA 4WU9D 1KX4D 5G49B 2G5HC 5DNNC 2ZY2A 5AV5B 2IO5B 5AV6A 1P3IC 1ID3D 1WWIA 5B0YA 1F66C 3A6ND 4KGCD 3KSYA 3LZ1B 3C1CC 4X23D 4AWLB 1M19B 4DRAA 1EQZA 5CP6B 4WU8B 5B40C 2J8PA 3MVDC 3R45B 3KWQB 3AV1C 3X1TC 3V9RA 1Q9CA 1P3AC 3RELB 3WTPC 3C1BB 1P3MB 3B6GD 3W99B 5B1MB 3AZMC 3AZIB 1TZYD 3EPKA 1P3KC 5B2IB 3UTAD 4XUJD 4ZUXA 1HQ3B 2FJ7D 3B0CT 4NE5A 2AROB 3WKJC 4H9NA 5B2JD 2HIOA 3EPJA 1P3GD 3C1BD 4EO5B 3LELB 4H9OB 5AV9A 4KUDA 2RIQA 3AZID 3KUYB 3KUYC 5GT0D 3WA9B 3W97A 5DNMD 3MGRC 2AROD 3AFAC 1F1EA 3UT9C 2CV5B 3AZLA 1P3PA 5AY8B 3O62D 4J8XC 1M1AC 5CPKC 2PYOA 1B67A 1T3UA 1BH8B 3WA9D 3WAAC 4J8VC 3MGQA 1JFIA 1AOIB 2F8NH 2XD5A 2BG1A 2CV5D 5B1LA 4R8PC 5GT3A 2Y2PA 5E5AA 4YM6B 1ZLAD 1TAFA 1P3OB 3MGSD 5FUGA 3X1SA 5JA4B 3KXBA 1H3OA 3AZFA 1AOID 3AYWD 4KHAB 1S32A 5AVBB 3AZNA 4J8UD 1P3LA 4CSRB 2UWXA 3AZEA 1EQZC 4LD9A 2YFWB 5B31D 4YS3A 3REIA 5B24D 3MGPD 5B33B 3B0BA 2HUEC 3TU4B 3KFUG 5CPJB 2Y2LA 3VH5T 5DNNA 5G49A 3AZJB 5F99B 1KX3D 3REKB 1HTAA 3LJAD 3LZ1A 4HGAC 2Y2MA 3AZKD 5AV9C 4KUDC 2NQBD 1P3FC 5B40A 3REHB 1B6WA 3AV1A 3X1TA 5GXQD 3R45A 4Z66D 3KWQA 3AZLC 3RELA 3LZ0B 3WTPA 4Z2MG 1P3MA 3W99A 5B1MA 2NZDC 5BO0B 1BH9B 1KX5D 5BNVB 5B2IA 1HQ3A 3REHD 3AV2B 3AV2C 3X1UB 3B6FB 5B1LC 5GT3C 3AZHD 3X1VD 3LELA 4H9OA 1M18B 3X1SC 3KXBC 3MNND 3KUYA 1M18C 4WU9B 5B0ZC 2JE5A 3MGRA 5BNXA 1KX4B 1S32C 4JJNB 3B6FD 1P3LC 5AY8A 2JCHA 3AZEC 4J8XA 3REJC 1ID3B 4WNNA 3NQJB 5C3IC 3A6NB 3REIC 5CPKA 4KGCC 2BYMA 1BH8A 2Y2KA 4G92C 3WAAA 4X23B 1W2EA 3AN2D 1BFMA 4R8PA 4YM6A 4JJND 3UTBD 5AV5C 1P3OA 2PYOD 5AV8D 2IO5C 4Z5TD 5JA4A 2DQNC 1KU5A 3MGQD 3AZGD 3B6GB 3LZ1C 4DQYB 3H0LC 2CWEA 4CAYA 4KHAA 1TZYB 5AVBA 3UTAB 3VH6W 4XUJB 4AWLC 3UTAC 4CSRA 1M19C 4XUJC 5CP6C 4XZQD 4WU8C 2FJ7B 2YFWA 2Y2JA 4UUZB 5GSUD 5B31G 3KWQC 3W98D 1P3BD 4J8WB 1N1JA 5B2JB 3RELC 1P3GB 3TU4A 5B32B 4QLCD 5CPID 3C1BC 1U35D 1P3MC 3W99C 5B1MC 3AZIC 5GT0B 5F99A 3W96D 2LY8A 5B2IC 3REKA 5DNMB 1HQ3C 2YFVB 2AROC 4H9QA 4E44A 4J8WD 3O62B 5DNND 5B32D 4EO5C 3VH6A 3LELC 1P3FA 1ULYA 1WWSA 4DRBA 5AVCD 3A1IA 1P3ID 1F66D 3WA9C 2F8ND 2W8SA 3C1CD 4LD9C 2CV5C 1ZLAB 3LZ0A 1ZLAC 5AY8C 3MGSB 2ZY4A 2NZDA 1BH9A 3MVDD 3AV1D 3AYWB 1AOIC 3AV2A 1A7WA 1P3AD 3X1UA 3WTPD 4J8UB 4YM6C 5JRGB 3AZMD 5B31B 5B31C 5B24B 4H9PB 3MGPB 1P3KD 3B0DB 1P3OC 1M18A 2ZY5A 5B0ZA 3WKJD 1KX4A 1P34B 2DF4C 1KX3B 5AVBC 1KX3C 3REJA 5JRGD 4KGCA 1ID3A 3NQJA 3A6NA 3LJAB 5B33C 3AFAD 3UT9D 3AZKB 3B0CW 4X23A 3TU4C 5CPJC 2NQBB 1P34D 3AZJC 5AV6B 5B0YB 5AV5A 5F99C 1M1AD 3REKC 5GXQB 4Z66B 4J8VD 3WAAD 3FDDA 2ZY3A 1KX5B 1TZYA 3UTAA 1M19A 3P5JB 4XUJA 5CP6A 5AV6D 4WU8A 5B0YD 3V9RB 2FJ7A 3REHC 4UUZA 5B2JA 3AZHB 2G5IC 3X1VB 3LZ0C 2Y2HA 3C1BA 3AZIA 3MNNB 1EQZD 4ZUXB 5GT0A 5DNMA 2AROA 4WV4B 2HIOB 3X1UC 3B6FC 4H9RB 3O62A 4UPKA 4G91B 3W97B 5B32G 4ZUXD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WA9 A;  4WU9 C;  2RVQ D;  3AN2 B;  1P3P B;  3AN2 C;  1KX4 C;  2CV5 A;  2HIO D;  3UTB B;  4JJN C;  1ZLA A;  2PYO B;  5AV9 D;  4KUD D;  5AV8 B;  3MGS A;  4Z5T B;  1ID3 C;  3VH5 W;  3A6N C;  3W97 D;  3MGQ B;  3AZG B;  1AOI A;  3AYW A;  3AZL D;  1P3P D;  4X23 C;  5E5A B;  4XZQ B;  5FUG B;  5B31 A;  5GSU B;  5B24 A;  4H9P A;  1H3O B;  3MGP A;  5GSU C;  3W98 B;  3AZF B;  1P3B B;  1U35 B;  4QLC B;  5CPI B;  3B6G C;  5B1L D;  5GT3 D;  5E5A D;  1TZY C;  1KX3 A;  2BYK B;  4YS3 B;  3W96 C;  3X1S D;  3VH5 A;  3KXB D;  2FJ7 C;  5BT1 D;  5B33 A;  3LJA A;  3AZF D;  4J8W C;  5B2J C;  5DNN B;  1S32 D;  2L5A A;  3AZK A;  5CPJ A;  1P3G C;  5B32 C;  3AZN D;  1P3L D;  2NQB A;  5KDM B;  3AZJ A;  5AVC B;  3AZE D;  3REJ D;  1P3I B;  5GT0 C;  5AVC C;  1F66 B;  4YS3 D;  4LD9 D;  3REI D;  2F8N B;  4H9S A;  5GXQ A;  4Z66 A;  5DNM C;  3C1C B;  3O62 C;  5B40 B;  5CHL B;  3MVD B;  1KX5 A;  5AV5 D;  3AV1 B;  3X1T B;  3REH A;  1P3A B;  3WTP B;  3LZ1 D;  3AZM B;  3WTP E;  3AZH A;  3X1V A;  1P3K B;  3MGS C;  1M19 D;  5B40 D;  3MNN A;  5BO0 A;  5CP6 D;  4WU8 D;  3NQU B;  5BNV A;  3X1T D;  3WKJ B;  3KWQ D;  5BS7 A;  3AYW C;  2F8N K;  4Z2M H;  3REL D;  4M6B A;  3B6F A;  1P3M D;  4J8U C;  3W99 D;  5B1M D;  4H9R A;  5JRG C;  5B24 C;  3MGP C;  5B2I D;  3B0D C;  1HQ3 D;  5BNX B;  3AFA B;  3MGR B;  3UT9 B;  4WU9 A;  4WZS B;  3AN2 A;  1P34 C;  4NFT A;  4J8X B;  4JJN A;  3UTB A;  4WNN B;  5CPK B;  1M1A B;  3LEL D;  5AV8 A;  2BYM B;  3KUY D;  4Z5T A;  4J8V B;  3WAA B;  3LJA C;  3AZG A;  3MGR D;  4R8P B;  3AZK C;  2NQB C;  5AY8 D;  4J8X D;  4XZQ A;  5AV6 C;  5CPK D;  5B0Y C;  4H9S C;  5GXQ C;  5GSU A;  4Z66 C;  1R4V A;  3W98 A;  1P3B A;  4CAY B;  2JSS A;  3B6G A;  1U35 A;  4QLC A;  5CPI A;  4R8P D;  1EQZ B;  4YM6 D;  1KX5 C;  1P3O D;  2BYK A;  3W96 A;  4NE3 A;  4ZBJ B;  4ZBJ C;  2HUE B;  1N1J B;  4J8W A;  1P3G A;  3X1V C;  3AZH C;  5B32 A;  5AVB D;  5KDM A;  3MNN C;  5AVC A;  4ZUX C;  1P3I A;  1F66 A;  2F8N A;  5B33 D;  4H9Q B;  2RVQ C;  4H9N B;  5BS7 C;  2YFV A;  4HGA B;  3C1C A;  2HIO C;  3TU4 D;  5CPJ D;  5AV9 B;  4KUD B;  1P3F B;  3AZJ D;  4G91 C;  5F99 D;  3MVD A;  3REK D;  3W97 C;  3AZL B;  1P3A A;  1P3P C;  3VH6 T;  2F8N G;  3AZM A;  4E45 A;  3UTB C;  2NZD B;  2PYO C;  1P3K A;  1P3F D;  5AV8 C;  3W96 B;  4Z5T C;  1JFI B;  3NQU A;  3MGQ C;  3AZG C;  3WKJ A;  5B1L B;  5GT3 B;  1TAF B;  4NE6 A;  5E5A C;  3LZ0 D;  4J8U A;  3X1S B;  3KXB B;  5JRG A;  2NZD D;  4XZQ C;  5B0Z B;  5BT1 C;  3W98 C;  3AZF C;  1P3B C;  3AFA A;  3UT9 A;  3AV2 D;  1S32 B;  1U35 C;  5CPI C;  4QLC C;  3X1U D;  3AZN B;  1P3L B;  3AZE B;  3AZN C;  1P34 A;  3REJ B;  4LD9 B;  5C3I B;  4KGC B;  3REI B;  1M1A A;  4YS3 C;  1M18 D;  4G92 B;  5B0Z D;  4J8V A;  4WU9 D;  1KX4 D;  5G49 B;  5DNN C;  5AV5 B;  2IO5 B;  5AV6 A;  1P3I C;  1ID3 D;  1WWI A;  5B0Y A;  1F66 C;  3A6N D;  4KGC D;  3KSY A;  3LZ1 B;  3C1C C;  4X23 D;  4AWL B;  1M19 B;  4DRA A;  1EQZ A;  5CP6 B;  4WU8 B;  5B40 C;  3MVD C;  3R45 B;  3KWQ B;  3AV1 C;  3X1T C;  3V9R A;  1Q9C A;  1P3A C;  3REL B;  3WTP C;  3C1B B;  1P3M B;  3B6G D;  3W99 B;  5B1M B;  3AZM C;  3AZI B;  1TZY D;  1P3K C;  5B2I B;  3UTA D;  4XUJ D;  4ZUX A;  1HQ3 B;  2FJ7 D;  3B0C T;  4NE5 A;  2ARO B;  3WKJ C;  4H9N A;  5B2J D;  2HIO A;  1P3G D;  3C1B D;  4EO5 B;  3LEL B;  4H9O B;  5AV9 A;  4KUD A;  3AZI D;  3KUY B;  3KUY C;  5GT0 D;  3WA9 B;  3W97 A;  5DNM D;  3MGR C;  2ARO D;  3AFA C;  1F1E A;  3UT9 C;  2CV5 B;  3AZL A;  1P3P A;  5AY8 B;  3O62 D;  4J8X C;  1M1A C;  5CPK C;  2PYO A;  1B67 A;  1BH8 B;  3WA9 D;  3WAA C;  4J8V C;  3MGQ A;  1JFI A;  1AOI B;  2F8N H;  2CV5 D;  5B1L A;  4R8P C;  5GT3 A;  4YM6 B;  5E5A A;  1ZLA D;  1TAF A;  1P3O B;  3MGS D;  5FUG A;  3X1S A;  5JA4 B;  3KXB A;  1H3O A;  3AZF A;  1AOI D;  3AYW D;  4KHA B;  1S32 A;  5AVB B;  3AZN A;  4J8U D;  1P3L A;  4CSR B;  3AZE A;  1EQZ C;  4LD9 A;  2YFW B;  5B31 D;  4YS3 A;  3REI A;  5B24 D;  3MGP D;  5B33 B;  3B0B A;  2HUE C;  3TU4 B;  5CPJ B;  3VH5 T;  5DNN A;  5G49 A;  3AZJ B;  5F99 B;  1KX3 D;  3REK B;  1HTA A;  3LJA D;  3LZ1 A;  4HGA C;  3AZK D;  5AV9 C;  4KUD C;  2NQB D;  1P3F C;  5B40 A;  3REH B;  1B6W A;  3AV1 A;  3X1T A;  5GXQ D;  3R45 A;  4Z66 D;  3KWQ A;  3AZL C;  3REL A;  3LZ0 B;  3WTP A;  4Z2M G;  1P3M A;  3W99 A;  5B1M A;  2NZD C;  5BO0 B;  1BH9 B;  1KX5 D;  5BNV B;  5B2I A;  1HQ3 A;  3REH D;  3AV2 B;  3AV2 C;  3X1U B;  3B6F B;  5B1L C;  5GT3 C;  3AZH D;  3X1V D;  3LEL A;  4H9O A;  1M18 B;  3X1S C;  3KXB C;  3MNN D;  3KUY A;  1M18 C;  4WU9 B;  5B0Z C;  3MGR A;  5BNX A;  1KX4 B;  1S32 C;  4JJN B;  3B6F D;  1P3L C;  5AY8 A;  3AZE C;  4J8X A;  3REJ C;  1ID3 B;  4WNN A;  3NQJ B;  5C3I C;  3A6N B;  3REI C;  5CPK A;  4KGC C;  2BYM A;  1BH8 A;  4G92 C;  3WAA A;  4X23 B;  3AN2 D;  1BFM A;  4R8P A;  4YM6 A;  4JJN D;  3UTB D;  5AV5 C;  1P3O A;  2PYO D;  5AV8 D;  2IO5 C;  4Z5T D;  5JA4 A;  1KU5 A;  3MGQ D;  3AZG D;  3B6G B;  3LZ1 C;  2CWE A;  4CAY A;  4KHA A;  1TZY B;  5AVB A;  3UTA B;  3VH6 W;  4XUJ B;  4AWL C;  3UTA C;  4CSR A;  1M19 C;  4XUJ C;  5CP6 C;  4XZQ D;  4WU8 C;  2FJ7 B;  2YFW A;  4UUZ B;  5GSU D;  5B31 G;  3KWQ C;  3W98 D;  1P3B D;  4J8W B;  1N1J A;  5B2J B;  3REL C;  1P3G B;  3TU4 A;  5B32 B;  4QLC D;  5CPI D;  3C1B C;  1U35 D;  1P3M C;  3W99 C;  5B1M C;  3AZI C;  5GT0 B;  5F99 A;  3W96 D;  2LY8 A;  5B2I C;  3REK A;  5DNM B;  1HQ3 C;  2YFV B;  2ARO C;  4H9Q A;  4E44 A;  4J8W D;  3O62 B;  5DNN D;  5B32 D;  4EO5 C;  3VH6 A;  3LEL C;  1P3F A;  1ULY A;  1WWS A;  4DRB A;  5AVC D;  1P3I D;  1F66 D;  3WA9 C;  2F8N D;  3C1C D;  4LD9 C;  2CV5 C;  1ZLA B;  3LZ0 A;  1ZLA C;  5AY8 C;  3MGS B;  2NZD A;  1BH9 A;  3MVD D;  3AV1 D;  3AYW B;  1AOI C;  3AV2 A;  1A7W A;  1P3A D;  3X1U A;  3WTP D;  4J8U B;  4YM6 C;  5JRG B;  3AZM D;  5B31 B;  5B31 C;  5B24 B;  4H9P B;  3MGP B;  1P3K D;  3B0D B;  1P3O C;  1M18 A;  5B0Z A;  3WKJ D;  1KX4 A;  1P34 B;  1KX3 B;  5AVB C;  1KX3 C;  3REJ A;  5JRG D;  4KGC A;  1ID3 A;  3NQJ A;  3A6N A;  3LJA B;  5B33 C;  3AFA D;  3UT9 D;  3AZK B;  3B0C W;  4X23 A;  3TU4 C;  5CPJ C;  2NQB B;  1P34 D;  3AZJ C;  5AV6 B;  5B0Y B;  5AV5 A;  5F99 C;  1M1A D;  3REK C;  5GXQ B;  4Z66 B;  4J8V D;  3WAA D;  1KX5 B;  1TZY A;  3UTA A;  1M19 A;  4XUJ A;  5CP6 A;  5AV6 D;  4WU8 A;  5B0Y D;  3V9R B;  2FJ7 A;  3REH C;  4UUZ A;  5B2J A;  3AZH B;  3X1V B;  3LZ0 C;  3C1B A;  3AZI A;  3MNN B;  1EQZ D;  4ZUX B;  5GT0 A;  5DNM A;  2ARO A;  4WV4 B;  2HIO B;  3X1U C;  3B6F C;  4H9R B;  3O62 A;  4G91 B;  3W97 B;  5B32 G;  4ZUX D; 
#chains in the Genus database with same CATH topology
 3WA9 A;  4WU9 C;  2RVQ D;  3AN2 B;  1P3P B;  3AN2 C;  1KX4 C;  2CV5 A;  2HIO D;  3UTB B;  2ZM5 A;  4JJN C;  1ZLA A;  2PYO B;  5AV9 D;  4KUD D;  5AV8 B;  3MGS A;  4Z5T B;  1ID3 C;  3VH5 W;  3A6N C;  3W97 D;  3MGQ B;  3AZG B;  1AOI A;  3AYW A;  3AZL D;  1P3P D;  4X23 C;  5E5A B;  4XZQ B;  5FUG B;  5B31 A;  5GSU B;  5B24 A;  3H0R C;  1H3O B;  3IP4 C;  4H9P A;  5GSU C;  2VQR A;  3MGP A;  3AZF B;  1P3B B;  3W98 B;  1U35 B;  4QLC B;  5CPI B;  3B6G C;  5B1L D;  5GT3 D;  5E5A D;  1TZY C;  1KX3 A;  2BYK B;  4YS3 B;  3W96 C;  3X1S D;  3VH5 A;  3KXB D;  2FJ7 C;  5BT1 D;  5B33 A;  3LJA A;  3AZF D;  4J8W C;  5B2J C;  5DNN B;  1S32 D;  2L5A A;  3AZK A;  5CPJ A;  1P3G C;  5B32 C;  3AZN D;  1P3L D;  2NQB A;  5KDM B;  3AZJ A;  5AVC B;  3AZE D;  3REJ D;  1P3I B;  5GT0 C;  5AVC C;  1F66 B;  4YS3 D;  4LD9 D;  3REI D;  2F8N B;  4H9S A;  5GXQ A;  4Z66 A;  5DNM C;  2Y2N A;  3C1C B;  1PZR A;  3AL0 C;  3O62 C;  5B40 B;  5CHL B;  3MVD B;  1KX5 A;  5AV5 D;  3AV1 B;  3X1T B;  3H0M C;  3REH A;  1P3A B;  3WTP B;  3LZ1 D;  3AZM B;  3WTP E;  3AZH A;  3X1V A;  1P3K B;  3MGS C;  1M19 D;  5B40 D;  3MNN A;  5BO0 A;  5CP6 D;  4WU8 D;  3NQU B;  5BNV A;  3X1T D;  3WKJ B;  3KWQ D;  5BS7 A;  3AYW C;  2F8N K;  4Z2M H;  3REL D;  4M6B A;  3B6F A;  1P3M D;  4J8U C;  3W99 D;  5B1M D;  3EPH A;  4H9R A;  5JRG C;  5B24 C;  3MGP C;  5B2I D;  3B0D C;  1HQ3 D;  5BNX B;  3AFA B;  3MGR B;  3UT9 B;  3A1K A;  4WU9 A;  4WZS B;  3AN2 A;  1P34 C;  4NFT A;  4J8X B;  4JJN A;  3UTB A;  4WNN B;  5CPK B;  1M1A B;  3LEL D;  5AV8 A;  2BYM B;  3KUY D;  4Z5T A;  4J8V B;  3WAA B;  3LJA C;  3F6T A;  3AZG A;  3MGR D;  2Y2G A;  4R8P B;  3AZK C;  3EPL A;  2NQB C;  5AY8 D;  4J8X D;  4XZQ A;  5AV6 C;  5CPK D;  5B0Y C;  4H9S C;  5GXQ C;  5GSU A;  4Z66 C;  1R4V A;  3W98 A;  1P3B A;  4CAY B;  2JSS A;  3B6G A;  1U35 A;  4QLC A;  5CPI A;  4R8P D;  1EQZ B;  4YM6 D;  1KX5 C;  1P3O D;  2BYK A;  3W96 A;  4NE3 A;  4ZBJ B;  4ZBJ C;  2HUE B;  1N1J B;  2FFF B;  2XD1 A;  4J8W A;  1P3G A;  3X1V C;  3AZH C;  5B32 A;  5AVB D;  5KDM A;  3MNN C;  5AVC A;  2Y2I A;  4ZUX C;  1P3I A;  1F66 A;  2F8N A;  5B33 D;  4H9Q B;  2RVQ C;  4H9N B;  5BS7 C;  2YFV A;  4HGA B;  3C1C A;  2HIO C;  3TU4 D;  5CPJ D;  5AV9 B;  4KUD B;  1P3F B;  3AZJ D;  4WJ3 C;  4G91 C;  5F99 D;  1Z2C B;  3MVD A;  3REK D;  3W97 C;  3AZL B;  1P3A A;  1P3P C;  3VH6 T;  2F8N G;  3AZM A;  4E45 A;  3UTB C;  2NZD B;  2PYO C;  1P3K A;  1P3F D;  5AV8 C;  3W96 B;  4Z5T C;  1JFI B;  3NQU A;  3MGQ C;  3AZG C;  3WKJ A;  5B1L B;  5GT3 B;  1TAF B;  3EG5 B;  4NE6 A;  5E5A C;  3LZ0 D;  4J8U A;  3X1S B;  3KXB B;  5JRG A;  2NZD D;  4XZQ C;  2Y2Q A;  5B0Z B;  5BT1 C;  3W98 C;  3AZF C;  1P3B C;  3AFA A;  3UT9 A;  2Y2O A;  3AV2 D;  1S32 B;  1U35 C;  5CPI C;  4QLC C;  3X1U D;  3AZN B;  1P3L B;  3AZE B;  3AZN C;  1P34 A;  2F2A C;  3REJ B;  4LD9 B;  5C3I B;  4KGC B;  3REI B;  1M1A A;  4YS3 C;  1M18 D;  4G92 B;  5B0Z D;  4J8V A;  4WU9 D;  1KX4 D;  5G49 B;  2G5H C;  5DNN C;  2ZY2 A;  5AV5 B;  2IO5 B;  5AV6 A;  1P3I C;  1ID3 D;  1WWI A;  5B0Y A;  1F66 C;  3A6N D;  4KGC D;  3KSY A;  3LZ1 B;  3C1C C;  4X23 D;  4AWL B;  1M19 B;  4DRA A;  1EQZ A;  5CP6 B;  4WU8 B;  5B40 C;  2J8P A;  3MVD C;  3R45 B;  3KWQ B;  3AV1 C;  3X1T C;  3V9R A;  1Q9C A;  1P3A C;  3REL B;  3WTP C;  3C1B B;  1P3M B;  3B6G D;  3W99 B;  5B1M B;  3AZM C;  3AZI B;  1TZY D;  3EPK A;  1P3K C;  5B2I B;  3UTA D;  4XUJ D;  4ZUX A;  1HQ3 B;  2FJ7 D;  3B0C T;  4NE5 A;  2ARO B;  3WKJ C;  4H9N A;  5B2J D;  2HIO A;  3EPJ A;  1P3G D;  3C1B D;  4EO5 B;  3LEL B;  4H9O B;  5AV9 A;  4KUD A;  2RIQ A;  3AZI D;  3KUY B;  3KUY C;  5GT0 D;  3WA9 B;  3W97 A;  5DNM D;  3MGR C;  2ARO D;  3AFA C;  1F1E A;  3UT9 C;  2CV5 B;  3AZL A;  1P3P A;  5AY8 B;  3O62 D;  4J8X C;  1M1A C;  5CPK C;  2PYO A;  1B67 A;  1T3U A;  1BH8 B;  3WA9 D;  3WAA C;  4J8V C;  3MGQ A;  1JFI A;  1AOI B;  2F8N H;  2XD5 A;  2BG1 A;  2CV5 D;  5B1L A;  4R8P C;  5GT3 A;  2Y2P A;  5E5A A;  4YM6 B;  1ZLA D;  1TAF A;  1P3O B;  3MGS D;  5FUG A;  3X1S A;  5JA4 B;  3KXB A;  1H3O A;  3AZF A;  1AOI D;  3AYW D;  4KHA B;  1S32 A;  5AVB B;  3AZN A;  4J8U D;  1P3L A;  4CSR B;  2UWX A;  3AZE A;  1EQZ C;  4LD9 A;  2YFW B;  5B31 D;  4YS3 A;  3REI A;  5B24 D;  3MGP D;  5B33 B;  3B0B A;  2HUE C;  3TU4 B;  3KFU G;  5CPJ B;  2Y2L A;  3VH5 T;  5DNN A;  5G49 A;  3AZJ B;  5F99 B;  1KX3 D;  3REK B;  1HTA A;  3LJA D;  3LZ1 A;  4HGA C;  2Y2M A;  3AZK D;  5AV9 C;  4KUD C;  2NQB D;  1P3F C;  5B40 A;  3REH B;  1B6W A;  3AV1 A;  3X1T A;  5GXQ D;  3R45 A;  4Z66 D;  3KWQ A;  3AZL C;  3REL A;  3LZ0 B;  3WTP A;  4Z2M G;  1P3M A;  3W99 A;  5B1M A;  2NZD C;  5BO0 B;  1BH9 B;  1KX5 D;  5BNV B;  5B2I A;  1HQ3 A;  3REH D;  3AV2 B;  3AV2 C;  3X1U B;  3B6F B;  5B1L C;  5GT3 C;  3AZH D;  3X1V D;  3LEL A;  4H9O A;  1M18 B;  3X1S C;  3KXB C;  3MNN D;  3KUY A;  1M18 C;  4WU9 B;  5B0Z C;  2JE5 A;  3MGR A;  5BNX A;  1KX4 B;  1S32 C;  4JJN B;  3B6F D;  1P3L C;  5AY8 A;  2JCH A;  3AZE C;  4J8X A;  3REJ C;  1ID3 B;  4WNN A;  3NQJ B;  5C3I C;  3A6N B;  3REI C;  5CPK A;  4KGC C;  2BYM A;  1BH8 A;  2Y2K A;  4G92 C;  3WAA A;  4X23 B;  1W2E A;  3AN2 D;  1BFM A;  4R8P A;  4YM6 A;  4JJN D;  3UTB D;  5AV5 C;  1P3O A;  2PYO D;  5AV8 D;  2IO5 C;  4Z5T D;  5JA4 A;  2DQN C;  1KU5 A;  3MGQ D;  3AZG D;  3B6G B;  3LZ1 C;  4DQY B;  3H0L C;  2CWE A;  4CAY A;  4KHA A;  1TZY B;  5AVB A;  3UTA B;  3VH6 W;  4XUJ B;  4AWL C;  3UTA C;  4CSR A;  1M19 C;  4XUJ C;  5CP6 C;  4XZQ D;  4WU8 C;  2FJ7 B;  2YFW A;  2Y2J A;  4UUZ B;  5GSU D;  5B31 G;  3KWQ C;  3W98 D;  1P3B D;  4J8W B;  1N1J A;  5B2J B;  3REL C;  1P3G B;  3TU4 A;  5B32 B;  4QLC D;  5CPI D;  3C1B C;  1U35 D;  1P3M C;  3W99 C;  5B1M C;  3AZI C;  5GT0 B;  5F99 A;  3W96 D;  2LY8 A;  5B2I C;  3REK A;  5DNM B;  1HQ3 C;  2YFV B;  2ARO C;  4H9Q A;  4E44 A;  4J8W D;  3O62 B;  5DNN D;  5B32 D;  4EO5 C;  3VH6 A;  3LEL C;  1P3F A;  1ULY A;  1WWS A;  4DRB A;  5AVC D;  3A1I A;  1P3I D;  1F66 D;  3WA9 C;  2F8N D;  2W8S A;  3C1C D;  4LD9 C;  2CV5 C;  1ZLA B;  3LZ0 A;  1ZLA C;  5AY8 C;  3MGS B;  2ZY4 A;  2NZD A;  1BH9 A;  3MVD D;  3AV1 D;  3AYW B;  1AOI C;  3AV2 A;  1A7W A;  1P3A D;  3X1U A;  3WTP D;  4J8U B;  4YM6 C;  5JRG B;  3AZM D;  5B31 B;  5B31 C;  5B24 B;  4H9P B;  3MGP B;  1P3K D;  3B0D B;  1P3O C;  1M18 A;  2ZY5 A;  5B0Z A;  3WKJ D;  1KX4 A;  1P34 B;  2DF4 C;  1KX3 B;  5AVB C;  1KX3 C;  3REJ A;  5JRG D;  4KGC A;  1ID3 A;  3NQJ A;  3A6N A;  3LJA B;  5B33 C;  3AFA D;  3UT9 D;  3AZK B;  3B0C W;  4X23 A;  3TU4 C;  5CPJ C;  2NQB B;  1P34 D;  3AZJ C;  5AV6 B;  5B0Y B;  5AV5 A;  5F99 C;  1M1A D;  3REK C;  5GXQ B;  4Z66 B;  4J8V D;  3WAA D;  3FDD A;  2ZY3 A;  1KX5 B;  1TZY A;  3UTA A;  1M19 A;  3P5J B;  4XUJ A;  5CP6 A;  5AV6 D;  4WU8 A;  5B0Y D;  3V9R B;  2FJ7 A;  3REH C;  4UUZ A;  5B2J A;  3AZH B;  2G5I C;  3X1V B;  3LZ0 C;  2Y2H A;  3C1B A;  3AZI A;  3MNN B;  1EQZ D;  4ZUX B;  5GT0 A;  5DNM A;  2ARO A;  4WV4 B;  2HIO B;  3X1U C;  3B6F C;  4H9R B;  3O62 A;  4UPK A;  4G91 B;  3W97 B;  5B32 G;  4ZUX D; 
#chains in the Genus database with same CATH homology
 3WA9 A;  4WU9 C;  2RVQ D;  3AN2 B;  1P3P B;  3AN2 C;  1KX4 C;  2CV5 A;  2HIO D;  3UTB B;  2ZM5 A;  4JJN C;  1ZLA A;  2PYO B;  5AV9 D;  4KUD D;  5AV8 B;  3MGS A;  4Z5T B;  1ID3 C;  3VH5 W;  3A6N C;  3W97 D;  3MGQ B;  3AZG B;  1AOI A;  3AYW A;  3AZL D;  1P3P D;  4X23 C;  5E5A B;  4XZQ B;  5FUG B;  5B31 A;  5GSU B;  5B24 A;  3H0R C;  1H3O B;  3IP4 C;  4H9P A;  5GSU C;  2VQR A;  3MGP A;  3AZF B;  1P3B B;  3W98 B;  1U35 B;  4QLC B;  5CPI B;  3B6G C;  5B1L D;  5GT3 D;  5E5A D;  1TZY C;  1KX3 A;  2BYK B;  4YS3 B;  3W96 C;  3X1S D;  3VH5 A;  3KXB D;  2FJ7 C;  5BT1 D;  5B33 A;  3LJA A;  3AZF D;  4J8W C;  5B2J C;  5DNN B;  1S32 D;  2L5A A;  3AZK A;  5CPJ A;  1P3G C;  5B32 C;  3AZN D;  1P3L D;  2NQB A;  5KDM B;  3AZJ A;  5AVC B;  3AZE D;  3REJ D;  1P3I B;  5GT0 C;  5AVC C;  1F66 B;  4YS3 D;  4LD9 D;  3REI D;  2F8N B;  4H9S A;  5GXQ A;  4Z66 A;  5DNM C;  2Y2N A;  3C1C B;  1PZR A;  3AL0 C;  3O62 C;  5B40 B;  5CHL B;  3MVD B;  1KX5 A;  5AV5 D;  3AV1 B;  3X1T B;  3H0M C;  3REH A;  1P3A B;  3WTP B;  3LZ1 D;  3AZM B;  3WTP E;  3AZH A;  3X1V A;  1P3K B;  3MGS C;  1M19 D;  5B40 D;  3MNN A;  5BO0 A;  5CP6 D;  4WU8 D;  3NQU B;  5BNV A;  3X1T D;  3WKJ B;  3KWQ D;  5BS7 A;  3AYW C;  2F8N K;  4Z2M H;  3REL D;  4M6B A;  3B6F A;  1P3M D;  4J8U C;  3W99 D;  5B1M D;  3EPH A;  4H9R A;  5JRG C;  5B24 C;  3MGP C;  5B2I D;  3B0D C;  1HQ3 D;  5BNX B;  3AFA B;  3MGR B;  3UT9 B;  3A1K A;  4WU9 A;  4WZS B;  3AN2 A;  1P34 C;  4NFT A;  4J8X B;  4JJN A;  3UTB A;  4WNN B;  5CPK B;  1M1A B;  3LEL D;  5AV8 A;  2BYM B;  3KUY D;  4Z5T A;  4J8V B;  3WAA B;  3LJA C;  3F6T A;  3AZG A;  3MGR D;  2Y2G A;  4R8P B;  3AZK C;  3EPL A;  2NQB C;  5AY8 D;  4J8X D;  4XZQ A;  5AV6 C;  5CPK D;  5B0Y C;  4H9S C;  5GXQ C;  5GSU A;  4Z66 C;  1R4V A;  3W98 A;  1P3B A;  4CAY B;  2JSS A;  3B6G A;  1U35 A;  4QLC A;  5CPI A;  4R8P D;  1EQZ B;  4YM6 D;  1KX5 C;  1P3O D;  2BYK A;  3W96 A;  4NE3 A;  4ZBJ B;  4ZBJ C;  2HUE B;  1N1J B;  2FFF B;  2XD1 A;  4J8W A;  1P3G A;  3X1V C;  3AZH C;  5B32 A;  5AVB D;  5KDM A;  3MNN C;  5AVC A;  2Y2I A;  4ZUX C;  1P3I A;  1F66 A;  2F8N A;  5B33 D;  4H9Q B;  2RVQ C;  4H9N B;  5BS7 C;  2YFV A;  4HGA B;  3C1C A;  2HIO C;  3TU4 D;  5CPJ D;  5AV9 B;  4KUD B;  1P3F B;  3AZJ D;  4WJ3 C;  4G91 C;  5F99 D;  1Z2C B;  3MVD A;  3REK D;  3W97 C;  3AZL B;  1P3A A;  1P3P C;  3VH6 T;  2F8N G;  3AZM A;  4E45 A;  3UTB C;  2NZD B;  2PYO C;  1P3K A;  1P3F D;  5AV8 C;  3W96 B;  4Z5T C;  1JFI B;  3NQU A;  3MGQ C;  3AZG C;  3WKJ A;  5B1L B;  5GT3 B;  1TAF B;  3EG5 B;  4NE6 A;  5E5A C;  3LZ0 D;  4J8U A;  3X1S B;  3KXB B;  5JRG A;  2NZD D;  4XZQ C;  2Y2Q A;  5B0Z B;  5BT1 C;  3W98 C;  3AZF C;  1P3B C;  3AFA A;  3UT9 A;  2Y2O A;  3AV2 D;  1S32 B;  1U35 C;  5CPI C;  4QLC C;  3X1U D;  3AZN B;  1P3L B;  3AZE B;  3AZN C;  1P34 A;  2F2A C;  3REJ B;  4LD9 B;  5C3I B;  4KGC B;  3REI B;  1M1A A;  4YS3 C;  1M18 D;  4G92 B;  5B0Z D;  4J8V A;  4WU9 D;  1KX4 D;  5G49 B;  2G5H C;  5DNN C;  2ZY2 A;  5AV5 B;  2IO5 B;  5AV6 A;  1P3I C;  1ID3 D;  1WWI A;  5B0Y A;  1F66 C;  3A6N D;  4KGC D;  3KSY A;  3LZ1 B;  3C1C C;  4X23 D;  4AWL B;  1M19 B;  4DRA A;  1EQZ A;  5CP6 B;  4WU8 B;  5B40 C;  2J8P A;  3MVD C;  3R45 B;  3KWQ B;  3AV1 C;  3X1T C;  3V9R A;  1Q9C A;  1P3A C;  3REL B;  3WTP C;  3C1B B;  1P3M B;  3B6G D;  3W99 B;  5B1M B;  3AZM C;  3AZI B;  1TZY D;  3EPK A;  1P3K C;  5B2I B;  3UTA D;  4XUJ D;  4ZUX A;  1HQ3 B;  2FJ7 D;  3B0C T;  4NE5 A;  2ARO B;  3WKJ C;  4H9N A;  5B2J D;  2HIO A;  3EPJ A;  1P3G D;  3C1B D;  4EO5 B;  3LEL B;  4H9O B;  5AV9 A;  4KUD A;  2RIQ A;  3AZI D;  3KUY B;  3KUY C;  5GT0 D;  3WA9 B;  3W97 A;  5DNM D;  3MGR C;  2ARO D;  3AFA C;  1F1E A;  3UT9 C;  2CV5 B;  3AZL A;  1P3P A;  5AY8 B;  3O62 D;  4J8X C;  1M1A C;  5CPK C;  2PYO A;  1B67 A;  1T3U A;  1BH8 B;  3WA9 D;  3WAA C;  4J8V C;  3MGQ A;  1JFI A;  1AOI B;  2F8N H;  2XD5 A;  2BG1 A;  2CV5 D;  5B1L A;  4R8P C;  5GT3 A;  2Y2P A;  5E5A A;  4YM6 B;  1ZLA D;  1TAF A;  1P3O B;  3MGS D;  5FUG A;  3X1S A;  5JA4 B;  3KXB A;  1H3O A;  3AZF A;  1AOI D;  3AYW D;  4KHA B;  1S32 A;  5AVB B;  3AZN A;  4J8U D;  1P3L A;  4CSR B;  2UWX A;  3AZE A;  1EQZ C;  4LD9 A;  2YFW B;  5B31 D;  4YS3 A;  3REI A;  5B24 D;  3MGP D;  5B33 B;  3B0B A;  2HUE C;  3TU4 B;  3KFU G;  5CPJ B;  2Y2L A;  3VH5 T;  5DNN A;  5G49 A;  3AZJ B;  5F99 B;  1KX3 D;  3REK B;  1HTA A;  3LJA D;  3LZ1 A;  4HGA C;  2Y2M A;  3AZK D;  5AV9 C;  4KUD C;  2NQB D;  1P3F C;  5B40 A;  3REH B;  1B6W A;  3AV1 A;  3X1T A;  5GXQ D;  3R45 A;  4Z66 D;  3KWQ A;  3AZL C;  3REL A;  3LZ0 B;  3WTP A;  4Z2M G;  1P3M A;  3W99 A;  5B1M A;  2NZD C;  5BO0 B;  1BH9 B;  1KX5 D;  5BNV B;  5B2I A;  1HQ3 A;  3REH D;  3AV2 B;  3AV2 C;  3X1U B;  3B6F B;  5B1L C;  5GT3 C;  3AZH D;  3X1V D;  3LEL A;  4H9O A;  1M18 B;  3X1S C;  3KXB C;  3MNN D;  3KUY A;  1M18 C;  4WU9 B;  5B0Z C;  2JE5 A;  3MGR A;  5BNX A;  1KX4 B;  1S32 C;  4JJN B;  3B6F D;  1P3L C;  5AY8 A;  2JCH A;  3AZE C;  4J8X A;  3REJ C;  1ID3 B;  4WNN A;  3NQJ B;  5C3I C;  3A6N B;  3REI C;  5CPK A;  4KGC C;  2BYM A;  1BH8 A;  2Y2K A;  4G92 C;  3WAA A;  4X23 B;  1W2E A;  3AN2 D;  1BFM A;  4R8P A;  4YM6 A;  4JJN D;  3UTB D;  5AV5 C;  1P3O A;  2PYO D;  5AV8 D;  2IO5 C;  4Z5T D;  5JA4 A;  2DQN C;  1KU5 A;  3MGQ D;  3AZG D;  3B6G B;  3LZ1 C;  4DQY B;  3H0L C;  2CWE A;  4CAY A;  4KHA A;  1TZY B;  5AVB A;  3UTA B;  3VH6 W;  4XUJ B;  4AWL C;  3UTA C;  4CSR A;  1M19 C;  4XUJ C;  5CP6 C;  4XZQ D;  4WU8 C;  2FJ7 B;  2YFW A;  2Y2J A;  4UUZ B;  5GSU D;  5B31 G;  3KWQ C;  3W98 D;  1P3B D;  4J8W B;  1N1J A;  5B2J B;  3REL C;  1P3G B;  3TU4 A;  5B32 B;  4QLC D;  5CPI D;  3C1B C;  1U35 D;  1P3M C;  3W99 C;  5B1M C;  3AZI C;  5GT0 B;  5F99 A;  3W96 D;  2LY8 A;  5B2I C;  3REK A;  5DNM B;  1HQ3 C;  2YFV B;  2ARO C;  4H9Q A;  4E44 A;  4J8W D;  3O62 B;  5DNN D;  5B32 D;  4EO5 C;  3VH6 A;  3LEL C;  1P3F A;  1ULY A;  1WWS A;  4DRB A;  5AVC D;  3A1I A;  1P3I D;  1F66 D;  3WA9 C;  2F8N D;  2W8S A;  3C1C D;  4LD9 C;  2CV5 C;  1ZLA B;  3LZ0 A;  1ZLA C;  5AY8 C;  3MGS B;  2ZY4 A;  2NZD A;  1BH9 A;  3MVD D;  3AV1 D;  3AYW B;  1AOI C;  3AV2 A;  1A7W A;  1P3A D;  3X1U A;  3WTP D;  4J8U B;  4YM6 C;  5JRG B;  3AZM D;  5B31 B;  5B31 C;  5B24 B;  4H9P B;  3MGP B;  1P3K D;  3B0D B;  1P3O C;  1M18 A;  2ZY5 A;  5B0Z A;  3WKJ D;  1KX4 A;  1P34 B;  2DF4 C;  1KX3 B;  5AVB C;  1KX3 C;  3REJ A;  5JRG D;  4KGC A;  1ID3 A;  3NQJ A;  3A6N A;  3LJA B;  5B33 C;  3AFA D;  3UT9 D;  3AZK B;  3B0C W;  4X23 A;  3TU4 C;  5CPJ C;  2NQB B;  1P34 D;  3AZJ C;  5AV6 B;  5B0Y B;  5AV5 A;  5F99 C;  1M1A D;  3REK C;  5GXQ B;  4Z66 B;  4J8V D;  3WAA D;  3FDD A;  2ZY3 A;  1KX5 B;  1TZY A;  3UTA A;  1M19 A;  3P5J B;  4XUJ A;  5CP6 A;  5AV6 D;  4WU8 A;  5B0Y D;  3V9R B;  2FJ7 A;  3REH C;  4UUZ A;  5B2J A;  3AZH B;  2G5I C;  3X1V B;  3LZ0 C;  2Y2H A;  3C1B A;  3AZI A;  3MNN B;  1EQZ D;  4ZUX B;  5GT0 A;  5DNM A;  2ARO A;  4WV4 B;  2HIO B;  3X1U C;  3B6F C;  4H9R B;  3O62 A;  4UPK A;  4G91 B;  3W97 B;  5B32 G;  4ZUX D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...