2BYKB

Histone fold heterodimer of the chromatin accessibility complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
89
structure length
89
Chain Sequence
PNAVIGRLIKEALPESASVSKEARAAIARAASVFAIFVTSSSTALAHKQNHKTITAKDILQTLTELDFESFVPSLTQDLEVYRKVVKEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHRAC-16
publication title The Histone Fold Subunits of Drosophila Chrac Facilitate Nucleosome Sliding Through Dynamic DNA Interactions.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Dna binding protein
total genus 29
structure length 89
sequence length 89
chains with identical sequence D
ec nomenclature
pdb deposition date 2005-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00808 CBFD_NFYB_HMF Histone-like transcription factor (CBF/NF-Y) and archaeal histone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2bykB00
3MGPA 3UTBB 5AY8D 3A6NC 3REHC 2CV5C 4J8XB 4J8UB 3AFAD 4J8VB 3O62D 5E5AA 5B0ZA 5GSUB 3X1UA 1P3OD 2PYOA 3AZKC 5AV8D 1F66B 5B2JD 5B40A 3X1VD 3B6FA 1HQ3D 5E5AB 1Q9CA 3C1CC 3X1UB 5GT0A 5GT3D 3B6FB 4R8PC 4DRBA 3REJC 3X1TD 5DNNA 5GT0B 3VH5W 3UT9B 1HTAA 3KWQA 4H9NA 4Z5TA 1KX3C 5B33C 2L5AA 4XUJA 1M18D 5AV6B 3KWQB 1U35A 5AVCA 4YM6B 5CPKD 5DNMD 1P3AA 5AVCB 5B32D 4J8WA 3WAAD 3VH5T 1AOIA 4J8WB 1N1JA 3MGRA 4WU9D 3TU4D 5CPIC 2NQBA 5B0YC 1ZLAB 2FJ7B 1N1JB 4YS3C 3REKA 3B6GA 1EQZD 4WU8B 2HUEC 1TAFA 3W97D 4QLCC 3LJAD 1P34C 4KGCC 1P3LA 3AZHC 2YFVB 3WA9C 1F1EA 5GXQD 4DRAA 3C1BD 3AZJA 1TZYA 1P3BA 1M1AC 3MNND 3REHB 2AROA 3AZJB 5B24D 2CV5B 4KUDD 3V9RB 3MVDD 2AROB 1ID3A 3AZKB 5F99A 5B1MD 3C1CB 3WKJC 3LZ0C 1P3PD 4R8PB 1P3MD 3MGPC 3MGQD 1S32C 4H9OA 1KX3A 5G49A 3AV2D 3W98A 5AV9A 4H9OB 1KX3B 3RELA 2RVQD 5G49B 5E5AC 5B33B 5B0ZC 3UTBD 4LD9A 3X1UC 3LELA 5CPJA 2PYOC 3W98B 4Z66D 5AV9B 4CSRB 4J8XD 5B40C 4J8UD 3RELB 4J8VD 1P3FA 3B6FC 3NQJB 3MGSA 3VH6W 1M19A 4G91B 4LD9B 5CPJB 5GSUD 4X23A 3AZND 4AWLC 1P3FB 1F66D 4G92C 1KX4A 3LZ1D 5DNNC 5JRGA 3X1SA 3KUYC 3KWQC 5AV5D 4Z5TC 2YFWB 5CPIB 4XUJC 5B0YB 3UT9D 1P3GA 1B67A 1U35C 5AVCC 4YS3B 5AVBA 5C3IB 2HUEB 4QLCB 1P34B 3AZMA 1P3AC 5AV6D 4WV4B 3AV1C 3AZHB 4YM6D 5B1LA 1AOIC 3AZMB 2CWEA 1M1AB 3AN2D 3MGRC 3B0CW 4JJND 4NE5A 3AZED 2NQBC 3B0DC 3NQUB 3REKC 3B6GC 3WTPE 3WKJA 1ZLAD 2FJ7D 1P3LC 1S32A 3WKJB 3LZ0B 3AZIA 4WU8D 3AZJC 1TZYC 3UTAD 1P3BC 3MGPB 1S32B 2NZDD 3AZIB 3AZFA 2AROC 4XZQC 4H9QA 4CAYA 5B2IA 1P3IA 5B0ZB 5BS7A 3WTPA 3A6ND 3REHD 1ID3C 2PYOB 2CV5D 3R45A 5B40B 5F99C 5JA4A 3R45B 3KUYA 2F8NH 3AZKD 4AWLB 4NFTA 4G92B 5DNNB 3C1CD 2HIOA 3KUYB 3W98C 4H9NB 5AV9C 4Z5TB 4R8PD 3REJD 3RELC 4ZUXD 4XUJB 4LD9C 4G91C 3LELC 5CPJC 1U35B 3AV1A 1P3FC 5B33D 3MGSC 1M19C 1P3AB 4X23C 3REIA 3AV1B 1KX4C 5CP6A 1AOIB 1BH8A 2F8NA 5JRGC 3AZLA 3X1SC 3W99A 5B31A 5CP6B 3MGRB 5C3IC 4E45A 2NQBB 3B0DB 1P3GC 3KXBD 3REKB 3W96A 5BT1C 5AVBC 3AYWA 3B6GB 1TAFB 5CPID 3AZGC 4Z2MH 5B0YD 3AZMC 1P3LB 4YS3D 5B1LC 1TZYB 4XZQA 4QLCD 1P34D 4KGCD 1P3BB 5AY8A 3AZHD 3WA9D 4XZQB 3AFAA 3O62A 1M1AD 5AY8B 1WWSA 1P3OA 1ID3B 5AV8A 2F8NK 5B2JA 3X1VA 1HQ3A 5F99B 4H9SA 4WZSB 3AZIC 5GT3A 3X1TA 3AZFC 3WKJD 2IO5C 5GT3B 3LZ0D 5CHLB 5B2IC 1KX5C 1P3IC 3MGPD 1S32D 5BS7C 3WTPC 1M18A 3LELB 2RVQC 4H9PA 5CPKA 5DNMA 3MGSB 5E5AD 5B0ZD 4UUZA 1M19B 5B32A 3X1UD 4X23B 3WAAA 2PYOD 5B40D 3B6FD 1KX4B 5JRGB 3X1SB 2HIOC 5BNVA 5GT0D 4ZBJC 3VH6T 5BO0A 5FUGA 4WU9A 3TU4A 5DNND 5KDMA 3AZGA 4H9RA 1P3GB 5AV5C 3KWQD 5BO0B 5FUGB 5AVBB 1EQZA 4Z5TD 3W97A 5KDMB 3LJAA 3AZGB 2LY8A 4XUJD 2F8NG 4KHAA 3REIC 5AVCD 1U35D 1EQZB 5GXQA 3C1BA 4NE3A 5B1LB 3KSYA 1A7WA 5CP6C 5B31G 3AZLC 1P3KC 3W99C 1P3AD 4KHAB 3MNNA 4J8WD 3AV1D 5GXQB 4WNNA 5B31C 3C1BB 5B24A 4KUDA 1AOID 4M6BA 3MVDA 3AN2C 3AYWC 3W96C 4JJNC 3MGRD 3MVDB 2BYMA 2NQBD 1H3OA 5B1MA 3B0CT 3REKD 3B6GD 2BYMB 4EO5B 1H3OB 1P3PA 1P3MA 3MGQA 1KX5A 1P3LD 5AY8C 3AZFB 2IO5B 3AV2A 3UTAC 3AZJD 1TZYD 4H9QB 4CAYB 3AFAC 5B2IB 1KX5B 3O62C 3VH5A 1P3BD 1P3IB 3UTBA 3WTPB 1P3OC 2AROD 5AV8C 4Z66A 4Z2MG 5B2JC 3X1VC 4J8XA 4J8UA 1HQ3C 4J8VA 1BH9A 5JA4B 4H9SC 5GSUA 4Z66B 3AZNA 5GT3C 1ID3D 1F66A 1BH9B 3X1TC 5F99D 3LZ1A 3AZNB 2HIOB 4ZBJB 5AV5A 3LZ1B 1WWIA 1KX3D 3UT9A 1M18C 5AV5B 3W98D 5B32G 5AV9D 4ZUXC 5CPKC 5DNMC 3RELD 5AV6A 4LD9D 5B32C 5CPJD 3WAAC 3LELD 1P3KA 3REIB 4YM6A 1P3FD 2F8NB 1BH8B 3MGSD 3AZLB 1M19D 1P3KB 3W99B 1JFIA 4X23D 3AN2A 5B31B 4JJNA 4WU9C 3TU4C 1KX4D 3AZEA 5JRGD 3X1SD 1JFIB 3AN2B 3AYWB 3W96B 4JJNB 1EQZC 3AZEB 3W97C 3LJAC 1ZLAA 3KXBC 2FJ7A 1P3GD 5BT1D 5AVBD 1BFMA 5GXQC 4WU8A 3C1BC 3UTAA 4HGAC 3AZGD 3AZMD 2NZDA 4NE6A 3MNNC 2YFVA 5B24C 3UTAB 5B1LD 4KUDC 3AFAB 3MVDC 2NZDB 3O62B 2JSSA 3A6NA 3REHA 1P3OB 2CV5A 5AV8B 5B2JB 3V9RA 4EO5C 3X1VB 1HQ3B 5B1MC 3A6NB 3AZKA 1P3PC 1P3MC 3VH6A 3MGQC 3X1TB 2BYKA 3C1CA 3AZID 3AV2C 4R8PA 1ULYA 2BYKB 3REJA 4ZUXA 3UTBC 3AZFD 1M18B 4Z66C 4J8XC 4J8UC 3REJB 4J8VC 5B2ID 1KX5D 4H9PB 4ZUXB 5B33A 5DNMB 5CPKB 1P3ID 4UUZB 5GSUC 3WTPD 3AZNC 5B32B 3WAAB 1F66C 4CSRA 3LZ1C 3NQJA 5BNVB 3KUYD 4WU9B 3TU4B 5GT0C 3UT9C 3B0BA 2HIOD 4H9RB 3KXBA 1R4VA 2YFWA 3W97B 5CPIA 3LJAB 5B0YA 1KU5A 5AV6C 3KXBB 4YS3A 4YM6C 4QLCA 1P34A 4KGCA 4HGAB 3MNNB 3REID 3AZHA 4WNNB 3WA9A 5B24B 2F8ND 5CP6D 3AZEC 4KGCB 4KUDB 3AZLD 1B6WA 3W99D 4J8WC 1P3KD 1M1AA 3WA9B 5B31D 5BNXA 1ZLAC 4E44A 2FJ7C 3NQUA 5B1MB 3AYWD 3W96D 5BNXB 4WU8C 1P3PB 1P3MB 3MGQB 2NZDC 3LZ0A 3AV2B 4XZQD
chains in the Genus database with same CATH superfamily
2ZY5A 3MGPA 3UTBB 5AY8D 3A6NC 3EPKA 3F6TA 3REHC 2XD5A 2CV5C 4J8XB 4J8UB 3AFAD 4J8VB 3O62D 5E5AA 5B0ZA 5GSUB 1PZRA 3X1UA 1P3OD 2PYOA 3AZKC 5AV8D 3EG5B 1F66B 5B2JD 5B40A 3X1VD 3B6FA 1HQ3D 5E5AB 1Q9CA 3C1CC 3X1UB 5GT0A 5GT3D 3B6FB 4R8PC 4DRBA 3REJC 2Y2GA 3X1TD 5DNNA 5GT0B 3VH5W 3UT9B 1HTAA 3KWQA 2JE5A 4H9NA 4Z5TA 1KX3C 5B33C 2L5AA 4XUJA 1M18D 5AV6B 3KWQB 1U35A 5AVCA 4YM6B 5CPKD 5DNMD 1P3AA 5AVCB 5B32D 4J8WA 2VQRA 3WAAD 3VH5T 1AOIA 4J8WB 1N1JA 3MGRA 4WU9D 3TU4D 5CPIC 2NQBA 5B0YC 1ZLAB 2FJ7B 1N1JB 4YS3C 3REKA 3B6GA 3KFUG 1EQZD 3A1IA 4WU8B 2HUEC 1TAFA 3W97D 2FFFB 4QLCC 3LJAD 1P34C 4KGCC 1P3LA 3AZHC 3EPHA 2YFVB 3WA9C 1F1EA 5GXQD 4DRAA 3C1BD 3AZJA 1TZYA 1P3BA 1M1AC 3MNND 3REHB 2AROA 3AZJB 5B24D 2CV5B 4KUDD 3V9RB 3MVDD 2AROB 1ID3A 3AZKB 5F99A 5B1MD 3C1CB 3WKJC 3LZ0C 1P3PD 4R8PB 1P3MD 3MGPC 3MGQD 1S32C 4H9OA 1KX3A 5G49A 3AV2D 3W98A 5AV9A 2Y2KA 4H9OB 1KX3B 3RELA 2RVQD 5G49B 5E5AC 5B33B 5B0ZC 3UTBD 2J8PA 4LD9A 3X1UC 3LELA 5CPJA 2PYOC 3W98B 4Z66D 5AV9B 4CSRB 4J8XD 5B40C 4J8UD 2Y2PA 4J8VD 3RELB 1P3FA 3B6FC 3NQJB 3MGSA 3VH6W 1M19A 4G91B 4LD9B 5CPJB 5GSUD 4X23A 3AZND 4AWLC 1P3FB 1F66D 4G92C 1KX4A 3LZ1D 5DNNC 5JRGA 3X1SA 3KUYC 3KWQC 5AV5D 4Z5TC 2YFWB 5CPIB 4XUJC 5B0YB 3UT9D 1P3GA 1B67A 1U35C 5AVCC 4YS3B 5AVBA 5C3IB 2HUEB 3H0LC 4QLCB 1P34B 3AZMA 1P3AC 5AV6D 4WV4B 3AV1C 3AZHB 2Y2HA 4YM6D 5B1LA 1AOIC 3AZMB 2CWEA 1M1AB 2ZM5A 3AN2D 3MGRC 3B0CW 4JJND 4NE5A 3AZED 2NQBC 3B0DC 3NQUB 3REKC 3B6GC 3WTPE 3WKJA 1ZLAD 2FJ7D 2Y2IA 1P3LC 1S32A 3WKJB 2Y2MA 3LZ0B 3AZIA 4WU8D 3AZJC 1TZYC 3UTAD 1P3BC 3MGPB 1S32B 2NZDD 3AZIB 3AZFA 2AROC 4XZQC 4H9QA 4CAYA 5B2IA 1P3IA 5B0ZB 5BS7A 3WTPA 3A6ND 3REHD 1ID3C 2PYOB 2CV5D 3R45A 5B40B 5F99C 5JA4A 2G5IC 3R45B 3KUYA 2F8NH 3AZKD 2Y2JA 4AWLB 4NFTA 4G92B 5DNNB 3C1CD 2HIOA 3KUYB 3W98C 2G5HC 4H9NB 5AV9C 4Z5TB 4R8PD 3REJD 3RELC 4ZUXD 4XUJB 4LD9C 4G91C 3LELC 3H0MC 5CPJC 1U35B 3AV1A 1P3FC 5B33D 3MGSC 1M19C 1P3AB 4X23C 3REIA 3AV1B 1KX4C 5CP6A 1AOIB 1BH8A 2F8NA 5JRGC 3AZLA 3X1SC 3W99A 5B31A 5CP6B 3MGRB 3A1KA 5C3IC 4E45A 2NQBB 3B0DB 1P3GC 3KXBD 3REKB 3W96A 5BT1C 5AVBC 3AYWA 3B6GB 1TAFB 2ZY3A 5CPID 3AZGC 4Z2MH 5B0YD 3AZMC 1P3LB 4YS3D 5B1LC 1TZYB 4XZQA 4QLCD 1P34D 4KGCD 1P3BB 2Y2NA 5AY8A 3AZHD 3WA9D 4XZQB 3AFAA 3O62A 1M1AD 5AY8B 1WWSA 1P3OA 1ID3B 5AV8A 2F8NK 5B2JA 3X1VA 1HQ3A 5F99B 2DF4C 4H9SA 4WZSB 3AZIC 5GT3A 3X1TA 3AZFC 3WKJD 2IO5C 5GT3B 3LZ0D 3P5JB 5CHLB 5B2IC 1KX5C 1P3IC 3MGPD 1S32D 1Z2CB 5BS7C 3WTPC 1M18A 3LELB 2RVQC 4H9PA 5CPKA 5DNMA 3MGSB 5E5AD 5B0ZD 4UUZA 1M19B 5B32A 3X1UD 4X23B 3WAAA 2PYOD 2UWXA 5B40D 3B6FD 1KX4B 5JRGB 3X1SB 2HIOC 5BNVA 5GT0D 4ZBJC 3VH6T 5BO0A 5FUGA 4WU9A 3TU4A 5DNND 5KDMA 3AZGA 4H9RA 1P3GB 5AV5C 3KWQD 5BO0B 5FUGB 5AVBB 1EQZA 4Z5TD 3W97A 5KDMB 3LJAA 3AZGB 2LY8A 4XUJD 2F8NG 2DQNC 4KHAA 3REIC 5AVCD 1U35D 1EQZB 5GXQA 4WJ3C 3C1BA 4NE3A 5B1LB 3KSYA 1A7WA 5CP6C 5B31G 3AZLC 1P3KC 3W99C 1P3AD 4KHAB 3MNNA 4J8WD 3AV1D 5GXQB 4WNNA 5B31C 3C1BB 5B24A 4KUDA 1AOID 4M6BA 3MVDA 3AN2C 3AYWC 3W96C 4JJNC 3MGRD 3MVDB 2BYMA 2NQBD 1H3OA 5B1MA 3B0CT 3REKD 3B6GD 2BYMB 4EO5B 1H3OB 1P3PA 1P3MA 3MGQA 1KX5A 1P3LD 5AY8C 3AZFB 2IO5B 3AV2A 3UTAC 3AZJD 1TZYD 4H9QB 4CAYB 3AFAC 5B2IB 1KX5B 3O62C 3VH5A 1P3BD 1P3IB 2XD1A 3UTBA 3WTPB 1P3OC 2AROD 5AV8C 4Z66A 4Z2MG 5B2JC 3X1VC 4J8XA 4J8UA 1HQ3C 4J8VA 1BH9A 5JA4B 4H9SC 5GSUA 4Z66B 3AZNA 5GT3C 1ID3D 1F66A 1BH9B 3X1TC 5F99D 3LZ1A 3AZNB 2HIOB 4ZBJB 5AV5A 3LZ1B 1WWIA 1KX3D 3IP4C 3UT9A 2W8SA 1M18C 5AV5B 3W98D 5B32G 5AV9D 4ZUXC 5CPKC 5DNMC 3RELD 4DQYB 5AV6A 4LD9D 5B32C 5CPJD 3WAAC 3LELD 1P3KA 3REIB 4YM6A 1P3FD 2F8NB 1BH8B 3MGSD 3AZLB 1M19D 1P3KB 3W99B 1JFIA 4X23D 3AN2A 5B31B 4JJNA 4WU9C 3TU4C 1KX4D 3AZEA 2RIQA 5JRGD 3X1SD 1JFIB 3AN2B 3AYWB 3W96B 4JJNB 1EQZC 3AZEB 3W97C 3LJAC 3AL0C 1ZLAA 3KXBC 2FJ7A 1P3GD 5BT1D 5AVBD 1BFMA 5GXQC 4WU8A 3C1BC 3EPLA 3UTAA 4HGAC 3AZGD 3AZMD 2NZDA 4NE6A 3MNNC 2YFVA 5B24C 3UTAB 5B1LD 3EPJA 4KUDC 3AFAB 3MVDC 2NZDB 2JCHA 3O62B 2JSSA 3A6NA 3REHA 1P3OB 2CV5A 5AV8B 5B2JB 3V9RA 4EO5C 3X1VB 1HQ3B 5B1MC 2ZY2A 3A6NB 3AZKA 1P3PC 1P3MC 3VH6A 3MGQC 3X1TB 2BYKA 3C1CA 3AZID 3AV2C 4R8PA 1ULYA 2BYKB 3REJA 4ZUXA 3UTBC 1T3UA 3AZFD 1M18B 4Z66C 4J8XC 4J8UC 3REJB 4J8VC 5B2ID 1KX5D 4H9PB 4ZUXB 5B33A 5DNMB 5CPKB 1P3ID 4UUZB 5GSUC 3WTPD 3AZNC 5B32B 3WAAB 2Y2QA 1F66C 4CSRA 3LZ1C 3NQJA 5BNVB 3KUYD 2BG1A 4WU9B 3TU4B 4UPKA 5GT0C 3UT9C 3B0BA 2HIOD 4H9RB 3KXBA 1R4VA 2F2AC 2YFWA 3W97B 5CPIA 3LJAB 5B0YA 1KU5A 2Y2LA 5AV6C 3KXBB 4YS3A 4YM6C 4QLCA 1P34A 4KGCA 4HGAB 1W2EA 3MNNB 3REID 3AZHA 4WNNB 3WA9A 5B24B 2F8ND 5CP6D 3AZEC 4KGCB 4KUDB 2ZY4A 3AZLD 1B6WA 3W99D 4J8WC 1P3KD 1M1AA 3WA9B 5B31D 3FDDA 5BNXA 1ZLAC 4E44A 2FJ7C 3NQUA 5B1MB 3AYWD 3W96D 5BNXB 4WU8C 3H0RC 1P3PB 2Y2OA 1P3MB 3MGQB 2NZDC 3LZ0A 3AV2B 4XZQD
chains in the Genus database with same CATH topology
2ZY5A 3MGPA 3UTBB 5AY8D 3A6NC 3EPKA 3F6TA 3REHC 2XD5A 2CV5C 4J8XB 4J8UB 3AFAD 4J8VB 3O62D 5E5AA 5B0ZA 5GSUB 1PZRA 3X1UA 1P3OD 2PYOA 3AZKC 5AV8D 3EG5B 1F66B 5B2JD 5B40A 3X1VD 3B6FA 1HQ3D 5E5AB 1Q9CA 3C1CC 3X1UB 5GT0A 5GT3D 3B6FB 4R8PC 4DRBA 3REJC 2Y2GA 3X1TD 5DNNA 5GT0B 3VH5W 3UT9B 1HTAA 3KWQA 2JE5A 4H9NA 4Z5TA 1KX3C 5B33C 2L5AA 4XUJA 1M18D 5AV6B 3KWQB 1U35A 5AVCA 4YM6B 5CPKD 5DNMD 1P3AA 5AVCB 5B32D 4J8WA 2VQRA 3WAAD 3VH5T 1AOIA 4J8WB 1N1JA 3MGRA 4WU9D 3TU4D 5CPIC 2NQBA 5B0YC 1ZLAB 2FJ7B 1N1JB 4YS3C 3REKA 3B6GA 3KFUG 1EQZD 3A1IA 4WU8B 2HUEC 1TAFA 3W97D 2FFFB 4QLCC 3LJAD 1P34C 4KGCC 1P3LA 3AZHC 3EPHA 2YFVB 3WA9C 1F1EA 5GXQD 4DRAA 3C1BD 3AZJA 1TZYA 1P3BA 1M1AC 3MNND 3REHB 2AROA 3AZJB 5B24D 2CV5B 4KUDD 3V9RB 3MVDD 2AROB 1ID3A 3AZKB 5F99A 5B1MD 3C1CB 3WKJC 3LZ0C 1P3PD 4R8PB 1P3MD 3MGPC 3MGQD 1S32C 4H9OA 1KX3A 5G49A 3AV2D 3W98A 5AV9A 2Y2KA 4H9OB 1KX3B 3RELA 2RVQD 5G49B 5E5AC 5B33B 5B0ZC 3UTBD 2J8PA 4LD9A 3X1UC 3LELA 5CPJA 2PYOC 3W98B 4Z66D 5AV9B 4CSRB 4J8XD 5B40C 4J8UD 2Y2PA 4J8VD 3RELB 1P3FA 3B6FC 3NQJB 3MGSA 3VH6W 1M19A 4G91B 4LD9B 5CPJB 5GSUD 4X23A 3AZND 4AWLC 1P3FB 1F66D 4G92C 1KX4A 3LZ1D 5DNNC 5JRGA 3X1SA 3KUYC 3KWQC 5AV5D 4Z5TC 2YFWB 5CPIB 4XUJC 5B0YB 3UT9D 1P3GA 1B67A 1U35C 5AVCC 4YS3B 5AVBA 5C3IB 2HUEB 3H0LC 4QLCB 1P34B 3AZMA 1P3AC 5AV6D 4WV4B 3AV1C 3AZHB 2Y2HA 4YM6D 5B1LA 1AOIC 3AZMB 2CWEA 1M1AB 2ZM5A 3AN2D 3MGRC 3B0CW 4JJND 4NE5A 3AZED 2NQBC 3B0DC 3NQUB 3REKC 3B6GC 3WTPE 3WKJA 1ZLAD 2FJ7D 2Y2IA 1P3LC 1S32A 3WKJB 2Y2MA 3LZ0B 3AZIA 4WU8D 3AZJC 1TZYC 3UTAD 1P3BC 3MGPB 1S32B 2NZDD 3AZIB 3AZFA 2AROC 4XZQC 4H9QA 4CAYA 5B2IA 1P3IA 5B0ZB 5BS7A 3WTPA 3A6ND 3REHD 1ID3C 2PYOB 2CV5D 3R45A 5B40B 5F99C 5JA4A 2G5IC 3R45B 3KUYA 2F8NH 3AZKD 2Y2JA 4AWLB 4NFTA 4G92B 5DNNB 3C1CD 2HIOA 3KUYB 3W98C 2G5HC 4H9NB 5AV9C 4Z5TB 4R8PD 3REJD 3RELC 4ZUXD 4XUJB 4LD9C 4G91C 3LELC 3H0MC 5CPJC 1U35B 3AV1A 1P3FC 5B33D 3MGSC 1M19C 1P3AB 4X23C 3REIA 3AV1B 1KX4C 5CP6A 1AOIB 1BH8A 2F8NA 5JRGC 3AZLA 3X1SC 3W99A 5B31A 5CP6B 3MGRB 3A1KA 5C3IC 4E45A 2NQBB 3B0DB 1P3GC 3KXBD 3REKB 3W96A 5BT1C 5AVBC 3AYWA 3B6GB 1TAFB 2ZY3A 5CPID 3AZGC 4Z2MH 5B0YD 3AZMC 1P3LB 4YS3D 5B1LC 1TZYB 4XZQA 4QLCD 1P34D 4KGCD 1P3BB 2Y2NA 5AY8A 3AZHD 3WA9D 4XZQB 3AFAA 3O62A 1M1AD 5AY8B 1WWSA 1P3OA 1ID3B 5AV8A 2F8NK 5B2JA 3X1VA 1HQ3A 5F99B 2DF4C 4H9SA 4WZSB 3AZIC 5GT3A 3X1TA 3AZFC 3WKJD 2IO5C 5GT3B 3LZ0D 3P5JB 5CHLB 5B2IC 1KX5C 1P3IC 3MGPD 1S32D 1Z2CB 5BS7C 3WTPC 1M18A 3LELB 2RVQC 4H9PA 5CPKA 5DNMA 3MGSB 5E5AD 5B0ZD 4UUZA 1M19B 5B32A 3X1UD 4X23B 3WAAA 2PYOD 2UWXA 5B40D 3B6FD 1KX4B 5JRGB 3X1SB 2HIOC 5BNVA 5GT0D 4ZBJC 3VH6T 5BO0A 5FUGA 4WU9A 3TU4A 5DNND 5KDMA 3AZGA 4H9RA 1P3GB 5AV5C 3KWQD 5BO0B 5FUGB 5AVBB 1EQZA 4Z5TD 3W97A 5KDMB 3LJAA 3AZGB 2LY8A 4XUJD 2F8NG 2DQNC 4KHAA 3REIC 5AVCD 1U35D 1EQZB 5GXQA 4WJ3C 3C1BA 4NE3A 5B1LB 3KSYA 1A7WA 5CP6C 5B31G 3AZLC 1P3KC 3W99C 1P3AD 4KHAB 3MNNA 4J8WD 3AV1D 5GXQB 4WNNA 5B31C 3C1BB 5B24A 4KUDA 1AOID 4M6BA 3MVDA 3AN2C 3AYWC 3W96C 4JJNC 3MGRD 3MVDB 2BYMA 2NQBD 1H3OA 5B1MA 3B0CT 3REKD 3B6GD 2BYMB 4EO5B 1H3OB 1P3PA 1P3MA 3MGQA 1KX5A 1P3LD 5AY8C 3AZFB 2IO5B 3AV2A 3UTAC 3AZJD 1TZYD 4H9QB 4CAYB 3AFAC 5B2IB 1KX5B 3O62C 3VH5A 1P3BD 1P3IB 2XD1A 3UTBA 3WTPB 1P3OC 2AROD 5AV8C 4Z66A 4Z2MG 5B2JC 3X1VC 4J8XA 4J8UA 1HQ3C 4J8VA 1BH9A 5JA4B 4H9SC 5GSUA 4Z66B 3AZNA 5GT3C 1ID3D 1F66A 1BH9B 3X1TC 5F99D 3LZ1A 3AZNB 2HIOB 4ZBJB 5AV5A 3LZ1B 1WWIA 1KX3D 3IP4C 3UT9A 2W8SA 1M18C 5AV5B 3W98D 5B32G 5AV9D 4ZUXC 5CPKC 5DNMC 3RELD 4DQYB 5AV6A 4LD9D 5B32C 5CPJD 3WAAC 3LELD 1P3KA 3REIB 4YM6A 1P3FD 2F8NB 1BH8B 3MGSD 3AZLB 1M19D 1P3KB 3W99B 1JFIA 4X23D 3AN2A 5B31B 4JJNA 4WU9C 3TU4C 1KX4D 3AZEA 2RIQA 5JRGD 3X1SD 1JFIB 3AN2B 3AYWB 3W96B 4JJNB 1EQZC 3AZEB 3W97C 3LJAC 3AL0C 1ZLAA 3KXBC 2FJ7A 1P3GD 5BT1D 5AVBD 1BFMA 5GXQC 4WU8A 3C1BC 3EPLA 3UTAA 4HGAC 3AZGD 3AZMD 2NZDA 4NE6A 3MNNC 2YFVA 5B24C 3UTAB 5B1LD 3EPJA 4KUDC 3AFAB 3MVDC 2NZDB 2JCHA 3O62B 2JSSA 3A6NA 3REHA 1P3OB 2CV5A 5AV8B 5B2JB 3V9RA 4EO5C 3X1VB 1HQ3B 5B1MC 2ZY2A 3A6NB 3AZKA 1P3PC 1P3MC 3VH6A 3MGQC 3X1TB 2BYKA 3C1CA 3AZID 3AV2C 4R8PA 1ULYA 2BYKB 3REJA 4ZUXA 3UTBC 1T3UA 3AZFD 1M18B 4Z66C 4J8XC 4J8UC 3REJB 4J8VC 5B2ID 1KX5D 4H9PB 4ZUXB 5B33A 5DNMB 5CPKB 1P3ID 4UUZB 5GSUC 3WTPD 3AZNC 5B32B 3WAAB 2Y2QA 1F66C 4CSRA 3LZ1C 3NQJA 5BNVB 3KUYD 2BG1A 4WU9B 3TU4B 4UPKA 5GT0C 3UT9C 3B0BA 2HIOD 4H9RB 3KXBA 1R4VA 2F2AC 2YFWA 3W97B 5CPIA 3LJAB 5B0YA 1KU5A 2Y2LA 5AV6C 3KXBB 4YS3A 4YM6C 4QLCA 1P34A 4KGCA 4HGAB 1W2EA 3MNNB 3REID 3AZHA 4WNNB 3WA9A 5B24B 2F8ND 5CP6D 3AZEC 4KGCB 4KUDB 2ZY4A 3AZLD 1B6WA 3W99D 4J8WC 1P3KD 1M1AA 3WA9B 5B31D 3FDDA 5BNXA 1ZLAC 4E44A 2FJ7C 3NQUA 5B1MB 3AYWD 3W96D 5BNXB 4WU8C 3H0RC 1P3PB 2Y2OA 1P3MB 3MGQB 2NZDC 3LZ0A 3AV2B 4XZQD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MGP A;  3UTB B;  5AY8 D;  3A6N C;  3REH C;  2CV5 C;  4J8X B;  4J8U B;  3AFA D;  4J8V B;  3O62 D;  5E5A A;  5B0Z A;  5GSU B;  3X1U A;  1P3O D;  2PYO A;  3AZK C;  5AV8 D;  1F66 B;  5B2J D;  5B40 A;  3X1V D;  3B6F A;  1HQ3 D;  5E5A B;  1Q9C A;  3C1C C;  3X1U B;  5GT0 A;  5GT3 D;  3B6F B;  4R8P C;  4DRB A;  3REJ C;  3X1T D;  5DNN A;  5GT0 B;  3VH5 W;  3UT9 B;  1HTA A;  3KWQ A;  4H9N A;  4Z5T A;  1KX3 C;  5B33 C;  2L5A A;  4XUJ A;  1M18 D;  5AV6 B;  3KWQ B;  1U35 A;  5AVC A;  4YM6 B;  5CPK D;  5DNM D;  1P3A A;  5AVC B;  5B32 D;  4J8W A;  3WAA D;  3VH5 T;  1AOI A;  4J8W B;  1N1J A;  3MGR A;  4WU9 D;  3TU4 D;  5CPI C;  2NQB A;  5B0Y C;  1ZLA B;  2FJ7 B;  1N1J B;  4YS3 C;  3REK A;  3B6G A;  1EQZ D;  4WU8 B;  2HUE C;  1TAF A;  3W97 D;  4QLC C;  3LJA D;  1P34 C;  4KGC C;  1P3L A;  3AZH C;  2YFV B;  3WA9 C;  1F1E A;  5GXQ D;  4DRA A;  3C1B D;  3AZJ A;  1TZY A;  1P3B A;  1M1A C;  3MNN D;  3REH B;  2ARO A;  3AZJ B;  5B24 D;  2CV5 B;  4KUD D;  3V9R B;  3MVD D;  2ARO B;  1ID3 A;  3AZK B;  5F99 A;  5B1M D;  3C1C B;  3WKJ C;  3LZ0 C;  1P3P D;  4R8P B;  1P3M D;  3MGP C;  3MGQ D;  1S32 C;  4H9O A;  1KX3 A;  5G49 A;  3AV2 D;  3W98 A;  5AV9 A;  4H9O B;  1KX3 B;  3REL A;  2RVQ D;  5G49 B;  5E5A C;  5B33 B;  5B0Z C;  3UTB D;  4LD9 A;  3X1U C;  3LEL A;  5CPJ A;  2PYO C;  3W98 B;  4Z66 D;  5AV9 B;  4CSR B;  4J8X D;  5B40 C;  4J8U D;  3REL B;  4J8V D;  1P3F A;  3B6F C;  3NQJ B;  3MGS A;  3VH6 W;  1M19 A;  4G91 B;  4LD9 B;  5CPJ B;  5GSU D;  4X23 A;  3AZN D;  4AWL C;  1P3F B;  1F66 D;  4G92 C;  1KX4 A;  3LZ1 D;  5DNN C;  5JRG A;  3X1S A;  3KUY C;  3KWQ C;  5AV5 D;  4Z5T C;  2YFW B;  5CPI B;  4XUJ C;  5B0Y B;  3UT9 D;  1P3G A;  1B67 A;  1U35 C;  5AVC C;  4YS3 B;  5AVB A;  5C3I B;  2HUE B;  4QLC B;  1P34 B;  3AZM A;  1P3A C;  5AV6 D;  4WV4 B;  3AV1 C;  3AZH B;  4YM6 D;  5B1L A;  1AOI C;  3AZM B;  2CWE A;  1M1A B;  3AN2 D;  3MGR C;  3B0C W;  4JJN D;  4NE5 A;  3AZE D;  2NQB C;  3B0D C;  3NQU B;  3REK C;  3B6G C;  3WTP E;  3WKJ A;  1ZLA D;  2FJ7 D;  1P3L C;  1S32 A;  3WKJ B;  3LZ0 B;  3AZI A;  4WU8 D;  3AZJ C;  1TZY C;  3UTA D;  1P3B C;  3MGP B;  1S32 B;  2NZD D;  3AZI B;  3AZF A;  2ARO C;  4XZQ C;  4H9Q A;  4CAY A;  5B2I A;  1P3I A;  5B0Z B;  5BS7 A;  3WTP A;  3A6N D;  3REH D;  1ID3 C;  2PYO B;  2CV5 D;  3R45 A;  5B40 B;  5F99 C;  5JA4 A;  3R45 B;  3KUY A;  2F8N H;  3AZK D;  4AWL B;  4NFT A;  4G92 B;  5DNN B;  3C1C D;  2HIO A;  3KUY B;  3W98 C;  4H9N B;  5AV9 C;  4Z5T B;  4R8P D;  3REJ D;  3REL C;  4ZUX D;  4XUJ B;  4LD9 C;  4G91 C;  3LEL C;  5CPJ C;  1U35 B;  3AV1 A;  1P3F C;  5B33 D;  3MGS C;  1M19 C;  1P3A B;  4X23 C;  3REI A;  3AV1 B;  1KX4 C;  5CP6 A;  1AOI B;  1BH8 A;  2F8N A;  5JRG C;  3AZL A;  3X1S C;  3W99 A;  5B31 A;  5CP6 B;  3MGR B;  5C3I C;  4E45 A;  2NQB B;  3B0D B;  1P3G C;  3KXB D;  3REK B;  3W96 A;  5BT1 C;  5AVB C;  3AYW A;  3B6G B;  1TAF B;  5CPI D;  3AZG C;  4Z2M H;  5B0Y D;  3AZM C;  1P3L B;  4YS3 D;  5B1L C;  1TZY B;  4XZQ A;  4QLC D;  1P34 D;  4KGC D;  1P3B B;  5AY8 A;  3AZH D;  3WA9 D;  4XZQ B;  3AFA A;  3O62 A;  1M1A D;  5AY8 B;  1WWS A;  1P3O A;  1ID3 B;  5AV8 A;  2F8N K;  5B2J A;  3X1V A;  1HQ3 A;  5F99 B;  4H9S A;  4WZS B;  3AZI C;  5GT3 A;  3X1T A;  3AZF C;  3WKJ D;  2IO5 C;  5GT3 B;  3LZ0 D;  5CHL B;  5B2I C;  1KX5 C;  1P3I C;  3MGP D;  1S32 D;  5BS7 C;  3WTP C;  1M18 A;  3LEL B;  2RVQ C;  4H9P A;  5CPK A;  5DNM A;  3MGS B;  5E5A D;  5B0Z D;  4UUZ A;  1M19 B;  5B32 A;  3X1U D;  4X23 B;  3WAA A;  2PYO D;  5B40 D;  3B6F D;  1KX4 B;  5JRG B;  3X1S B;  2HIO C;  5BNV A;  5GT0 D;  4ZBJ C;  3VH6 T;  5BO0 A;  5FUG A;  4WU9 A;  3TU4 A;  5DNN D;  5KDM A;  3AZG A;  4H9R A;  1P3G B;  5AV5 C;  3KWQ D;  5BO0 B;  5FUG B;  5AVB B;  1EQZ A;  4Z5T D;  3W97 A;  5KDM B;  3LJA A;  3AZG B;  2LY8 A;  4XUJ D;  2F8N G;  4KHA A;  3REI C;  5AVC D;  1U35 D;  1EQZ B;  5GXQ A;  3C1B A;  4NE3 A;  5B1L B;  3KSY A;  1A7W A;  5CP6 C;  5B31 G;  3AZL C;  1P3K C;  3W99 C;  1P3A D;  4KHA B;  3MNN A;  4J8W D;  3AV1 D;  5GXQ B;  4WNN A;  5B31 C;  3C1B B;  5B24 A;  4KUD A;  1AOI D;  4M6B A;  3MVD A;  3AN2 C;  3AYW C;  3W96 C;  4JJN C;  3MGR D;  3MVD B;  2BYM A;  2NQB D;  1H3O A;  5B1M A;  3B0C T;  3REK D;  3B6G D;  2BYM B;  4EO5 B;  1H3O B;  1P3P A;  1P3M A;  3MGQ A;  1KX5 A;  1P3L D;  5AY8 C;  3AZF B;  2IO5 B;  3AV2 A;  3UTA C;  3AZJ D;  1TZY D;  4H9Q B;  4CAY B;  3AFA C;  5B2I B;  1KX5 B;  3O62 C;  3VH5 A;  1P3B D;  1P3I B;  3UTB A;  3WTP B;  1P3O C;  2ARO D;  5AV8 C;  4Z66 A;  4Z2M G;  5B2J C;  3X1V C;  4J8X A;  4J8U A;  1HQ3 C;  4J8V A;  1BH9 A;  5JA4 B;  4H9S C;  5GSU A;  4Z66 B;  3AZN A;  5GT3 C;  1ID3 D;  1F66 A;  1BH9 B;  3X1T C;  5F99 D;  3LZ1 A;  3AZN B;  2HIO B;  4ZBJ B;  5AV5 A;  3LZ1 B;  1WWI A;  1KX3 D;  3UT9 A;  1M18 C;  5AV5 B;  3W98 D;  5B32 G;  5AV9 D;  4ZUX C;  5CPK C;  5DNM C;  3REL D;  5AV6 A;  4LD9 D;  5B32 C;  5CPJ D;  3WAA C;  3LEL D;  1P3K A;  3REI B;  4YM6 A;  1P3F D;  2F8N B;  1BH8 B;  3MGS D;  3AZL B;  1M19 D;  1P3K B;  3W99 B;  1JFI A;  4X23 D;  3AN2 A;  5B31 B;  4JJN A;  4WU9 C;  3TU4 C;  1KX4 D;  3AZE A;  5JRG D;  3X1S D;  1JFI B;  3AN2 B;  3AYW B;  3W96 B;  4JJN B;  1EQZ C;  3AZE B;  3W97 C;  3LJA C;  1ZLA A;  3KXB C;  2FJ7 A;  1P3G D;  5BT1 D;  5AVB D;  1BFM A;  5GXQ C;  4WU8 A;  3C1B C;  3UTA A;  4HGA C;  3AZG D;  3AZM D;  2NZD A;  4NE6 A;  3MNN C;  2YFV A;  5B24 C;  3UTA B;  5B1L D;  4KUD C;  3AFA B;  3MVD C;  2NZD B;  3O62 B;  2JSS A;  3A6N A;  3REH A;  1P3O B;  2CV5 A;  5AV8 B;  5B2J B;  3V9R A;  4EO5 C;  3X1V B;  1HQ3 B;  5B1M C;  3A6N B;  3AZK A;  1P3P C;  1P3M C;  3VH6 A;  3MGQ C;  3X1T B;  2BYK A;  3C1C A;  3AZI D;  3AV2 C;  4R8P A;  1ULY A;  2BYK B;  3REJ A;  4ZUX A;  3UTB C;  3AZF D;  1M18 B;  4Z66 C;  4J8X C;  4J8U C;  3REJ B;  4J8V C;  5B2I D;  1KX5 D;  4H9P B;  4ZUX B;  5B33 A;  5DNM B;  5CPK B;  1P3I D;  4UUZ B;  5GSU C;  3WTP D;  3AZN C;  5B32 B;  3WAA B;  1F66 C;  4CSR A;  3LZ1 C;  3NQJ A;  5BNV B;  3KUY D;  4WU9 B;  3TU4 B;  5GT0 C;  3UT9 C;  3B0B A;  2HIO D;  4H9R B;  3KXB A;  1R4V A;  2YFW A;  3W97 B;  5CPI A;  3LJA B;  5B0Y A;  1KU5 A;  5AV6 C;  3KXB B;  4YS3 A;  4YM6 C;  4QLC A;  1P34 A;  4KGC A;  4HGA B;  3MNN B;  3REI D;  3AZH A;  4WNN B;  3WA9 A;  5B24 B;  2F8N D;  5CP6 D;  3AZE C;  4KGC B;  4KUD B;  3AZL D;  1B6W A;  3W99 D;  4J8W C;  1P3K D;  1M1A A;  3WA9 B;  5B31 D;  5BNX A;  1ZLA C;  4E44 A;  2FJ7 C;  3NQU A;  5B1M B;  3AYW D;  3W96 D;  5BNX B;  4WU8 C;  1P3P B;  1P3M B;  3MGQ B;  2NZD C;  3LZ0 A;  3AV2 B;  4XZQ D; 
#chains in the Genus database with same CATH topology
 2ZY5 A;  3MGP A;  3UTB B;  5AY8 D;  3A6N C;  3EPK A;  3F6T A;  3REH C;  2XD5 A;  2CV5 C;  4J8X B;  4J8U B;  3AFA D;  4J8V B;  3O62 D;  5E5A A;  5B0Z A;  5GSU B;  1PZR A;  3X1U A;  1P3O D;  2PYO A;  3AZK C;  5AV8 D;  3EG5 B;  1F66 B;  5B2J D;  5B40 A;  3X1V D;  3B6F A;  1HQ3 D;  5E5A B;  1Q9C A;  3C1C C;  3X1U B;  5GT0 A;  5GT3 D;  3B6F B;  4R8P C;  4DRB A;  3REJ C;  2Y2G A;  3X1T D;  5DNN A;  5GT0 B;  3VH5 W;  3UT9 B;  1HTA A;  3KWQ A;  2JE5 A;  4H9N A;  4Z5T A;  1KX3 C;  5B33 C;  2L5A A;  4XUJ A;  1M18 D;  5AV6 B;  3KWQ B;  1U35 A;  5AVC A;  4YM6 B;  5CPK D;  5DNM D;  1P3A A;  5AVC B;  5B32 D;  4J8W A;  2VQR A;  3WAA D;  3VH5 T;  1AOI A;  4J8W B;  1N1J A;  3MGR A;  4WU9 D;  3TU4 D;  5CPI C;  2NQB A;  5B0Y C;  1ZLA B;  2FJ7 B;  1N1J B;  4YS3 C;  3REK A;  3B6G A;  3KFU G;  1EQZ D;  3A1I A;  4WU8 B;  2HUE C;  1TAF A;  3W97 D;  2FFF B;  4QLC C;  3LJA D;  1P34 C;  4KGC C;  1P3L A;  3AZH C;  3EPH A;  2YFV B;  3WA9 C;  1F1E A;  5GXQ D;  4DRA A;  3C1B D;  3AZJ A;  1TZY A;  1P3B A;  1M1A C;  3MNN D;  3REH B;  2ARO A;  3AZJ B;  5B24 D;  2CV5 B;  4KUD D;  3V9R B;  3MVD D;  2ARO B;  1ID3 A;  3AZK B;  5F99 A;  5B1M D;  3C1C B;  3WKJ C;  3LZ0 C;  1P3P D;  4R8P B;  1P3M D;  3MGP C;  3MGQ D;  1S32 C;  4H9O A;  1KX3 A;  5G49 A;  3AV2 D;  3W98 A;  5AV9 A;  2Y2K A;  4H9O B;  1KX3 B;  3REL A;  2RVQ D;  5G49 B;  5E5A C;  5B33 B;  5B0Z C;  3UTB D;  2J8P A;  4LD9 A;  3X1U C;  3LEL A;  5CPJ A;  2PYO C;  3W98 B;  4Z66 D;  5AV9 B;  4CSR B;  4J8X D;  5B40 C;  4J8U D;  2Y2P A;  4J8V D;  3REL B;  1P3F A;  3B6F C;  3NQJ B;  3MGS A;  3VH6 W;  1M19 A;  4G91 B;  4LD9 B;  5CPJ B;  5GSU D;  4X23 A;  3AZN D;  4AWL C;  1P3F B;  1F66 D;  4G92 C;  1KX4 A;  3LZ1 D;  5DNN C;  5JRG A;  3X1S A;  3KUY C;  3KWQ C;  5AV5 D;  4Z5T C;  2YFW B;  5CPI B;  4XUJ C;  5B0Y B;  3UT9 D;  1P3G A;  1B67 A;  1U35 C;  5AVC C;  4YS3 B;  5AVB A;  5C3I B;  2HUE B;  3H0L C;  4QLC B;  1P34 B;  3AZM A;  1P3A C;  5AV6 D;  4WV4 B;  3AV1 C;  3AZH B;  2Y2H A;  4YM6 D;  5B1L A;  1AOI C;  3AZM B;  2CWE A;  1M1A B;  2ZM5 A;  3AN2 D;  3MGR C;  3B0C W;  4JJN D;  4NE5 A;  3AZE D;  2NQB C;  3B0D C;  3NQU B;  3REK C;  3B6G C;  3WTP E;  3WKJ A;  1ZLA D;  2FJ7 D;  2Y2I A;  1P3L C;  1S32 A;  3WKJ B;  2Y2M A;  3LZ0 B;  3AZI A;  4WU8 D;  3AZJ C;  1TZY C;  3UTA D;  1P3B C;  3MGP B;  1S32 B;  2NZD D;  3AZI B;  3AZF A;  2ARO C;  4XZQ C;  4H9Q A;  4CAY A;  5B2I A;  1P3I A;  5B0Z B;  5BS7 A;  3WTP A;  3A6N D;  3REH D;  1ID3 C;  2PYO B;  2CV5 D;  3R45 A;  5B40 B;  5F99 C;  5JA4 A;  2G5I C;  3R45 B;  3KUY A;  2F8N H;  3AZK D;  2Y2J A;  4AWL B;  4NFT A;  4G92 B;  5DNN B;  3C1C D;  2HIO A;  3KUY B;  3W98 C;  2G5H C;  4H9N B;  5AV9 C;  4Z5T B;  4R8P D;  3REJ D;  3REL C;  4ZUX D;  4XUJ B;  4LD9 C;  4G91 C;  3LEL C;  3H0M C;  5CPJ C;  1U35 B;  3AV1 A;  1P3F C;  5B33 D;  3MGS C;  1M19 C;  1P3A B;  4X23 C;  3REI A;  3AV1 B;  1KX4 C;  5CP6 A;  1AOI B;  1BH8 A;  2F8N A;  5JRG C;  3AZL A;  3X1S C;  3W99 A;  5B31 A;  5CP6 B;  3MGR B;  3A1K A;  5C3I C;  4E45 A;  2NQB B;  3B0D B;  1P3G C;  3KXB D;  3REK B;  3W96 A;  5BT1 C;  5AVB C;  3AYW A;  3B6G B;  1TAF B;  2ZY3 A;  5CPI D;  3AZG C;  4Z2M H;  5B0Y D;  3AZM C;  1P3L B;  4YS3 D;  5B1L C;  1TZY B;  4XZQ A;  4QLC D;  1P34 D;  4KGC D;  1P3B B;  2Y2N A;  5AY8 A;  3AZH D;  3WA9 D;  4XZQ B;  3AFA A;  3O62 A;  1M1A D;  5AY8 B;  1WWS A;  1P3O A;  1ID3 B;  5AV8 A;  2F8N K;  5B2J A;  3X1V A;  1HQ3 A;  5F99 B;  2DF4 C;  4H9S A;  4WZS B;  3AZI C;  5GT3 A;  3X1T A;  3AZF C;  3WKJ D;  2IO5 C;  5GT3 B;  3LZ0 D;  3P5J B;  5CHL B;  5B2I C;  1KX5 C;  1P3I C;  3MGP D;  1S32 D;  1Z2C B;  5BS7 C;  3WTP C;  1M18 A;  3LEL B;  2RVQ C;  4H9P A;  5CPK A;  5DNM A;  3MGS B;  5E5A D;  5B0Z D;  4UUZ A;  1M19 B;  5B32 A;  3X1U D;  4X23 B;  3WAA A;  2PYO D;  2UWX A;  5B40 D;  3B6F D;  1KX4 B;  5JRG B;  3X1S B;  2HIO C;  5BNV A;  5GT0 D;  4ZBJ C;  3VH6 T;  5BO0 A;  5FUG A;  4WU9 A;  3TU4 A;  5DNN D;  5KDM A;  3AZG A;  4H9R A;  1P3G B;  5AV5 C;  3KWQ D;  5BO0 B;  5FUG B;  5AVB B;  1EQZ A;  4Z5T D;  3W97 A;  5KDM B;  3LJA A;  3AZG B;  2LY8 A;  4XUJ D;  2F8N G;  2DQN C;  4KHA A;  3REI C;  5AVC D;  1U35 D;  1EQZ B;  5GXQ A;  4WJ3 C;  3C1B A;  4NE3 A;  5B1L B;  3KSY A;  1A7W A;  5CP6 C;  5B31 G;  3AZL C;  1P3K C;  3W99 C;  1P3A D;  4KHA B;  3MNN A;  4J8W D;  3AV1 D;  5GXQ B;  4WNN A;  5B31 C;  3C1B B;  5B24 A;  4KUD A;  1AOI D;  4M6B A;  3MVD A;  3AN2 C;  3AYW C;  3W96 C;  4JJN C;  3MGR D;  3MVD B;  2BYM A;  2NQB D;  1H3O A;  5B1M A;  3B0C T;  3REK D;  3B6G D;  2BYM B;  4EO5 B;  1H3O B;  1P3P A;  1P3M A;  3MGQ A;  1KX5 A;  1P3L D;  5AY8 C;  3AZF B;  2IO5 B;  3AV2 A;  3UTA C;  3AZJ D;  1TZY D;  4H9Q B;  4CAY B;  3AFA C;  5B2I B;  1KX5 B;  3O62 C;  3VH5 A;  1P3B D;  1P3I B;  2XD1 A;  3UTB A;  3WTP B;  1P3O C;  2ARO D;  5AV8 C;  4Z66 A;  4Z2M G;  5B2J C;  3X1V C;  4J8X A;  4J8U A;  1HQ3 C;  4J8V A;  1BH9 A;  5JA4 B;  4H9S C;  5GSU A;  4Z66 B;  3AZN A;  5GT3 C;  1ID3 D;  1F66 A;  1BH9 B;  3X1T C;  5F99 D;  3LZ1 A;  3AZN B;  2HIO B;  4ZBJ B;  5AV5 A;  3LZ1 B;  1WWI A;  1KX3 D;  3IP4 C;  3UT9 A;  2W8S A;  1M18 C;  5AV5 B;  3W98 D;  5B32 G;  5AV9 D;  4ZUX C;  5CPK C;  5DNM C;  3REL D;  4DQY B;  5AV6 A;  4LD9 D;  5B32 C;  5CPJ D;  3WAA C;  3LEL D;  1P3K A;  3REI B;  4YM6 A;  1P3F D;  2F8N B;  1BH8 B;  3MGS D;  3AZL B;  1M19 D;  1P3K B;  3W99 B;  1JFI A;  4X23 D;  3AN2 A;  5B31 B;  4JJN A;  4WU9 C;  3TU4 C;  1KX4 D;  3AZE A;  2RIQ A;  5JRG D;  3X1S D;  1JFI B;  3AN2 B;  3AYW B;  3W96 B;  4JJN B;  1EQZ C;  3AZE B;  3W97 C;  3LJA C;  3AL0 C;  1ZLA A;  3KXB C;  2FJ7 A;  1P3G D;  5BT1 D;  5AVB D;  1BFM A;  5GXQ C;  4WU8 A;  3C1B C;  3EPL A;  3UTA A;  4HGA C;  3AZG D;  3AZM D;  2NZD A;  4NE6 A;  3MNN C;  2YFV A;  5B24 C;  3UTA B;  5B1L D;  3EPJ A;  4KUD C;  3AFA B;  3MVD C;  2NZD B;  2JCH A;  3O62 B;  2JSS A;  3A6N A;  3REH A;  1P3O B;  2CV5 A;  5AV8 B;  5B2J B;  3V9R A;  4EO5 C;  3X1V B;  1HQ3 B;  5B1M C;  2ZY2 A;  3A6N B;  3AZK A;  1P3P C;  1P3M C;  3VH6 A;  3MGQ C;  3X1T B;  2BYK A;  3C1C A;  3AZI D;  3AV2 C;  4R8P A;  1ULY A;  2BYK B;  3REJ A;  4ZUX A;  3UTB C;  1T3U A;  3AZF D;  1M18 B;  4Z66 C;  4J8X C;  4J8U C;  3REJ B;  4J8V C;  5B2I D;  1KX5 D;  4H9P B;  4ZUX B;  5B33 A;  5DNM B;  5CPK B;  1P3I D;  4UUZ B;  5GSU C;  3WTP D;  3AZN C;  5B32 B;  3WAA B;  2Y2Q A;  1F66 C;  4CSR A;  3LZ1 C;  3NQJ A;  5BNV B;  3KUY D;  2BG1 A;  4WU9 B;  3TU4 B;  4UPK A;  5GT0 C;  3UT9 C;  3B0B A;  2HIO D;  4H9R B;  3KXB A;  1R4V A;  2F2A C;  2YFW A;  3W97 B;  5CPI A;  3LJA B;  5B0Y A;  1KU5 A;  2Y2L A;  5AV6 C;  3KXB B;  4YS3 A;  4YM6 C;  4QLC A;  1P34 A;  4KGC A;  4HGA B;  1W2E A;  3MNN B;  3REI D;  3AZH A;  4WNN B;  3WA9 A;  5B24 B;  2F8N D;  5CP6 D;  3AZE C;  4KGC B;  4KUD B;  2ZY4 A;  3AZL D;  1B6W A;  3W99 D;  4J8W C;  1P3K D;  1M1A A;  3WA9 B;  5B31 D;  3FDD A;  5BNX A;  1ZLA C;  4E44 A;  2FJ7 C;  3NQU A;  5B1M B;  3AYW D;  3W96 D;  5BNX B;  4WU8 C;  3H0R C;  1P3P B;  2Y2O A;  1P3M B;  3MGQ B;  2NZD C;  3LZ0 A;  3AV2 B;  4XZQ D; 
#chains in the Genus database with same CATH homology
 2ZY5 A;  3MGP A;  3UTB B;  5AY8 D;  3A6N C;  3EPK A;  3F6T A;  3REH C;  2XD5 A;  2CV5 C;  4J8X B;  4J8U B;  3AFA D;  4J8V B;  3O62 D;  5E5A A;  5B0Z A;  5GSU B;  1PZR A;  3X1U A;  1P3O D;  2PYO A;  3AZK C;  5AV8 D;  3EG5 B;  1F66 B;  5B2J D;  5B40 A;  3X1V D;  3B6F A;  1HQ3 D;  5E5A B;  1Q9C A;  3C1C C;  3X1U B;  5GT0 A;  5GT3 D;  3B6F B;  4R8P C;  4DRB A;  3REJ C;  2Y2G A;  3X1T D;  5DNN A;  5GT0 B;  3VH5 W;  3UT9 B;  1HTA A;  3KWQ A;  2JE5 A;  4H9N A;  4Z5T A;  1KX3 C;  5B33 C;  2L5A A;  4XUJ A;  1M18 D;  5AV6 B;  3KWQ B;  1U35 A;  5AVC A;  4YM6 B;  5CPK D;  5DNM D;  1P3A A;  5AVC B;  5B32 D;  4J8W A;  2VQR A;  3WAA D;  3VH5 T;  1AOI A;  4J8W B;  1N1J A;  3MGR A;  4WU9 D;  3TU4 D;  5CPI C;  2NQB A;  5B0Y C;  1ZLA B;  2FJ7 B;  1N1J B;  4YS3 C;  3REK A;  3B6G A;  3KFU G;  1EQZ D;  3A1I A;  4WU8 B;  2HUE C;  1TAF A;  3W97 D;  2FFF B;  4QLC C;  3LJA D;  1P34 C;  4KGC C;  1P3L A;  3AZH C;  3EPH A;  2YFV B;  3WA9 C;  1F1E A;  5GXQ D;  4DRA A;  3C1B D;  3AZJ A;  1TZY A;  1P3B A;  1M1A C;  3MNN D;  3REH B;  2ARO A;  3AZJ B;  5B24 D;  2CV5 B;  4KUD D;  3V9R B;  3MVD D;  2ARO B;  1ID3 A;  3AZK B;  5F99 A;  5B1M D;  3C1C B;  3WKJ C;  3LZ0 C;  1P3P D;  4R8P B;  1P3M D;  3MGP C;  3MGQ D;  1S32 C;  4H9O A;  1KX3 A;  5G49 A;  3AV2 D;  3W98 A;  5AV9 A;  2Y2K A;  4H9O B;  1KX3 B;  3REL A;  2RVQ D;  5G49 B;  5E5A C;  5B33 B;  5B0Z C;  3UTB D;  2J8P A;  4LD9 A;  3X1U C;  3LEL A;  5CPJ A;  2PYO C;  3W98 B;  4Z66 D;  5AV9 B;  4CSR B;  4J8X D;  5B40 C;  4J8U D;  2Y2P A;  4J8V D;  3REL B;  1P3F A;  3B6F C;  3NQJ B;  3MGS A;  3VH6 W;  1M19 A;  4G91 B;  4LD9 B;  5CPJ B;  5GSU D;  4X23 A;  3AZN D;  4AWL C;  1P3F B;  1F66 D;  4G92 C;  1KX4 A;  3LZ1 D;  5DNN C;  5JRG A;  3X1S A;  3KUY C;  3KWQ C;  5AV5 D;  4Z5T C;  2YFW B;  5CPI B;  4XUJ C;  5B0Y B;  3UT9 D;  1P3G A;  1B67 A;  1U35 C;  5AVC C;  4YS3 B;  5AVB A;  5C3I B;  2HUE B;  3H0L C;  4QLC B;  1P34 B;  3AZM A;  1P3A C;  5AV6 D;  4WV4 B;  3AV1 C;  3AZH B;  2Y2H A;  4YM6 D;  5B1L A;  1AOI C;  3AZM B;  2CWE A;  1M1A B;  2ZM5 A;  3AN2 D;  3MGR C;  3B0C W;  4JJN D;  4NE5 A;  3AZE D;  2NQB C;  3B0D C;  3NQU B;  3REK C;  3B6G C;  3WTP E;  3WKJ A;  1ZLA D;  2FJ7 D;  2Y2I A;  1P3L C;  1S32 A;  3WKJ B;  2Y2M A;  3LZ0 B;  3AZI A;  4WU8 D;  3AZJ C;  1TZY C;  3UTA D;  1P3B C;  3MGP B;  1S32 B;  2NZD D;  3AZI B;  3AZF A;  2ARO C;  4XZQ C;  4H9Q A;  4CAY A;  5B2I A;  1P3I A;  5B0Z B;  5BS7 A;  3WTP A;  3A6N D;  3REH D;  1ID3 C;  2PYO B;  2CV5 D;  3R45 A;  5B40 B;  5F99 C;  5JA4 A;  2G5I C;  3R45 B;  3KUY A;  2F8N H;  3AZK D;  2Y2J A;  4AWL B;  4NFT A;  4G92 B;  5DNN B;  3C1C D;  2HIO A;  3KUY B;  3W98 C;  2G5H C;  4H9N B;  5AV9 C;  4Z5T B;  4R8P D;  3REJ D;  3REL C;  4ZUX D;  4XUJ B;  4LD9 C;  4G91 C;  3LEL C;  3H0M C;  5CPJ C;  1U35 B;  3AV1 A;  1P3F C;  5B33 D;  3MGS C;  1M19 C;  1P3A B;  4X23 C;  3REI A;  3AV1 B;  1KX4 C;  5CP6 A;  1AOI B;  1BH8 A;  2F8N A;  5JRG C;  3AZL A;  3X1S C;  3W99 A;  5B31 A;  5CP6 B;  3MGR B;  3A1K A;  5C3I C;  4E45 A;  2NQB B;  3B0D B;  1P3G C;  3KXB D;  3REK B;  3W96 A;  5BT1 C;  5AVB C;  3AYW A;  3B6G B;  1TAF B;  2ZY3 A;  5CPI D;  3AZG C;  4Z2M H;  5B0Y D;  3AZM C;  1P3L B;  4YS3 D;  5B1L C;  1TZY B;  4XZQ A;  4QLC D;  1P34 D;  4KGC D;  1P3B B;  2Y2N A;  5AY8 A;  3AZH D;  3WA9 D;  4XZQ B;  3AFA A;  3O62 A;  1M1A D;  5AY8 B;  1WWS A;  1P3O A;  1ID3 B;  5AV8 A;  2F8N K;  5B2J A;  3X1V A;  1HQ3 A;  5F99 B;  2DF4 C;  4H9S A;  4WZS B;  3AZI C;  5GT3 A;  3X1T A;  3AZF C;  3WKJ D;  2IO5 C;  5GT3 B;  3LZ0 D;  3P5J B;  5CHL B;  5B2I C;  1KX5 C;  1P3I C;  3MGP D;  1S32 D;  1Z2C B;  5BS7 C;  3WTP C;  1M18 A;  3LEL B;  2RVQ C;  4H9P A;  5CPK A;  5DNM A;  3MGS B;  5E5A D;  5B0Z D;  4UUZ A;  1M19 B;  5B32 A;  3X1U D;  4X23 B;  3WAA A;  2PYO D;  2UWX A;  5B40 D;  3B6F D;  1KX4 B;  5JRG B;  3X1S B;  2HIO C;  5BNV A;  5GT0 D;  4ZBJ C;  3VH6 T;  5BO0 A;  5FUG A;  4WU9 A;  3TU4 A;  5DNN D;  5KDM A;  3AZG A;  4H9R A;  1P3G B;  5AV5 C;  3KWQ D;  5BO0 B;  5FUG B;  5AVB B;  1EQZ A;  4Z5T D;  3W97 A;  5KDM B;  3LJA A;  3AZG B;  2LY8 A;  4XUJ D;  2F8N G;  2DQN C;  4KHA A;  3REI C;  5AVC D;  1U35 D;  1EQZ B;  5GXQ A;  4WJ3 C;  3C1B A;  4NE3 A;  5B1L B;  3KSY A;  1A7W A;  5CP6 C;  5B31 G;  3AZL C;  1P3K C;  3W99 C;  1P3A D;  4KHA B;  3MNN A;  4J8W D;  3AV1 D;  5GXQ B;  4WNN A;  5B31 C;  3C1B B;  5B24 A;  4KUD A;  1AOI D;  4M6B A;  3MVD A;  3AN2 C;  3AYW C;  3W96 C;  4JJN C;  3MGR D;  3MVD B;  2BYM A;  2NQB D;  1H3O A;  5B1M A;  3B0C T;  3REK D;  3B6G D;  2BYM B;  4EO5 B;  1H3O B;  1P3P A;  1P3M A;  3MGQ A;  1KX5 A;  1P3L D;  5AY8 C;  3AZF B;  2IO5 B;  3AV2 A;  3UTA C;  3AZJ D;  1TZY D;  4H9Q B;  4CAY B;  3AFA C;  5B2I B;  1KX5 B;  3O62 C;  3VH5 A;  1P3B D;  1P3I B;  2XD1 A;  3UTB A;  3WTP B;  1P3O C;  2ARO D;  5AV8 C;  4Z66 A;  4Z2M G;  5B2J C;  3X1V C;  4J8X A;  4J8U A;  1HQ3 C;  4J8V A;  1BH9 A;  5JA4 B;  4H9S C;  5GSU A;  4Z66 B;  3AZN A;  5GT3 C;  1ID3 D;  1F66 A;  1BH9 B;  3X1T C;  5F99 D;  3LZ1 A;  3AZN B;  2HIO B;  4ZBJ B;  5AV5 A;  3LZ1 B;  1WWI A;  1KX3 D;  3IP4 C;  3UT9 A;  2W8S A;  1M18 C;  5AV5 B;  3W98 D;  5B32 G;  5AV9 D;  4ZUX C;  5CPK C;  5DNM C;  3REL D;  4DQY B;  5AV6 A;  4LD9 D;  5B32 C;  5CPJ D;  3WAA C;  3LEL D;  1P3K A;  3REI B;  4YM6 A;  1P3F D;  2F8N B;  1BH8 B;  3MGS D;  3AZL B;  1M19 D;  1P3K B;  3W99 B;  1JFI A;  4X23 D;  3AN2 A;  5B31 B;  4JJN A;  4WU9 C;  3TU4 C;  1KX4 D;  3AZE A;  2RIQ A;  5JRG D;  3X1S D;  1JFI B;  3AN2 B;  3AYW B;  3W96 B;  4JJN B;  1EQZ C;  3AZE B;  3W97 C;  3LJA C;  3AL0 C;  1ZLA A;  3KXB C;  2FJ7 A;  1P3G D;  5BT1 D;  5AVB D;  1BFM A;  5GXQ C;  4WU8 A;  3C1B C;  3EPL A;  3UTA A;  4HGA C;  3AZG D;  3AZM D;  2NZD A;  4NE6 A;  3MNN C;  2YFV A;  5B24 C;  3UTA B;  5B1L D;  3EPJ A;  4KUD C;  3AFA B;  3MVD C;  2NZD B;  2JCH A;  3O62 B;  2JSS A;  3A6N A;  3REH A;  1P3O B;  2CV5 A;  5AV8 B;  5B2J B;  3V9R A;  4EO5 C;  3X1V B;  1HQ3 B;  5B1M C;  2ZY2 A;  3A6N B;  3AZK A;  1P3P C;  1P3M C;  3VH6 A;  3MGQ C;  3X1T B;  2BYK A;  3C1C A;  3AZI D;  3AV2 C;  4R8P A;  1ULY A;  2BYK B;  3REJ A;  4ZUX A;  3UTB C;  1T3U A;  3AZF D;  1M18 B;  4Z66 C;  4J8X C;  4J8U C;  3REJ B;  4J8V C;  5B2I D;  1KX5 D;  4H9P B;  4ZUX B;  5B33 A;  5DNM B;  5CPK B;  1P3I D;  4UUZ B;  5GSU C;  3WTP D;  3AZN C;  5B32 B;  3WAA B;  2Y2Q A;  1F66 C;  4CSR A;  3LZ1 C;  3NQJ A;  5BNV B;  3KUY D;  2BG1 A;  4WU9 B;  3TU4 B;  4UPK A;  5GT0 C;  3UT9 C;  3B0B A;  2HIO D;  4H9R B;  3KXB A;  1R4V A;  2F2A C;  2YFW A;  3W97 B;  5CPI A;  3LJA B;  5B0Y A;  1KU5 A;  2Y2L A;  5AV6 C;  3KXB B;  4YS3 A;  4YM6 C;  4QLC A;  1P34 A;  4KGC A;  4HGA B;  1W2E A;  3MNN B;  3REI D;  3AZH A;  4WNN B;  3WA9 A;  5B24 B;  2F8N D;  5CP6 D;  3AZE C;  4KGC B;  4KUD B;  2ZY4 A;  3AZL D;  1B6W A;  3W99 D;  4J8W C;  1P3K D;  1M1A A;  3WA9 B;  5B31 D;  3FDD A;  5BNX A;  1ZLA C;  4E44 A;  2FJ7 C;  3NQU A;  5B1M B;  3AYW D;  3W96 D;  5BNX B;  4WU8 C;  3H0R C;  1P3P B;  2Y2O A;  1P3M B;  3MGQ B;  2NZD C;  3LZ0 A;  3AV2 B;  4XZQ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...