2BYKB

Histone fold heterodimer of the chromatin accessibility complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
89
structure length
89
Chain Sequence
PNAVIGRLIKEALPESASVSKEARAAIARAASVFAIFVTSSSTALAHKQNHKTITAKDILQTLTELDFESFVPSLTQDLEVYRKVVKEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords CHRAC-16
publication title The Histone Fold Subunits of Drosophila Chrac Facilitate Nucleosome Sliding Through Dynamic DNA Interactions.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 29
structure length 89
sequence length 89
chains with identical sequence D
ec nomenclature
pdb deposition date 2005-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00808 CBFD_NFYB_HMF Histone-like transcription factor (CBF/NF-Y) and archaeal histone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2bykB00
3AV2A 3B0DC 4CAYA 5G49B 5DNNC 2AROC 3AZLD 2PYOC 3A6NB 1WWIA 3MNNC 3W96D 5AVBD 3MGPC 4QLCD 5AV5A 5B33C 4Z5TB 5CP6D 5CPJB 3AZLB 1P3GC 1P3LC 5AVBB 3W96B 2CV5C 4WU8B 4YM6D 3AZHD 5CP6B 5B24D 5JRGA 4G92B 3AZIC 5B31G 3B6GA 3NQJA 3AZEA 2NQBD 3WKJD 4YM6B 5B1MA 5F99A 3AZHB 3WA9D 5B24B 2IO5C 1BH9B 5AV8D 3AZMA 4LD9D 2NQBB 3KXBD 3WA9B 5B2IA 2BYKA 3MVDA 3X1UD 1P3OC 5AV8B 5CPIC 2YFVA 3KXBB 5DNMD 5AVCC 3O62A 3KWQC 3AZGA 5B2JD 5B40D 4JJNA 4H9QB 4Z2MH 3AV1C 4J8UD 1EQZA 5B40B 4ZUXD 1P3PC 3AYWA 5CPKB 1KX3C 4Z5TC 3VH6T 4WNNB 5CPJC 4J8UB 1P3BA 4ZUXB 3LZ0B 4UUZA 5BS7A 5BT1D 5B31D 4J8XB 5CHLB 1P34A 1M19A 5AV6A 3LZ1A 1U35C 3X1SA 3WAAA 3MGQC 1KU5A 5B31B 3AN2C 1M18C 1P3IA 1P3AD 4KGCC 3REKC 3W97D 1A7WA 1P3MC 5GSUD 4HGAB 4WU9D 3AZJD 3B6FD 2BYMB 5B1LB 3A6NA 5GSUB 5DNND 3KUYC 2AROD 2FJ7B 2NZDC 4WU9B 1TAFB 3AZKD 3AZJB 3MNND 1F1EA 3B6FB 3O62D 3MGPD 3AZLA 5B33D 3B0DB 5DNNB 3W96A 2AROB 5AVBA 2PYOB 4QLCA 1P3GD 3MNNB 1P3LD 5CP6A 3MGPB 2CV5D 5B33B 1N1JA 3AZID 4YM6A 1P3GB 3RELC 1P3LB 3AZHA 2CV5B 3REJC 5B24A 1P3KC 3AZIB 2NQBA 3WKJA 3WA9A 3C1CC 5B0YD 5BNVA 5AV8A 1B6WA 4LD9A 2IO5B 3KXBA 1P3OD 5CPID 3X1UA 3UT9C 1KX5C 5AVCD 1HQ3C 1P3OB 5CPIB 3KWQD 4XUJC 2RVQC 5DNMA 3AV1D 5B2JA 5B40A 5AVCB 2FJ7C 3KWQB 5CPKA 5FUGB 3VH5T 4WNNA 3AV1B 4J8UA 1P3PD 4R8PC 1KX3D 4Z5TD 1HTAA 2YFWB 5CPJD 4ZUXA 4X23C 4Z2MG 3AZFC 5BNXA 4WU8D 3REHC 1P3PB 1S32C 4J8XA 1KX3B 1F66C 4XZQC 5F99C 5B32C 1KX4C 5B31A 1ZLAC 3REIC 3MGQD 5GXQC 3AN2D 5B2IC 1M18D 5C3IC 1H3OB 1U35B 4KGCD 3REKD 4H9NB 4H9RB 4E45A 1B67A 3MGQB 3TU4C 1P3AA 1P3FC 1P3MD 3AN2B 4NE3A 3W97A 1M18B 5B1LA 2HIOC 4KGCB 5GSUA 3REKB 4H9OA 4WU9A 1P3MB 3X1VC 3AZJA 3KUYD 3NQUA 3B6FA 2NZDD 4ZBJC 5DNNA 1ID3C 2AROA 3LJAB 2F8NK 1BH8B 4M6BA 3AZKA 3MNNA 3KUYB 5JA4B 3MGPA 2NZDB 1M1AC 1R4VA 5B33A 5CPKD 1P3GA 4CSRB 1P3LA 2CV5A 4KHAB 4NE5A 5B32G 3RELD 3LZ0D 4NFTA 3VH6A 3WTPC 3AZIA 1P3KD 4H9SC 3UTAC 5E5AC 4J8XD 5AV9C 3AZNC 3RELB 1JFIA 3C1CD 3REJB 4Z66C 3X1TC 1P3KB 5GT3C 3MGRB 5B0YA 3WTPE 3C1BC 3C1CB 3UT9D 1P3OA 3UTBB 1AOIB 5CPIA 1KX5D 2HUEC 1HQ3D 5B0ZC 4XUJD 2RVQD 5AVCA 3UT9B 5B1LD 4WZSB 3KWQA 1KX5B 5FUGA 1HQ3B 2FJ7D 3AV1A 4XUJB 5G49A 3LJAC 4R8PD 4J8VC 4X23D 5AY8C 2PYOD 1P3PA 3AZFD 1KX3A 4Z5TA 3W99C 2CWEA 5CPJA 3REHD 4R8PB 1S32D 4J8WC 1F66D 5KDMB 4XZQD 4WU8A 4X23B 5B32D 3AZFB 4KUDC 3WKJC 3AFAC 3REHB 1KX4D 1S32B 1ZLAD 4YS3C 1F66B 3REID 4XZQB 4H9PB 5GXQD 1H3OA 5F99B 5B32B 2F8NG 3MGSC 1ULYA 4H9NA 3MGQA 1KX4B 1ZLAB 3AN2A 1M18A 3REIB 1BH9A 1P3FD 3TU4D 3MGRC 3X1UC 5GXQB 5B2IB 3REKA 4KGCA 5C3IB 2HIOD 5GT0C 3LELC 1P3MA 3UTBC 1P3FB 3TU4B 1AOIC 3X1VD 1TZYC 5B2JC 2HIOB 3KUYA 1ID3D 5JA4A 2NZDA 3X1VB 3W98C 4H9QA 3B0CW 3AV2C 1M1AD 4ZBJB 4CSRA 1ID3B 4KHAA 5AV5C 1M1AB 3VH5A 3WTPD 4NE6A 3RELA 1Q9CA 3LZ0A 3UTAD 5E5AD 5AV9D 1P3KA 5JRGC 1M19B 4WV4B 2F8NH 3B6GC 3WTPB 4Z66D 5BO0B 3X1TD 3LZ1B 3AZEC 3X1SB 5GT3D 3UTAB 3KSYA 5B1MC 5E5AB 3C1CA 2F8ND 5AV9B 3AZNB 1P3AC 1P3IB 1U35D 4Z66B 3X1TB 3AZMC 4DRAA 5GT3B 2F8NB 3UT9A 5B0ZD 3MVDC 3C1BB 1KX5A 1HQ3A 4XUJA 2HUEB 2BYMA 3AZKC 4G91C 5B0ZB 2LY8A 3O62C 3AZGC 2FJ7A 3LJAD 4JJNC 1TAFA 4J8VD 4AWLC 5AY8D 4R8PA 1WWSA 1EQZC 3W99D 4QLCB 5KDMA 4X23A 2PYOA 3AZFA 4J8WD 4J8VB 3R45B 3AYWC 5AY8B 3REHA 1S32A 1N1JB 4KUDD 1P3BC 3W99B 1F66A 3AFAD 4XZQA 4H9PA 5B32A 4YS3D 4J8WB 5BS7C 4EO5C 1KX4A 1ZLAA 3MGSD 4KUDB 5B0YC 1P34C 3REIA 1M19C 3VH6W 3V9RB 3AFAB 3REJD 5GXQA 3WKJB 5AV6C 3LZ1C 4YS3B 3WAAC 2L5AA 3X1SC 5BNVB 3MGRD 3MGSB 4LD9B 5GT0D 1P3FA 3TU4A 3LELD 1P3IC 3UTBD 1AOID 2HIOA 3X1UB 1TZYD 5GT0B 3LELB 3X1VA 1BFMA 5DNMB 1TZYB 3W98D 3A6NC 3AV2D 5B2JB 1ID3A 1M1AA 3AZLC 3W98B 5AV5D 3AV2B 4CAYB 3W96C 5AVBC 4WU8C 2YFWA 4QLCC 5BNXB 5CP6C 5AV5B 4G92C 3WTPA 5BO0A 4H9SA 5JRGD 4YM6C 3B6GD 3UTAA 5E5AA 3AZHC 5AV9A 3AZNA 3AZED 5B24C 5B1MD 5F99D 4Z66A 3X1TA 5JRGB 2NQBC 5GT3A 3B6GB 2F8NA 3WA9C 3NQJB 3AZEB 3AZMD 5B1MB 3C1BA 1U35A 5B2ID 5AV8C 1P3AB 4LD9C 4H9RA 3KXBC 3MVDD 3W97B 2JSSA 3AZMB 5B0ZA 4H9OB 2BYKB 3MVDB 3NQUB 3AZGD 2YFVB 4JJND 5DNMC 3AZKB 4G91B 3LJAA 5B40C 1BH8A 3O62B 1EQZD 4J8VA 3R45A 3AZGB 5CPKC 5AY8A 4JJNB 4J8UC 3AYWD 3W99A 4AWLB 4E44A 4ZUXC 3LZ0C 1P3BD 1EQZB 4J8WA 4KUDA 3AYWB 4J8XC 3AFAA 3V9RA 3VH5W 1P3BB 4YS3A 1P34D 1M19D 1JFIB 5BT1C 5AV6D 4UUZB 3LZ1D 3MGSA 3X1SD 5B31C 3WAAD 3REJA 4EO5B 3AZND 3B0BA 5B0YB 1P34B 3MGRA 1P3ID 5AV6B 4DRBA 3WAAB 4HGAC 5GT0A 3LELA 3B0CT 3C1BD 3UTBA 1AOIA 3W97C 5B1LC 1TZYA 5GSUC 4WU9C 3A6ND 3AZJC 3B6FC 3W98A
chains in the Genus database with same CATH superfamily
3AV2A 3B0DC 4CAYA 5G49B 5DNNC 2AROC 3AZLD 2PYOC 3A6NB 1WWIA 3MNNC 3W96D 5AVBD 3MGPC 3EPHA 4QLCD 5AV5A 5B33C 4Z5TB 5CP6D 5CPJB 3AZLB 1P3GC 1P3LC 5AVBB 3W96B 2CV5C 4WU8B 4YM6D 4DQYB 3AZHD 5CP6B 5B24D 5JRGA 4G92B 3AZIC 5B31G 3B6GA 3NQJA 3AZEA 2NQBD 3WKJD 4YM6B 5B1MA 3F6TA 5F99A 3AZHB 3WA9D 5B24B 2IO5C 2RIQA 1BH9B 5AV8D 3AZMA 4LD9D 2NQBB 3KXBD 3WA9B 5B2IA 2BYKA 3MVDA 3X1UD 1P3OC 5AV8B 5CPIC 2YFVA 3KXBB 5DNMD 5AVCC 3O62A 3KWQC 3AZGA 5B2JD 5B40D 3KFUG 4JJNA 4H9QB 4Z2MH 3AV1C 3H0RC 4J8UD 1EQZA 5B40B 4ZUXD 1P3PC 3AYWA 5CPKB 1KX3C 4Z5TC 3VH6T 4WNNB 5CPJC 4J8UB 1P3BA 4ZUXB 3LZ0B 4UUZA 3EPLA 5BS7A 5BT1D 5B31D 4J8XB 5CHLB 1P34A 1M19A 5AV6A 3LZ1A 1U35C 3X1SA 3WAAA 2W8SA 3MGQC 1KU5A 5B31B 3AN2C 1M18C 1P3IA 1P3AD 3EPJA 4KGCC 3REKC 3W97D 1A7WA 2BG1A 5GSUD 1P3MC 4HGAB 4WU9D 3AZJD 3B6FD 2BYMB 5B1LB 3A6NA 5GSUB 5DNND 3KUYC 2AROD 2FJ7B 2NZDC 4WU9B 1TAFB 3AZKD 3AZJB 3MNND 1F1EA 3B6FB 3O62D 3MGPD 3AZLA 5B33D 3B0DB 5DNNB 2JCHA 3W96A 2AROB 5AVBA 2PYOB 4QLCA 1P3GD 3MNNB 1P3LD 5CP6A 3MGPB 2CV5D 5B33B 1N1JA 3AZID 4YM6A 1P3GB 3RELC 1P3LB 3AZHA 2Y2OA 2CV5B 3REJC 5B24A 1P3KC 3AZIB 2NQBA 3WKJA 3WA9A 3C1CC 3A1IA 5B0YD 5BNVA 5AV8A 1B6WA 4LD9A 2IO5B 3KXBA 1P3OD 5CPID 3X1UA 3UT9C 1KX5C 2JE5A 5AVCD 1HQ3C 1P3OB 3EPKA 5CPIB 3KWQD 4XUJC 2RVQC 5DNMA 3AV1D 5B2JA 5B40A 5AVCB 2FJ7C 3KWQB 5CPKA 5FUGB 3VH5T 4WNNA 3AV1B 4J8UA 1P3PD 4R8PC 1KX3D 4Z5TD 1HTAA 1PZRA 2YFWB 5CPJD 4ZUXA 4X23C 4Z2MG 3AZFC 5BNXA 4WU8D 3REHC 2XD1A 1S32C 1P3PB 4J8XA 2DQNC 1KX3B 1F66C 4XZQC 5F99C 5B32C 1KX4C 5B31A 1ZLAC 3P5JB 3REIC 3MGQD 5GXQC 3AN2D 5B2IC 1M18D 5C3IC 1H3OB 1U35B 4KGCD 3REKD 4H9NB 4H9RB 4E45A 1B67A 3MGQB 3TU4C 1P3AA 1P3FC 1P3MD 3AN2B 4NE3A 3W97A 1M18B 5B1LA 2HIOC 4KGCB 5GSUA 3REKB 4H9OA 4WU9A 1P3MB 3X1VC 3AZJA 3KUYD 3NQUA 3B6FA 2NZDD 2Y2QA 4ZBJC 5DNNA 2ZY3A 1ID3C 2AROA 3LJAB 2F8NK 1BH8B 4M6BA 3AZKA 3MNNA 3KUYB 5JA4B 3MGPA 2NZDB 2Y2KA 1M1AC 1R4VA 5B33A 5CPKD 1P3GA 4CSRB 1P3LA 2CV5A 4KHAB 4NE5A 5B32G 3RELD 3LZ0D 4NFTA 3FDDA 3VH6A 3WTPC 3AZIA 1P3KD 4H9SC 3UTAC 5E5AC 4J8XD 5AV9C 3AZNC 3RELB 1JFIA 3C1CD 3REJB 4Z66C 3X1TC 1P3KB 5GT3C 3MGRB 5B0YA 3WTPE 3C1BC 3C1CB 3UT9D 1P3OA 3UTBB 1AOIB 5CPIA 1KX5D 2HUEC 1HQ3D 5B0ZC 4XUJD 2RVQD 5AVCA 3UT9B 5B1LD 4WZSB 3KWQA 1KX5B 5FUGA 1HQ3B 2FJ7D 3A1KA 3AV1A 4XUJB 5G49A 3LJAC 4R8PD 4J8VC 4X23D 5AY8C 2PYOD 1P3PA 3AZFD 1T3UA 4Z5TA 1KX3A 3W99C 2CWEA 5CPJA 3REHD 4R8PB 1S32D 4J8WC 1F66D 5KDMB 4XZQD 4WU8A 4X23B 5B32D 3AZFB 4KUDC 2Y2MA 3WKJC 3AFAC 3REHB 1KX4D 1S32B 1ZLAD 2Y2JA 4YS3C 1F66B 3REID 4XZQB 4H9PB 5GXQD 1H3OA 5F99B 5B32B 2F8NG 3MGSC 1ULYA 4H9NA 3MGQA 1KX4B 1ZLAB 3AN2A 1M18A 3REIB 1BH9A 1P3FD 3TU4D 3MGRC 3X1UC 5GXQB 5B2IB 3REKA 4KGCA 5C3IB 2HIOD 5GT0C 3LELC 1P3MA 3UTBC 1P3FB 3TU4B 1AOIC 3X1VD 1TZYC 5B2JC 2HIOB 2Y2PA 1W2EA 3KUYA 1ID3D 5JA4A 2NZDA 3X1VB 2XD5A 2ZM5A 3W98C 4H9QA 3B0CW 3AV2C 1M1AD 4ZBJB 4CSRA 1ID3B 2VQRA 4KHAA 5AV5C 1M1AB 2ZY2A 3VH5A 3WTPD 4NE6A 3RELA 1Q9CA 3LZ0A 3UTAD 5E5AD 5AV9D 3H0LC 1P3KA 5JRGC 1M19B 4WV4B 2F8NH 3B6GC 3WTPB 4Z66D 5BO0B 3X1TD 3LZ1B 3AZEC 3X1SB 5GT3D 3UTAB 3KSYA 5B1MC 4UPKA 5E5AB 3C1CA 5AV9B 2F8ND 3AZNB 1P3AC 2DF4C 1P3IB 1U35D 4Z66B 3X1TB 2FFFB 3AZMC 4DRAA 5GT3B 2F8NB 3UT9A 5B0ZD 3MVDC 3C1BB 1KX5A 2F2AC 2Y2IA 1HQ3A 4XUJA 2HUEB 3AL0C 2BYMA 3AZKC 4G91C 5B0ZB 2LY8A 3O62C 3AZGC 2FJ7A 3LJAD 4JJNC 1TAFA 4J8VD 4AWLC 5AY8D 4R8PA 1WWSA 3IP4C 1EQZC 3W99D 2UWXA 4QLCB 5KDMA 4X23A 2PYOA 3AZFA 4J8WD 4J8VB 3R45B 3AYWC 5AY8B 3REHA 1S32A 1N1JB 4KUDD 1P3BC 3W99B 1F66A 3AFAD 4XZQA 4H9PA 5B32A 4YS3D 4J8WB 5BS7C 4EO5C 1KX4A 1ZLAA 3MGSD 4KUDB 5B0YC 1P34C 3REIA 1M19C 3VH6W 3V9RB 3AFAB 3REJD 5GXQA 3WKJB 5AV6C 3LZ1C 4YS3B 3WAAC 2L5AA 3X1SC 5BNVB 3MGRD 3MGSB 4LD9B 5GT0D 1P3FA 3TU4A 3LELD 1P3IC 2ZY4A 3UTBD 1AOID 2HIOA 3X1UB 3EG5B 1TZYD 2G5HC 5GT0B 3LELB 3X1VA 1BFMA 5DNMB 1TZYB 3W98D 3A6NC 3AV2D 5B2JB 1ID3A 1M1AA 3AZLC 3W98B 5AV5D 3AV2B 4CAYB 3W96C 5AVBC 4WU8C 2Y2NA 2YFWA 5BNXB 4QLCC 5CP6C 5AV5B 4G92C 3WTPA 5BO0A 4H9SA 5JRGD 4YM6C 3B6GD 3UTAA 5E5AA 3AZHC 5AV9A 3AZNA 3AZED 5B24C 5B1MD 5F99D 1Z2CB 4Z66A 3X1TA 2G5IC 5JRGB 2NQBC 5GT3A 3B6GB 2F8NA 3WA9C 3NQJB 3AZEB 3AZMD 5B1MB 3C1BA 1U35A 5B2ID 5AV8C 1P3AB 4LD9C 4H9RA 3KXBC 3MVDD 3W97B 2JSSA 3AZMB 2J8PA 5B0ZA 4H9OB 2BYKB 3MVDB 3NQUB 3AZGD 2YFVB 4JJND 5DNMC 3H0MC 3AZKB 4G91B 3LJAA 5B40C 1BH8A 3O62B 1EQZD 4J8VA 3R45A 3AZGB 5CPKC 5AY8A 4WJ3C 4JJNB 2Y2LA 4J8UC 3AYWD 3W99A 4AWLB 4E44A 4ZUXC 3LZ0C 2Y2GA 1P3BD 1EQZB 4J8WA 2Y2HA 4KUDA 3AYWB 4J8XC 3AFAA 3V9RA 3VH5W 1P3BB 4YS3A 1P34D 1M19D 1JFIB 5BT1C 5AV6D 4UUZB 3LZ1D 3MGSA 3X1SD 5B31C 3WAAD 3REJA 4EO5B 3AZND 3B0BA 5B0YB 1P34B 2ZY5A 3MGRA 1P3ID 5AV6B 4DRBA 3WAAB 4HGAC 5GT0A 3LELA 3B0CT 3C1BD 3UTBA 1AOIA 3W97C 5B1LC 1TZYA 5GSUC 4WU9C 3A6ND 3AZJC 3B6FC 3W98A
chains in the Genus database with same CATH topology
3AV2A 3B0DC 4CAYA 5G49B 5DNNC 2AROC 3AZLD 2PYOC 3A6NB 1WWIA 3MNNC 3W96D 5AVBD 3MGPC 3EPHA 4QLCD 5AV5A 5B33C 4Z5TB 5CP6D 5CPJB 3AZLB 1P3GC 1P3LC 5AVBB 3W96B 2CV5C 4WU8B 4YM6D 4DQYB 3AZHD 5CP6B 5B24D 5JRGA 4G92B 3AZIC 5B31G 3B6GA 3NQJA 3AZEA 2NQBD 3WKJD 4YM6B 5B1MA 3F6TA 5F99A 3AZHB 3WA9D 5B24B 2IO5C 2RIQA 1BH9B 5AV8D 3AZMA 4LD9D 2NQBB 3KXBD 3WA9B 5B2IA 2BYKA 3MVDA 3X1UD 1P3OC 5AV8B 5CPIC 2YFVA 3KXBB 5DNMD 5AVCC 3O62A 3KWQC 3AZGA 5B2JD 5B40D 3KFUG 4JJNA 4H9QB 4Z2MH 3AV1C 3H0RC 4J8UD 1EQZA 5B40B 4ZUXD 1P3PC 3AYWA 5CPKB 1KX3C 4Z5TC 3VH6T 4WNNB 5CPJC 4J8UB 1P3BA 4ZUXB 3LZ0B 4UUZA 3EPLA 5BS7A 5BT1D 5B31D 4J8XB 5CHLB 1P34A 1M19A 5AV6A 3LZ1A 1U35C 3X1SA 3WAAA 2W8SA 3MGQC 1KU5A 5B31B 3AN2C 1M18C 1P3IA 1P3AD 3EPJA 4KGCC 3REKC 3W97D 1A7WA 2BG1A 5GSUD 1P3MC 4HGAB 4WU9D 3AZJD 3B6FD 2BYMB 5B1LB 3A6NA 5GSUB 5DNND 3KUYC 2AROD 2FJ7B 2NZDC 4WU9B 1TAFB 3AZKD 3AZJB 3MNND 1F1EA 3B6FB 3O62D 3MGPD 3AZLA 5B33D 3B0DB 5DNNB 2JCHA 3W96A 2AROB 5AVBA 2PYOB 4QLCA 1P3GD 3MNNB 1P3LD 5CP6A 3MGPB 2CV5D 5B33B 1N1JA 3AZID 4YM6A 1P3GB 3RELC 1P3LB 3AZHA 2Y2OA 2CV5B 3REJC 5B24A 1P3KC 3AZIB 2NQBA 3WKJA 3WA9A 3C1CC 3A1IA 5B0YD 5BNVA 5AV8A 1B6WA 4LD9A 2IO5B 3KXBA 1P3OD 5CPID 3X1UA 3UT9C 1KX5C 2JE5A 5AVCD 1HQ3C 1P3OB 3EPKA 5CPIB 3KWQD 4XUJC 2RVQC 5DNMA 3AV1D 5B2JA 5B40A 5AVCB 2FJ7C 3KWQB 5CPKA 5FUGB 3VH5T 4WNNA 3AV1B 4J8UA 1P3PD 4R8PC 1KX3D 4Z5TD 1HTAA 1PZRA 2YFWB 5CPJD 4ZUXA 4X23C 4Z2MG 3AZFC 5BNXA 4WU8D 3REHC 2XD1A 1S32C 1P3PB 4J8XA 2DQNC 1KX3B 1F66C 4XZQC 5F99C 5B32C 1KX4C 5B31A 1ZLAC 3P5JB 3REIC 3MGQD 5GXQC 3AN2D 5B2IC 1M18D 5C3IC 1H3OB 1U35B 4KGCD 3REKD 4H9NB 4H9RB 4E45A 1B67A 3MGQB 3TU4C 1P3AA 1P3FC 1P3MD 3AN2B 4NE3A 3W97A 1M18B 5B1LA 2HIOC 4KGCB 5GSUA 3REKB 4H9OA 4WU9A 1P3MB 3X1VC 3AZJA 3KUYD 3NQUA 3B6FA 2NZDD 2Y2QA 4ZBJC 5DNNA 2ZY3A 1ID3C 2AROA 3LJAB 2F8NK 1BH8B 4M6BA 3AZKA 3MNNA 3KUYB 5JA4B 3MGPA 2NZDB 2Y2KA 1M1AC 1R4VA 5B33A 5CPKD 1P3GA 4CSRB 1P3LA 2CV5A 4KHAB 4NE5A 5B32G 3RELD 3LZ0D 4NFTA 3FDDA 3VH6A 3WTPC 3AZIA 1P3KD 4H9SC 3UTAC 5E5AC 4J8XD 5AV9C 3AZNC 3RELB 1JFIA 3C1CD 3REJB 4Z66C 3X1TC 1P3KB 5GT3C 3MGRB 5B0YA 3WTPE 3C1BC 3C1CB 3UT9D 1P3OA 3UTBB 1AOIB 5CPIA 1KX5D 2HUEC 1HQ3D 5B0ZC 4XUJD 2RVQD 5AVCA 3UT9B 5B1LD 4WZSB 3KWQA 1KX5B 5FUGA 1HQ3B 2FJ7D 3A1KA 3AV1A 4XUJB 5G49A 3LJAC 4R8PD 4J8VC 4X23D 5AY8C 2PYOD 1P3PA 3AZFD 1T3UA 4Z5TA 1KX3A 3W99C 2CWEA 5CPJA 3REHD 4R8PB 1S32D 4J8WC 1F66D 5KDMB 4XZQD 4WU8A 4X23B 5B32D 3AZFB 4KUDC 2Y2MA 3WKJC 3AFAC 3REHB 1KX4D 1S32B 1ZLAD 2Y2JA 4YS3C 1F66B 3REID 4XZQB 4H9PB 5GXQD 1H3OA 5F99B 5B32B 2F8NG 3MGSC 1ULYA 4H9NA 3MGQA 1KX4B 1ZLAB 3AN2A 1M18A 3REIB 1BH9A 1P3FD 3TU4D 3MGRC 3X1UC 5GXQB 5B2IB 3REKA 4KGCA 5C3IB 2HIOD 5GT0C 3LELC 1P3MA 3UTBC 1P3FB 3TU4B 1AOIC 3X1VD 1TZYC 5B2JC 2HIOB 2Y2PA 1W2EA 3KUYA 1ID3D 5JA4A 2NZDA 3X1VB 2XD5A 2ZM5A 3W98C 4H9QA 3B0CW 3AV2C 1M1AD 4ZBJB 4CSRA 1ID3B 2VQRA 4KHAA 5AV5C 1M1AB 2ZY2A 3VH5A 3WTPD 4NE6A 3RELA 1Q9CA 3LZ0A 3UTAD 5E5AD 5AV9D 3H0LC 1P3KA 5JRGC 1M19B 4WV4B 2F8NH 3B6GC 3WTPB 4Z66D 5BO0B 3X1TD 3LZ1B 3AZEC 3X1SB 5GT3D 3UTAB 3KSYA 5B1MC 4UPKA 5E5AB 3C1CA 5AV9B 2F8ND 3AZNB 1P3AC 2DF4C 1P3IB 1U35D 4Z66B 3X1TB 2FFFB 3AZMC 4DRAA 5GT3B 2F8NB 3UT9A 5B0ZD 3MVDC 3C1BB 1KX5A 2F2AC 2Y2IA 1HQ3A 4XUJA 2HUEB 3AL0C 2BYMA 3AZKC 4G91C 5B0ZB 2LY8A 3O62C 3AZGC 2FJ7A 3LJAD 4JJNC 1TAFA 4J8VD 4AWLC 5AY8D 4R8PA 1WWSA 3IP4C 1EQZC 3W99D 2UWXA 4QLCB 5KDMA 4X23A 2PYOA 3AZFA 4J8WD 4J8VB 3R45B 3AYWC 5AY8B 3REHA 1S32A 1N1JB 4KUDD 1P3BC 3W99B 1F66A 3AFAD 4XZQA 4H9PA 5B32A 4YS3D 4J8WB 5BS7C 4EO5C 1KX4A 1ZLAA 3MGSD 4KUDB 5B0YC 1P34C 3REIA 1M19C 3VH6W 3V9RB 3AFAB 3REJD 5GXQA 3WKJB 5AV6C 3LZ1C 4YS3B 3WAAC 2L5AA 3X1SC 5BNVB 3MGRD 3MGSB 4LD9B 5GT0D 1P3FA 3TU4A 3LELD 1P3IC 2ZY4A 3UTBD 1AOID 2HIOA 3X1UB 3EG5B 1TZYD 2G5HC 5GT0B 3LELB 3X1VA 1BFMA 5DNMB 1TZYB 3W98D 3A6NC 3AV2D 5B2JB 1ID3A 1M1AA 3AZLC 3W98B 5AV5D 3AV2B 4CAYB 3W96C 5AVBC 4WU8C 2Y2NA 2YFWA 5BNXB 4QLCC 5CP6C 5AV5B 4G92C 3WTPA 5BO0A 4H9SA 5JRGD 4YM6C 3B6GD 3UTAA 5E5AA 3AZHC 5AV9A 3AZNA 3AZED 5B24C 5B1MD 5F99D 1Z2CB 4Z66A 3X1TA 2G5IC 5JRGB 2NQBC 5GT3A 3B6GB 2F8NA 3WA9C 3NQJB 3AZEB 3AZMD 5B1MB 3C1BA 1U35A 5B2ID 5AV8C 1P3AB 4LD9C 4H9RA 3KXBC 3MVDD 3W97B 2JSSA 3AZMB 2J8PA 5B0ZA 4H9OB 2BYKB 3MVDB 3NQUB 3AZGD 2YFVB 4JJND 5DNMC 3H0MC 3AZKB 4G91B 3LJAA 5B40C 1BH8A 3O62B 1EQZD 4J8VA 3R45A 3AZGB 5CPKC 5AY8A 4WJ3C 4JJNB 2Y2LA 4J8UC 3AYWD 3W99A 4AWLB 4E44A 4ZUXC 3LZ0C 2Y2GA 1P3BD 1EQZB 4J8WA 2Y2HA 4KUDA 3AYWB 4J8XC 3AFAA 3V9RA 3VH5W 1P3BB 4YS3A 1P34D 1M19D 1JFIB 5BT1C 5AV6D 4UUZB 3LZ1D 3MGSA 3X1SD 5B31C 3WAAD 3REJA 4EO5B 3AZND 3B0BA 5B0YB 1P34B 2ZY5A 3MGRA 1P3ID 5AV6B 4DRBA 3WAAB 4HGAC 5GT0A 3LELA 3B0CT 3C1BD 3UTBA 1AOIA 3W97C 5B1LC 1TZYA 5GSUC 4WU9C 3A6ND 3AZJC 3B6FC 3W98A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AV2 A;  3B0D C;  4CAY A;  5G49 B;  5DNN C;  2ARO C;  3AZL D;  2PYO C;  3A6N B;  1WWI A;  3MNN C;  3W96 D;  5AVB D;  3MGP C;  4QLC D;  5AV5 A;  5B33 C;  4Z5T B;  5CP6 D;  5CPJ B;  3AZL B;  1P3G C;  1P3L C;  5AVB B;  3W96 B;  2CV5 C;  4WU8 B;  4YM6 D;  3AZH D;  5CP6 B;  5B24 D;  5JRG A;  4G92 B;  3AZI C;  5B31 G;  3B6G A;  3NQJ A;  3AZE A;  2NQB D;  3WKJ D;  4YM6 B;  5B1M A;  5F99 A;  3AZH B;  3WA9 D;  5B24 B;  2IO5 C;  1BH9 B;  5AV8 D;  3AZM A;  4LD9 D;  2NQB B;  3KXB D;  3WA9 B;  5B2I A;  2BYK A;  3MVD A;  3X1U D;  1P3O C;  5AV8 B;  5CPI C;  2YFV A;  3KXB B;  5DNM D;  5AVC C;  3O62 A;  3KWQ C;  3AZG A;  5B2J D;  5B40 D;  4JJN A;  4H9Q B;  4Z2M H;  3AV1 C;  4J8U D;  1EQZ A;  5B40 B;  4ZUX D;  1P3P C;  3AYW A;  5CPK B;  1KX3 C;  4Z5T C;  3VH6 T;  4WNN B;  5CPJ C;  4J8U B;  1P3B A;  4ZUX B;  3LZ0 B;  4UUZ A;  5BS7 A;  5BT1 D;  5B31 D;  4J8X B;  5CHL B;  1P34 A;  1M19 A;  5AV6 A;  3LZ1 A;  1U35 C;  3X1S A;  3WAA A;  3MGQ C;  1KU5 A;  5B31 B;  3AN2 C;  1M18 C;  1P3I A;  1P3A D;  4KGC C;  3REK C;  3W97 D;  1A7W A;  1P3M C;  5GSU D;  4HGA B;  4WU9 D;  3AZJ D;  3B6F D;  2BYM B;  5B1L B;  3A6N A;  5GSU B;  5DNN D;  3KUY C;  2ARO D;  2FJ7 B;  2NZD C;  4WU9 B;  1TAF B;  3AZK D;  3AZJ B;  3MNN D;  1F1E A;  3B6F B;  3O62 D;  3MGP D;  3AZL A;  5B33 D;  3B0D B;  5DNN B;  3W96 A;  2ARO B;  5AVB A;  2PYO B;  4QLC A;  1P3G D;  3MNN B;  1P3L D;  5CP6 A;  3MGP B;  2CV5 D;  5B33 B;  1N1J A;  3AZI D;  4YM6 A;  1P3G B;  3REL C;  1P3L B;  3AZH A;  2CV5 B;  3REJ C;  5B24 A;  1P3K C;  3AZI B;  2NQB A;  3WKJ A;  3WA9 A;  3C1C C;  5B0Y D;  5BNV A;  5AV8 A;  1B6W A;  4LD9 A;  2IO5 B;  3KXB A;  1P3O D;  5CPI D;  3X1U A;  3UT9 C;  1KX5 C;  5AVC D;  1HQ3 C;  1P3O B;  5CPI B;  3KWQ D;  4XUJ C;  2RVQ C;  5DNM A;  3AV1 D;  5B2J A;  5B40 A;  5AVC B;  2FJ7 C;  3KWQ B;  5CPK A;  5FUG B;  3VH5 T;  4WNN A;  3AV1 B;  4J8U A;  1P3P D;  4R8P C;  1KX3 D;  4Z5T D;  1HTA A;  2YFW B;  5CPJ D;  4ZUX A;  4X23 C;  4Z2M G;  3AZF C;  5BNX A;  4WU8 D;  3REH C;  1P3P B;  1S32 C;  4J8X A;  1KX3 B;  1F66 C;  4XZQ C;  5F99 C;  5B32 C;  1KX4 C;  5B31 A;  1ZLA C;  3REI C;  3MGQ D;  5GXQ C;  3AN2 D;  5B2I C;  1M18 D;  5C3I C;  1H3O B;  1U35 B;  4KGC D;  3REK D;  4H9N B;  4H9R B;  4E45 A;  1B67 A;  3MGQ B;  3TU4 C;  1P3A A;  1P3F C;  1P3M D;  3AN2 B;  4NE3 A;  3W97 A;  1M18 B;  5B1L A;  2HIO C;  4KGC B;  5GSU A;  3REK B;  4H9O A;  4WU9 A;  1P3M B;  3X1V C;  3AZJ A;  3KUY D;  3NQU A;  3B6F A;  2NZD D;  4ZBJ C;  5DNN A;  1ID3 C;  2ARO A;  3LJA B;  2F8N K;  1BH8 B;  4M6B A;  3AZK A;  3MNN A;  3KUY B;  5JA4 B;  3MGP A;  2NZD B;  1M1A C;  1R4V A;  5B33 A;  5CPK D;  1P3G A;  4CSR B;  1P3L A;  2CV5 A;  4KHA B;  4NE5 A;  5B32 G;  3REL D;  3LZ0 D;  4NFT A;  3VH6 A;  3WTP C;  3AZI A;  1P3K D;  4H9S C;  3UTA C;  5E5A C;  4J8X D;  5AV9 C;  3AZN C;  3REL B;  1JFI A;  3C1C D;  3REJ B;  4Z66 C;  3X1T C;  1P3K B;  5GT3 C;  3MGR B;  5B0Y A;  3WTP E;  3C1B C;  3C1C B;  3UT9 D;  1P3O A;  3UTB B;  1AOI B;  5CPI A;  1KX5 D;  2HUE C;  1HQ3 D;  5B0Z C;  4XUJ D;  2RVQ D;  5AVC A;  3UT9 B;  5B1L D;  4WZS B;  3KWQ A;  1KX5 B;  5FUG A;  1HQ3 B;  2FJ7 D;  3AV1 A;  4XUJ B;  5G49 A;  3LJA C;  4R8P D;  4J8V C;  4X23 D;  5AY8 C;  2PYO D;  1P3P A;  3AZF D;  1KX3 A;  4Z5T A;  3W99 C;  2CWE A;  5CPJ A;  3REH D;  4R8P B;  1S32 D;  4J8W C;  1F66 D;  5KDM B;  4XZQ D;  4WU8 A;  4X23 B;  5B32 D;  3AZF B;  4KUD C;  3WKJ C;  3AFA C;  3REH B;  1KX4 D;  1S32 B;  1ZLA D;  4YS3 C;  1F66 B;  3REI D;  4XZQ B;  4H9P B;  5GXQ D;  1H3O A;  5F99 B;  5B32 B;  2F8N G;  3MGS C;  1ULY A;  4H9N A;  3MGQ A;  1KX4 B;  1ZLA B;  3AN2 A;  1M18 A;  3REI B;  1BH9 A;  1P3F D;  3TU4 D;  3MGR C;  3X1U C;  5GXQ B;  5B2I B;  3REK A;  4KGC A;  5C3I B;  2HIO D;  5GT0 C;  3LEL C;  1P3M A;  3UTB C;  1P3F B;  3TU4 B;  1AOI C;  3X1V D;  1TZY C;  5B2J C;  2HIO B;  3KUY A;  1ID3 D;  5JA4 A;  2NZD A;  3X1V B;  3W98 C;  4H9Q A;  3B0C W;  3AV2 C;  1M1A D;  4ZBJ B;  4CSR A;  1ID3 B;  4KHA A;  5AV5 C;  1M1A B;  3VH5 A;  3WTP D;  4NE6 A;  3REL A;  1Q9C A;  3LZ0 A;  3UTA D;  5E5A D;  5AV9 D;  1P3K A;  5JRG C;  1M19 B;  4WV4 B;  2F8N H;  3B6G C;  3WTP B;  4Z66 D;  5BO0 B;  3X1T D;  3LZ1 B;  3AZE C;  3X1S B;  5GT3 D;  3UTA B;  3KSY A;  5B1M C;  5E5A B;  3C1C A;  2F8N D;  5AV9 B;  3AZN B;  1P3A C;  1P3I B;  1U35 D;  4Z66 B;  3X1T B;  3AZM C;  4DRA A;  5GT3 B;  2F8N B;  3UT9 A;  5B0Z D;  3MVD C;  3C1B B;  1KX5 A;  1HQ3 A;  4XUJ A;  2HUE B;  2BYM A;  3AZK C;  4G91 C;  5B0Z B;  2LY8 A;  3O62 C;  3AZG C;  2FJ7 A;  3LJA D;  4JJN C;  1TAF A;  4J8V D;  4AWL C;  5AY8 D;  4R8P A;  1WWS A;  1EQZ C;  3W99 D;  4QLC B;  5KDM A;  4X23 A;  2PYO A;  3AZF A;  4J8W D;  4J8V B;  3R45 B;  3AYW C;  5AY8 B;  3REH A;  1S32 A;  1N1J B;  4KUD D;  1P3B C;  3W99 B;  1F66 A;  3AFA D;  4XZQ A;  4H9P A;  5B32 A;  4YS3 D;  4J8W B;  5BS7 C;  4EO5 C;  1KX4 A;  1ZLA A;  3MGS D;  4KUD B;  5B0Y C;  1P34 C;  3REI A;  1M19 C;  3VH6 W;  3V9R B;  3AFA B;  3REJ D;  5GXQ A;  3WKJ B;  5AV6 C;  3LZ1 C;  4YS3 B;  3WAA C;  2L5A A;  3X1S C;  5BNV B;  3MGR D;  3MGS B;  4LD9 B;  5GT0 D;  1P3F A;  3TU4 A;  3LEL D;  1P3I C;  3UTB D;  1AOI D;  2HIO A;  3X1U B;  1TZY D;  5GT0 B;  3LEL B;  3X1V A;  1BFM A;  5DNM B;  1TZY B;  3W98 D;  3A6N C;  3AV2 D;  5B2J B;  1ID3 A;  1M1A A;  3AZL C;  3W98 B;  5AV5 D;  3AV2 B;  4CAY B;  3W96 C;  5AVB C;  4WU8 C;  2YFW A;  4QLC C;  5BNX B;  5CP6 C;  5AV5 B;  4G92 C;  3WTP A;  5BO0 A;  4H9S A;  5JRG D;  4YM6 C;  3B6G D;  3UTA A;  5E5A A;  3AZH C;  5AV9 A;  3AZN A;  3AZE D;  5B24 C;  5B1M D;  5F99 D;  4Z66 A;  3X1T A;  5JRG B;  2NQB C;  5GT3 A;  3B6G B;  2F8N A;  3WA9 C;  3NQJ B;  3AZE B;  3AZM D;  5B1M B;  3C1B A;  1U35 A;  5B2I D;  5AV8 C;  1P3A B;  4LD9 C;  4H9R A;  3KXB C;  3MVD D;  3W97 B;  2JSS A;  3AZM B;  5B0Z A;  4H9O B;  2BYK B;  3MVD B;  3NQU B;  3AZG D;  2YFV B;  4JJN D;  5DNM C;  3AZK B;  4G91 B;  3LJA A;  5B40 C;  1BH8 A;  3O62 B;  1EQZ D;  4J8V A;  3R45 A;  3AZG B;  5CPK C;  5AY8 A;  4JJN B;  4J8U C;  3AYW D;  3W99 A;  4AWL B;  4E44 A;  4ZUX C;  3LZ0 C;  1P3B D;  1EQZ B;  4J8W A;  4KUD A;  3AYW B;  4J8X C;  3AFA A;  3V9R A;  3VH5 W;  1P3B B;  4YS3 A;  1P34 D;  1M19 D;  1JFI B;  5BT1 C;  5AV6 D;  4UUZ B;  3LZ1 D;  3MGS A;  3X1S D;  5B31 C;  3WAA D;  3REJ A;  4EO5 B;  3AZN D;  3B0B A;  5B0Y B;  1P34 B;  3MGR A;  1P3I D;  5AV6 B;  4DRB A;  3WAA B;  4HGA C;  5GT0 A;  3LEL A;  3B0C T;  3C1B D;  3UTB A;  1AOI A;  3W97 C;  5B1L C;  1TZY A;  5GSU C;  4WU9 C;  3A6N D;  3AZJ C;  3B6F C;  3W98 A; 
#chains in the Genus database with same CATH topology
 3AV2 A;  3B0D C;  4CAY A;  5G49 B;  5DNN C;  2ARO C;  3AZL D;  2PYO C;  3A6N B;  1WWI A;  3MNN C;  3W96 D;  5AVB D;  3MGP C;  3EPH A;  4QLC D;  5AV5 A;  5B33 C;  4Z5T B;  5CP6 D;  5CPJ B;  3AZL B;  1P3G C;  1P3L C;  5AVB B;  3W96 B;  2CV5 C;  4WU8 B;  4YM6 D;  4DQY B;  3AZH D;  5CP6 B;  5B24 D;  5JRG A;  4G92 B;  3AZI C;  5B31 G;  3B6G A;  3NQJ A;  3AZE A;  2NQB D;  3WKJ D;  4YM6 B;  5B1M A;  3F6T A;  5F99 A;  3AZH B;  3WA9 D;  5B24 B;  2IO5 C;  2RIQ A;  1BH9 B;  5AV8 D;  3AZM A;  4LD9 D;  2NQB B;  3KXB D;  3WA9 B;  5B2I A;  2BYK A;  3MVD A;  3X1U D;  1P3O C;  5AV8 B;  5CPI C;  2YFV A;  3KXB B;  5DNM D;  5AVC C;  3O62 A;  3KWQ C;  3AZG A;  5B2J D;  5B40 D;  3KFU G;  4JJN A;  4H9Q B;  4Z2M H;  3AV1 C;  3H0R C;  4J8U D;  1EQZ A;  5B40 B;  4ZUX D;  1P3P C;  3AYW A;  5CPK B;  1KX3 C;  4Z5T C;  3VH6 T;  4WNN B;  5CPJ C;  4J8U B;  1P3B A;  4ZUX B;  3LZ0 B;  4UUZ A;  3EPL A;  5BS7 A;  5BT1 D;  5B31 D;  4J8X B;  5CHL B;  1P34 A;  1M19 A;  5AV6 A;  3LZ1 A;  1U35 C;  3X1S A;  3WAA A;  2W8S A;  3MGQ C;  1KU5 A;  5B31 B;  3AN2 C;  1M18 C;  1P3I A;  1P3A D;  3EPJ A;  4KGC C;  3REK C;  3W97 D;  1A7W A;  2BG1 A;  5GSU D;  1P3M C;  4HGA B;  4WU9 D;  3AZJ D;  3B6F D;  2BYM B;  5B1L B;  3A6N A;  5GSU B;  5DNN D;  3KUY C;  2ARO D;  2FJ7 B;  2NZD C;  4WU9 B;  1TAF B;  3AZK D;  3AZJ B;  3MNN D;  1F1E A;  3B6F B;  3O62 D;  3MGP D;  3AZL A;  5B33 D;  3B0D B;  5DNN B;  2JCH A;  3W96 A;  2ARO B;  5AVB A;  2PYO B;  4QLC A;  1P3G D;  3MNN B;  1P3L D;  5CP6 A;  3MGP B;  2CV5 D;  5B33 B;  1N1J A;  3AZI D;  4YM6 A;  1P3G B;  3REL C;  1P3L B;  3AZH A;  2Y2O A;  2CV5 B;  3REJ C;  5B24 A;  1P3K C;  3AZI B;  2NQB A;  3WKJ A;  3WA9 A;  3C1C C;  3A1I A;  5B0Y D;  5BNV A;  5AV8 A;  1B6W A;  4LD9 A;  2IO5 B;  3KXB A;  1P3O D;  5CPI D;  3X1U A;  3UT9 C;  1KX5 C;  2JE5 A;  5AVC D;  1HQ3 C;  1P3O B;  3EPK A;  5CPI B;  3KWQ D;  4XUJ C;  2RVQ C;  5DNM A;  3AV1 D;  5B2J A;  5B40 A;  5AVC B;  2FJ7 C;  3KWQ B;  5CPK A;  5FUG B;  3VH5 T;  4WNN A;  3AV1 B;  4J8U A;  1P3P D;  4R8P C;  1KX3 D;  4Z5T D;  1HTA A;  1PZR A;  2YFW B;  5CPJ D;  4ZUX A;  4X23 C;  4Z2M G;  3AZF C;  5BNX A;  4WU8 D;  3REH C;  2XD1 A;  1S32 C;  1P3P B;  4J8X A;  2DQN C;  1KX3 B;  1F66 C;  4XZQ C;  5F99 C;  5B32 C;  1KX4 C;  5B31 A;  1ZLA C;  3P5J B;  3REI C;  3MGQ D;  5GXQ C;  3AN2 D;  5B2I C;  1M18 D;  5C3I C;  1H3O B;  1U35 B;  4KGC D;  3REK D;  4H9N B;  4H9R B;  4E45 A;  1B67 A;  3MGQ B;  3TU4 C;  1P3A A;  1P3F C;  1P3M D;  3AN2 B;  4NE3 A;  3W97 A;  1M18 B;  5B1L A;  2HIO C;  4KGC B;  5GSU A;  3REK B;  4H9O A;  4WU9 A;  1P3M B;  3X1V C;  3AZJ A;  3KUY D;  3NQU A;  3B6F A;  2NZD D;  2Y2Q A;  4ZBJ C;  5DNN A;  2ZY3 A;  1ID3 C;  2ARO A;  3LJA B;  2F8N K;  1BH8 B;  4M6B A;  3AZK A;  3MNN A;  3KUY B;  5JA4 B;  3MGP A;  2NZD B;  2Y2K A;  1M1A C;  1R4V A;  5B33 A;  5CPK D;  1P3G A;  4CSR B;  1P3L A;  2CV5 A;  4KHA B;  4NE5 A;  5B32 G;  3REL D;  3LZ0 D;  4NFT A;  3FDD A;  3VH6 A;  3WTP C;  3AZI A;  1P3K D;  4H9S C;  3UTA C;  5E5A C;  4J8X D;  5AV9 C;  3AZN C;  3REL B;  1JFI A;  3C1C D;  3REJ B;  4Z66 C;  3X1T C;  1P3K B;  5GT3 C;  3MGR B;  5B0Y A;  3WTP E;  3C1B C;  3C1C B;  3UT9 D;  1P3O A;  3UTB B;  1AOI B;  5CPI A;  1KX5 D;  2HUE C;  1HQ3 D;  5B0Z C;  4XUJ D;  2RVQ D;  5AVC A;  3UT9 B;  5B1L D;  4WZS B;  3KWQ A;  1KX5 B;  5FUG A;  1HQ3 B;  2FJ7 D;  3A1K A;  3AV1 A;  4XUJ B;  5G49 A;  3LJA C;  4R8P D;  4J8V C;  4X23 D;  5AY8 C;  2PYO D;  1P3P A;  3AZF D;  1T3U A;  4Z5T A;  1KX3 A;  3W99 C;  2CWE A;  5CPJ A;  3REH D;  4R8P B;  1S32 D;  4J8W C;  1F66 D;  5KDM B;  4XZQ D;  4WU8 A;  4X23 B;  5B32 D;  3AZF B;  4KUD C;  2Y2M A;  3WKJ C;  3AFA C;  3REH B;  1KX4 D;  1S32 B;  1ZLA D;  2Y2J A;  4YS3 C;  1F66 B;  3REI D;  4XZQ B;  4H9P B;  5GXQ D;  1H3O A;  5F99 B;  5B32 B;  2F8N G;  3MGS C;  1ULY A;  4H9N A;  3MGQ A;  1KX4 B;  1ZLA B;  3AN2 A;  1M18 A;  3REI B;  1BH9 A;  1P3F D;  3TU4 D;  3MGR C;  3X1U C;  5GXQ B;  5B2I B;  3REK A;  4KGC A;  5C3I B;  2HIO D;  5GT0 C;  3LEL C;  1P3M A;  3UTB C;  1P3F B;  3TU4 B;  1AOI C;  3X1V D;  1TZY C;  5B2J C;  2HIO B;  2Y2P A;  1W2E A;  3KUY A;  1ID3 D;  5JA4 A;  2NZD A;  3X1V B;  2XD5 A;  2ZM5 A;  3W98 C;  4H9Q A;  3B0C W;  3AV2 C;  1M1A D;  4ZBJ B;  4CSR A;  1ID3 B;  2VQR A;  4KHA A;  5AV5 C;  1M1A B;  2ZY2 A;  3VH5 A;  3WTP D;  4NE6 A;  3REL A;  1Q9C A;  3LZ0 A;  3UTA D;  5E5A D;  5AV9 D;  3H0L C;  1P3K A;  5JRG C;  1M19 B;  4WV4 B;  2F8N H;  3B6G C;  3WTP B;  4Z66 D;  5BO0 B;  3X1T D;  3LZ1 B;  3AZE C;  3X1S B;  5GT3 D;  3UTA B;  3KSY A;  5B1M C;  4UPK A;  5E5A B;  3C1C A;  5AV9 B;  2F8N D;  3AZN B;  1P3A C;  2DF4 C;  1P3I B;  1U35 D;  4Z66 B;  3X1T B;  2FFF B;  3AZM C;  4DRA A;  5GT3 B;  2F8N B;  3UT9 A;  5B0Z D;  3MVD C;  3C1B B;  1KX5 A;  2F2A C;  2Y2I A;  1HQ3 A;  4XUJ A;  2HUE B;  3AL0 C;  2BYM A;  3AZK C;  4G91 C;  5B0Z B;  2LY8 A;  3O62 C;  3AZG C;  2FJ7 A;  3LJA D;  4JJN C;  1TAF A;  4J8V D;  4AWL C;  5AY8 D;  4R8P A;  1WWS A;  3IP4 C;  1EQZ C;  3W99 D;  2UWX A;  4QLC B;  5KDM A;  4X23 A;  2PYO A;  3AZF A;  4J8W D;  4J8V B;  3R45 B;  3AYW C;  5AY8 B;  3REH A;  1S32 A;  1N1J B;  4KUD D;  1P3B C;  3W99 B;  1F66 A;  3AFA D;  4XZQ A;  4H9P A;  5B32 A;  4YS3 D;  4J8W B;  5BS7 C;  4EO5 C;  1KX4 A;  1ZLA A;  3MGS D;  4KUD B;  5B0Y C;  1P34 C;  3REI A;  1M19 C;  3VH6 W;  3V9R B;  3AFA B;  3REJ D;  5GXQ A;  3WKJ B;  5AV6 C;  3LZ1 C;  4YS3 B;  3WAA C;  2L5A A;  3X1S C;  5BNV B;  3MGR D;  3MGS B;  4LD9 B;  5GT0 D;  1P3F A;  3TU4 A;  3LEL D;  1P3I C;  2ZY4 A;  3UTB D;  1AOI D;  2HIO A;  3X1U B;  3EG5 B;  1TZY D;  2G5H C;  5GT0 B;  3LEL B;  3X1V A;  1BFM A;  5DNM B;  1TZY B;  3W98 D;  3A6N C;  3AV2 D;  5B2J B;  1ID3 A;  1M1A A;  3AZL C;  3W98 B;  5AV5 D;  3AV2 B;  4CAY B;  3W96 C;  5AVB C;  4WU8 C;  2Y2N A;  2YFW A;  5BNX B;  4QLC C;  5CP6 C;  5AV5 B;  4G92 C;  3WTP A;  5BO0 A;  4H9S A;  5JRG D;  4YM6 C;  3B6G D;  3UTA A;  5E5A A;  3AZH C;  5AV9 A;  3AZN A;  3AZE D;  5B24 C;  5B1M D;  5F99 D;  1Z2C B;  4Z66 A;  3X1T A;  2G5I C;  5JRG B;  2NQB C;  5GT3 A;  3B6G B;  2F8N A;  3WA9 C;  3NQJ B;  3AZE B;  3AZM D;  5B1M B;  3C1B A;  1U35 A;  5B2I D;  5AV8 C;  1P3A B;  4LD9 C;  4H9R A;  3KXB C;  3MVD D;  3W97 B;  2JSS A;  3AZM B;  2J8P A;  5B0Z A;  4H9O B;  2BYK B;  3MVD B;  3NQU B;  3AZG D;  2YFV B;  4JJN D;  5DNM C;  3H0M C;  3AZK B;  4G91 B;  3LJA A;  5B40 C;  1BH8 A;  3O62 B;  1EQZ D;  4J8V A;  3R45 A;  3AZG B;  5CPK C;  5AY8 A;  4WJ3 C;  4JJN B;  2Y2L A;  4J8U C;  3AYW D;  3W99 A;  4AWL B;  4E44 A;  4ZUX C;  3LZ0 C;  2Y2G A;  1P3B D;  1EQZ B;  4J8W A;  2Y2H A;  4KUD A;  3AYW B;  4J8X C;  3AFA A;  3V9R A;  3VH5 W;  1P3B B;  4YS3 A;  1P34 D;  1M19 D;  1JFI B;  5BT1 C;  5AV6 D;  4UUZ B;  3LZ1 D;  3MGS A;  3X1S D;  5B31 C;  3WAA D;  3REJ A;  4EO5 B;  3AZN D;  3B0B A;  5B0Y B;  1P34 B;  2ZY5 A;  3MGR A;  1P3I D;  5AV6 B;  4DRB A;  3WAA B;  4HGA C;  5GT0 A;  3LEL A;  3B0C T;  3C1B D;  3UTB A;  1AOI A;  3W97 C;  5B1L C;  1TZY A;  5GSU C;  4WU9 C;  3A6N D;  3AZJ C;  3B6F C;  3W98 A; 
#chains in the Genus database with same CATH homology
 3AV2 A;  3B0D C;  4CAY A;  5G49 B;  5DNN C;  2ARO C;  3AZL D;  2PYO C;  3A6N B;  1WWI A;  3MNN C;  3W96 D;  5AVB D;  3MGP C;  3EPH A;  4QLC D;  5AV5 A;  5B33 C;  4Z5T B;  5CP6 D;  5CPJ B;  3AZL B;  1P3G C;  1P3L C;  5AVB B;  3W96 B;  2CV5 C;  4WU8 B;  4YM6 D;  4DQY B;  3AZH D;  5CP6 B;  5B24 D;  5JRG A;  4G92 B;  3AZI C;  5B31 G;  3B6G A;  3NQJ A;  3AZE A;  2NQB D;  3WKJ D;  4YM6 B;  5B1M A;  3F6T A;  5F99 A;  3AZH B;  3WA9 D;  5B24 B;  2IO5 C;  2RIQ A;  1BH9 B;  5AV8 D;  3AZM A;  4LD9 D;  2NQB B;  3KXB D;  3WA9 B;  5B2I A;  2BYK A;  3MVD A;  3X1U D;  1P3O C;  5AV8 B;  5CPI C;  2YFV A;  3KXB B;  5DNM D;  5AVC C;  3O62 A;  3KWQ C;  3AZG A;  5B2J D;  5B40 D;  3KFU G;  4JJN A;  4H9Q B;  4Z2M H;  3AV1 C;  3H0R C;  4J8U D;  1EQZ A;  5B40 B;  4ZUX D;  1P3P C;  3AYW A;  5CPK B;  1KX3 C;  4Z5T C;  3VH6 T;  4WNN B;  5CPJ C;  4J8U B;  1P3B A;  4ZUX B;  3LZ0 B;  4UUZ A;  3EPL A;  5BS7 A;  5BT1 D;  5B31 D;  4J8X B;  5CHL B;  1P34 A;  1M19 A;  5AV6 A;  3LZ1 A;  1U35 C;  3X1S A;  3WAA A;  2W8S A;  3MGQ C;  1KU5 A;  5B31 B;  3AN2 C;  1M18 C;  1P3I A;  1P3A D;  3EPJ A;  4KGC C;  3REK C;  3W97 D;  1A7W A;  2BG1 A;  5GSU D;  1P3M C;  4HGA B;  4WU9 D;  3AZJ D;  3B6F D;  2BYM B;  5B1L B;  3A6N A;  5GSU B;  5DNN D;  3KUY C;  2ARO D;  2FJ7 B;  2NZD C;  4WU9 B;  1TAF B;  3AZK D;  3AZJ B;  3MNN D;  1F1E A;  3B6F B;  3O62 D;  3MGP D;  3AZL A;  5B33 D;  3B0D B;  5DNN B;  2JCH A;  3W96 A;  2ARO B;  5AVB A;  2PYO B;  4QLC A;  1P3G D;  3MNN B;  1P3L D;  5CP6 A;  3MGP B;  2CV5 D;  5B33 B;  1N1J A;  3AZI D;  4YM6 A;  1P3G B;  3REL C;  1P3L B;  3AZH A;  2Y2O A;  2CV5 B;  3REJ C;  5B24 A;  1P3K C;  3AZI B;  2NQB A;  3WKJ A;  3WA9 A;  3C1C C;  3A1I A;  5B0Y D;  5BNV A;  5AV8 A;  1B6W A;  4LD9 A;  2IO5 B;  3KXB A;  1P3O D;  5CPI D;  3X1U A;  3UT9 C;  1KX5 C;  2JE5 A;  5AVC D;  1HQ3 C;  1P3O B;  3EPK A;  5CPI B;  3KWQ D;  4XUJ C;  2RVQ C;  5DNM A;  3AV1 D;  5B2J A;  5B40 A;  5AVC B;  2FJ7 C;  3KWQ B;  5CPK A;  5FUG B;  3VH5 T;  4WNN A;  3AV1 B;  4J8U A;  1P3P D;  4R8P C;  1KX3 D;  4Z5T D;  1HTA A;  1PZR A;  2YFW B;  5CPJ D;  4ZUX A;  4X23 C;  4Z2M G;  3AZF C;  5BNX A;  4WU8 D;  3REH C;  2XD1 A;  1S32 C;  1P3P B;  4J8X A;  2DQN C;  1KX3 B;  1F66 C;  4XZQ C;  5F99 C;  5B32 C;  1KX4 C;  5B31 A;  1ZLA C;  3P5J B;  3REI C;  3MGQ D;  5GXQ C;  3AN2 D;  5B2I C;  1M18 D;  5C3I C;  1H3O B;  1U35 B;  4KGC D;  3REK D;  4H9N B;  4H9R B;  4E45 A;  1B67 A;  3MGQ B;  3TU4 C;  1P3A A;  1P3F C;  1P3M D;  3AN2 B;  4NE3 A;  3W97 A;  1M18 B;  5B1L A;  2HIO C;  4KGC B;  5GSU A;  3REK B;  4H9O A;  4WU9 A;  1P3M B;  3X1V C;  3AZJ A;  3KUY D;  3NQU A;  3B6F A;  2NZD D;  2Y2Q A;  4ZBJ C;  5DNN A;  2ZY3 A;  1ID3 C;  2ARO A;  3LJA B;  2F8N K;  1BH8 B;  4M6B A;  3AZK A;  3MNN A;  3KUY B;  5JA4 B;  3MGP A;  2NZD B;  2Y2K A;  1M1A C;  1R4V A;  5B33 A;  5CPK D;  1P3G A;  4CSR B;  1P3L A;  2CV5 A;  4KHA B;  4NE5 A;  5B32 G;  3REL D;  3LZ0 D;  4NFT A;  3FDD A;  3VH6 A;  3WTP C;  3AZI A;  1P3K D;  4H9S C;  3UTA C;  5E5A C;  4J8X D;  5AV9 C;  3AZN C;  3REL B;  1JFI A;  3C1C D;  3REJ B;  4Z66 C;  3X1T C;  1P3K B;  5GT3 C;  3MGR B;  5B0Y A;  3WTP E;  3C1B C;  3C1C B;  3UT9 D;  1P3O A;  3UTB B;  1AOI B;  5CPI A;  1KX5 D;  2HUE C;  1HQ3 D;  5B0Z C;  4XUJ D;  2RVQ D;  5AVC A;  3UT9 B;  5B1L D;  4WZS B;  3KWQ A;  1KX5 B;  5FUG A;  1HQ3 B;  2FJ7 D;  3A1K A;  3AV1 A;  4XUJ B;  5G49 A;  3LJA C;  4R8P D;  4J8V C;  4X23 D;  5AY8 C;  2PYO D;  1P3P A;  3AZF D;  1T3U A;  4Z5T A;  1KX3 A;  3W99 C;  2CWE A;  5CPJ A;  3REH D;  4R8P B;  1S32 D;  4J8W C;  1F66 D;  5KDM B;  4XZQ D;  4WU8 A;  4X23 B;  5B32 D;  3AZF B;  4KUD C;  2Y2M A;  3WKJ C;  3AFA C;  3REH B;  1KX4 D;  1S32 B;  1ZLA D;  2Y2J A;  4YS3 C;  1F66 B;  3REI D;  4XZQ B;  4H9P B;  5GXQ D;  1H3O A;  5F99 B;  5B32 B;  2F8N G;  3MGS C;  1ULY A;  4H9N A;  3MGQ A;  1KX4 B;  1ZLA B;  3AN2 A;  1M18 A;  3REI B;  1BH9 A;  1P3F D;  3TU4 D;  3MGR C;  3X1U C;  5GXQ B;  5B2I B;  3REK A;  4KGC A;  5C3I B;  2HIO D;  5GT0 C;  3LEL C;  1P3M A;  3UTB C;  1P3F B;  3TU4 B;  1AOI C;  3X1V D;  1TZY C;  5B2J C;  2HIO B;  2Y2P A;  1W2E A;  3KUY A;  1ID3 D;  5JA4 A;  2NZD A;  3X1V B;  2XD5 A;  2ZM5 A;  3W98 C;  4H9Q A;  3B0C W;  3AV2 C;  1M1A D;  4ZBJ B;  4CSR A;  1ID3 B;  2VQR A;  4KHA A;  5AV5 C;  1M1A B;  2ZY2 A;  3VH5 A;  3WTP D;  4NE6 A;  3REL A;  1Q9C A;  3LZ0 A;  3UTA D;  5E5A D;  5AV9 D;  3H0L C;  1P3K A;  5JRG C;  1M19 B;  4WV4 B;  2F8N H;  3B6G C;  3WTP B;  4Z66 D;  5BO0 B;  3X1T D;  3LZ1 B;  3AZE C;  3X1S B;  5GT3 D;  3UTA B;  3KSY A;  5B1M C;  4UPK A;  5E5A B;  3C1C A;  5AV9 B;  2F8N D;  3AZN B;  1P3A C;  2DF4 C;  1P3I B;  1U35 D;  4Z66 B;  3X1T B;  2FFF B;  3AZM C;  4DRA A;  5GT3 B;  2F8N B;  3UT9 A;  5B0Z D;  3MVD C;  3C1B B;  1KX5 A;  2F2A C;  2Y2I A;  1HQ3 A;  4XUJ A;  2HUE B;  3AL0 C;  2BYM A;  3AZK C;  4G91 C;  5B0Z B;  2LY8 A;  3O62 C;  3AZG C;  2FJ7 A;  3LJA D;  4JJN C;  1TAF A;  4J8V D;  4AWL C;  5AY8 D;  4R8P A;  1WWS A;  3IP4 C;  1EQZ C;  3W99 D;  2UWX A;  4QLC B;  5KDM A;  4X23 A;  2PYO A;  3AZF A;  4J8W D;  4J8V B;  3R45 B;  3AYW C;  5AY8 B;  3REH A;  1S32 A;  1N1J B;  4KUD D;  1P3B C;  3W99 B;  1F66 A;  3AFA D;  4XZQ A;  4H9P A;  5B32 A;  4YS3 D;  4J8W B;  5BS7 C;  4EO5 C;  1KX4 A;  1ZLA A;  3MGS D;  4KUD B;  5B0Y C;  1P34 C;  3REI A;  1M19 C;  3VH6 W;  3V9R B;  3AFA B;  3REJ D;  5GXQ A;  3WKJ B;  5AV6 C;  3LZ1 C;  4YS3 B;  3WAA C;  2L5A A;  3X1S C;  5BNV B;  3MGR D;  3MGS B;  4LD9 B;  5GT0 D;  1P3F A;  3TU4 A;  3LEL D;  1P3I C;  2ZY4 A;  3UTB D;  1AOI D;  2HIO A;  3X1U B;  3EG5 B;  1TZY D;  2G5H C;  5GT0 B;  3LEL B;  3X1V A;  1BFM A;  5DNM B;  1TZY B;  3W98 D;  3A6N C;  3AV2 D;  5B2J B;  1ID3 A;  1M1A A;  3AZL C;  3W98 B;  5AV5 D;  3AV2 B;  4CAY B;  3W96 C;  5AVB C;  4WU8 C;  2Y2N A;  2YFW A;  5BNX B;  4QLC C;  5CP6 C;  5AV5 B;  4G92 C;  3WTP A;  5BO0 A;  4H9S A;  5JRG D;  4YM6 C;  3B6G D;  3UTA A;  5E5A A;  3AZH C;  5AV9 A;  3AZN A;  3AZE D;  5B24 C;  5B1M D;  5F99 D;  1Z2C B;  4Z66 A;  3X1T A;  2G5I C;  5JRG B;  2NQB C;  5GT3 A;  3B6G B;  2F8N A;  3WA9 C;  3NQJ B;  3AZE B;  3AZM D;  5B1M B;  3C1B A;  1U35 A;  5B2I D;  5AV8 C;  1P3A B;  4LD9 C;  4H9R A;  3KXB C;  3MVD D;  3W97 B;  2JSS A;  3AZM B;  2J8P A;  5B0Z A;  4H9O B;  2BYK B;  3MVD B;  3NQU B;  3AZG D;  2YFV B;  4JJN D;  5DNM C;  3H0M C;  3AZK B;  4G91 B;  3LJA A;  5B40 C;  1BH8 A;  3O62 B;  1EQZ D;  4J8V A;  3R45 A;  3AZG B;  5CPK C;  5AY8 A;  4WJ3 C;  4JJN B;  2Y2L A;  4J8U C;  3AYW D;  3W99 A;  4AWL B;  4E44 A;  4ZUX C;  3LZ0 C;  2Y2G A;  1P3B D;  1EQZ B;  4J8W A;  2Y2H A;  4KUD A;  3AYW B;  4J8X C;  3AFA A;  3V9R A;  3VH5 W;  1P3B B;  4YS3 A;  1P34 D;  1M19 D;  1JFI B;  5BT1 C;  5AV6 D;  4UUZ B;  3LZ1 D;  3MGS A;  3X1S D;  5B31 C;  3WAA D;  3REJ A;  4EO5 B;  3AZN D;  3B0B A;  5B0Y B;  1P34 B;  2ZY5 A;  3MGR A;  1P3I D;  5AV6 B;  4DRB A;  3WAA B;  4HGA C;  5GT0 A;  3LEL A;  3B0C T;  3C1B D;  3UTB A;  1AOI A;  3W97 C;  5B1L C;  1TZY A;  5GSU C;  4WU9 C;  3A6N D;  3AZJ C;  3B6F C;  3W98 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...