3LELC

Structural insight into the sequence-dependence of nucleosome positioning
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
104
structure length
104
Chain Sequence
KTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Structural insight into the sequence dependence of nucleosome positioning
pubmed doi rcsb
source organism Xenopus laevis
total genus 32
structure length 104
sequence length 104
chains with identical sequence G, M, Q
ec nomenclature
pdb deposition date 2010-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3lelC00
4NE3A 3REHD 2NZDC 3UTBD 2HIOB 2NZDA 3A6ND 4ZUXB 2CWEA 2AROB 1R4VA 4WZSB 4XUJB 1F66D 1ZLAB 4ZBJB 4XZQB 1N1JA 5B33B 3WTPB 5B32C 3AV2C 3W98C 3AZKC 1M19D 4H9QA 3AV2A 1U35D 5B32A 3W98A 3MGPB 3KWQC 3AZKA 1HTAA 3KWQA 5BO0A 1H3OA 1P3AD 4DRAA 3W99B 5B1MD 3O62D 4J8WB 1ID3D 1P3BB 4G92B 1P3GB 5B2ID 3AZLD 2BYKA 1P3FC 3REKB 3AZJC 3MNNC 3KXBB 3AFAB 1P3FA 3VH6W 3AZJA 3MNNA 2F8ND 1WWSA 3X1VC 5B31G 5C3IB 4YS3D 4H9RB 3X1VA 4WU8B 4KHAB 3C1BD 2L5AA 5DNNC 5B31C 3AZFD 1HQ3C 5B2JD 5DNNA 5B31A 2NZDB 1HQ3A 3LZ0D 1P3PD 1KX3C 3WKJD 1AOID 3KUYD 1KX3A 4X23B 5B0ZC 2CV5C 4QLCC 4J8XC 4KUDC 5E5AC 5B0ZA 1A7WA 3UT9C 2CV5A 1F1EA 4QLCA 4J8XA 4KUDA 5E5AA 1N1JB 2F8NK 3UT9A 5GT3D 5GSUD 5AV5D 3AV2B 5B32B 5B0YD 1P34D 3W98B 4UUZA 3AZMD 3AZKB 2PYOC 3C1CC 3KWQB 2PYOA 3C1CA 5BO0B 3REJC 2HIOD 1H3OB 4ZUXD 3MGSC 1P3KC 3REJA 3VH5T 1P3MC 2AROD 5B40C 3MGSA 1P3MA 5B40A 4XUJD 5CPKD 1B6WA 5AV9C 3LJAC 1ZLAD 1ULYA 5AV9A 3LJAA 5CHLB 4XZQD 3WTPD 3AZJB 4Z5TC 3MNNB 4JJNC 4Z5TA 5AVCC 3MVDC 3MGPD 3TU4B 4JJNA 3MGRC 3AV1C 5AVCA 3MVDA 3X1VB 3MGRA 3AYWB 3AV1A 5B1LC 3KSYA 5AY8C 3W99D 5DNNB 4J8WD 1HQ3B 5B1LA 1P3BD 5AY8A 1P3GD 3AZEC 3REKD 3AZEA 3LELC 3AFAD 3KXBD 5B0ZB 2CV5B 4QLCB 3LELA 4J8XB 4KUDB 3B0CT 3R45A 5E5AB 5GT0C 4J8VC 3W97C 3UT9B 3AZGC 3MGQC 3W97A 5GT0A 3WTPE 1BH9B 4UUZB 3AZGA 5BS7C 3MGQA 4R8PB 4WU8D 1M18C 5BS7A 3WAAB 3AN2C 2PYOB 3C1CB 4WU9C 1S32C 1M18A 3RELC 3AN2A 2NZDD 1S32A 4WU9A 5AV6C 3REJB 3WA9B 3RELA 3AZIC 3MGSB 1P3KB 5AV6A 4X23D 1P3MB 3AZIA 1P3LC 5B40B 3X1TC 1P3LA 1M1AC 5AV9B 3LJAB 5AVBC 3X1TA 1M1AA 3X1UC 1KX4C 5CPJB 5AVBA 3AV2D 1KX4A 5B32D 3X1UA 3B6FC 3W98D 4Z5TB 3AZKD 1KX5D 4JJNB 3B6FA 3B0DC 5AVCB 1B67A 4H9PA 4EO5C 3MVDB 5CP6B 3KWQD 5DNMC 3MGRB 3REHC 3UTBC 3AZNC 3AV1B 4YM6B 3REHA 3AZNA 5DNMA 3UTBA 3A6NC 2FJ7C 5B1LB 5G49A 5AY8B 3A6NA 2FJ7A 5BNVB 5GXQC 5B24C 1TZYB 5GXQA 5F99C 2IO5C 5B24A 3AZEB 4AWLC 5F99A 3AZJD 3LELB 3MNND 1M19C 1U35C 4Z66D 5GT0B 3TU4D 3W97B 4J8VB 1M19A 1U35A 3AZGB 3MGQB 3X1VD 3REIC 5CPIC 3AYWD 1P3OD 1P3AC 3REIA 1M18B 5CPIA 5DNND 4J8UC 3AN2B 1S32B 5JA4A 4WU9B 1HQ3D 1P3AA 4J8UA 5B2IC 5AV6B 2HUEC 3AZLC 3AZIB 3UTAC 1P3IC 5B2IA 3AZLA 2F8NG 5B0ZD 1P3LB 5AV8C 3UTAA 2CV5D 1P3IA 4QLCD 4J8XD 4KUDD 5E5AD 3X1TB 1M1AB 5AV8A 3UT9D 5AVBB 1KX4B 3X1UB 4YS3C 4R8PD 4H9QB 3B6FB 3WAAD 2PYOD 3C1CD 4YS3A 3AZFC 5FUGA 1BH8A 3LZ1C 3B0DB 4EO5B 2LY8A 3AZFA 3AZNB 5DNMB 3REJD 3LZ0C 3WA9D 5JRGC 3LZ1A 1P3PC 1EQZC 3VH5W 3MGSD 5G49B 2JSSA 1P3KD 2NQBC 3LZ0A 2FJ7B 5JRGA 1P3MD 1P3PA 5B40D 1EQZA 2NQBA 5GXQB 4H9OA 5B24B 5AV9D 3LJAD 2BYKB 3NQUA 5F99B 2IO5B 4HGAC 5CPJD 5GT3C 4AWLB 1P3FB 5B33D 5B0YC 2BYMA 4Z5TD 5GT3A 2YFVA 4JJND 1M19B 5B0YA 2YFWA 5AVCD 3MVDD 5CP6D 3MGRD 3AV1D 2HIOC 4YM6D 3REIB 5CPIB 2HIOA 5JA4B 4H9SC 5B1LD 5BNXA 5AY8D 4J8UB 5B31B 4H9SA 5CPKC 1TZYD 4H9NA 3AZED 4NFTA 5B2IB 2HUEB 3AZLB 5CPKA 1KX3B 4XZQC 1ZLAA 3UTAB 3WTPC 1P3IB 3B6GC 3LELD 4XZQA 3B0CW 5AV8B 3WTPA 3B6GA 5GT0D 3W97D 3MGPC 4J8VD 3AZGD 3MGQD 5KDMA 3MGPA 3AZHC 1M18D 3AZHA 5FUGB 2RVQD 1BH8B 5BT1D 3AN2D 1S32D 4WU9D 3AZFB 4J8WC 4LD9C 3LZ1B 5AV6D 4J8WA 4LD9A 5JRGB 3AZID 1P3PB 1EQZB 1JFIA 2NQBB 1P3LD 3X1SC 3X1TD 1M1AD 3X1SA 3W96C 5AVBD 1KX4D 3X1UD 3W96A 4HGAB 5C3IC 2YFVB 5GT3B 5B0YB 2YFWB 4H9RA 4KGCC 3AZND 5DNMD 4KGCA 1TAFA 5BNXB 4NE6A 2FJ7D 4X23C 3B0BA 5GXQD 4X23A 4H9NB 5B24D 5CPKB 5B32G 1F66C 3NQJA 5F99D 1F66A 1P3FD 4G91C 3B6GB 1Q9CA 3R45B 1KX5C 5KDMB 1KX5A 3REID 3AZHB 5CPID 4J8UD 5B31D 5B1MC 3O62C 4LD9B 1ID3C 3RELB 5B1MA 1JFIB 3O62A 1ID3A 1KX3D 3V9RA 3UTAD 1P3ID 4WV4B 5AV8D 3X1SB 4CSRA 4Z66C 3VH6T 3TU4C 3W96B 4Z66A 3TU4A 3VH6A 2F8NA 3AYWC 1P3OC 3C1BC 4CAYA 4H9PB 3AYWA 1P3OA 4KGCB 5B2JC 3C1BA 3LZ1D 2F8NH 1TAFB 3REHB 3UTBB 5B2JA 5JRGD 1EQZD 3WKJC 1AOIC 3KUYC 2NQBD 3A6NB 3WKJA 1AOIA 3KUYA 4WNNA 3NQJB 1F66B 4Z2MG 4G91B 5GSUC 4R8PC 5AV5C 1P34C 1BH9A 3WAAC 4NE5A 5GSUA 1KU5A 3AZMC 5AV5A 4R8PA 1KX5B 1U35B 1P34A 3WAAA 3AZMA 3WA9C 4ZUXC 4Z2MH 3WA9A 1P3AB 1WWIA 2AROC 4ZUXA 1P3KA 2AROA 5B1MB 3VH5A 4XUJC 3O62B 1ID3B 3V9RB 1ZLAC 4XUJA 5CPJC 4ZBJC 4CSRB 5B33C 3B6GD 5CPJA 5B33A 4Z66B 5CP6C 1BFMA 2F8NB 4YM6C 3AZHD 5CP6A 4CAYB 4YS3B 4E45A 4YM6A 1P3OB 3C1BB 3W99C 4LD9D 5B2JB 3RELD 1P3BC 1TZYC 3W99A 4G92C 5BNVA 4DRBA 1P3GC 3LZ0B 1P3BA 1TZYA 3WKJB 1AOIB 3KUYB 3REKC 1P3GA 4WNNB 3X1SD 3KXBC 3AFAC 4H9OB 3REKA 3NQUB 3KXBA 3AFAA 4E44A 3W96D 4J8VA 4M6BA 2BYMB 5GSUB 5AV5B 4WU8C 3B6FD 1P34B 2RVQC 5BT1C 3AZMB 4KGCD 4WU8A 4KHAA
chains in the Genus database with same CATH superfamily
4NE3A 3REHD 2NZDC 3UTBD 2HIOB 2NZDA 3A6ND 4ZUXB 2CWEA 2AROB 3IP4C 1R4VA 4WZSB 4XUJB 1F66D 2Y2HA 1ZLAB 2F2AC 4ZBJB 4XZQB 1N1JA 5B33B 3WTPB 5B32C 3AV2C 3W98C 3EPHA 3AZKC 1M19D 4H9QA 3AV2A 1U35D 2UWXA 5B32A 3W98A 3MGPB 3KWQC 3AZKA 1HTAA 3KWQA 2DQNC 5BO0A 1H3OA 1P3AD 4DRAA 3W99B 5B1MD 3O62D 4J8WB 1ID3D 1P3BB 4G92B 1P3GB 2ZY5A 5B2ID 3AZLD 2BYKA 1P3FC 3REKB 2Y2OA 3AZJC 3MNNC 3KXBB 3AFAB 1P3FA 3VH6W 1Z2CB 3AZJA 3MNNA 2F8ND 1WWSA 3X1VC 5B31G 5C3IB 4YS3D 4H9RB 3X1VA 4WU8B 4KHAB 3C1BD 2L5AA 5DNNC 5B31C 3AZFD 2FFFB 1HQ3C 3EG5B 5B2JD 5DNNA 5B31A 2NZDB 2Y2MA 1HQ3A 3LZ0D 1P3PD 1KX3C 3WKJD 1AOID 3KUYD 1KX3A 4X23B 5B0ZC 2CV5C 4QLCC 4J8XC 4KUDC 5E5AC 5B0ZA 1A7WA 3UT9C 2CV5A 2VQRA 1F1EA 4QLCA 4J8XA 4KUDA 5E5AA 1N1JB 2F8NK 3UT9A 5GT3D 5GSUD 5AV5D 3AV2B 5B32B 5B0YD 1P34D 3W98B 4UUZA 3AZMD 3AZKB 3EPLA 3C1CC 2PYOC 3KWQB 2PYOA 3C1CA 5BO0B 3REJC 2HIOD 1H3OB 4ZUXD 3MGSC 1P3KC 3A1KA 3REJA 3VH5T 1P3MC 2AROD 5B40C 3MGSA 1P3MA 5B40A 4XUJD 5CPKD 1B6WA 5AV9C 3LJAC 1ZLAD 1ULYA 5AV9A 3LJAA 5CHLB 4XZQD 3WTPD 3AZJB 2ZY3A 4Z5TC 3MNNB 4JJNC 2XD1A 2Y2PA 4Z5TA 5AVCC 3MVDC 3MGPD 3TU4B 4JJNA 3MGRC 3AV1C 5AVCA 3MVDA 3X1VB 3MGRA 3AYWB 3AV1A 2Y2GA 3KSYA 5B1LC 5AY8C 3W99D 5DNNB 2Y2LA 4J8WD 1HQ3B 5B1LA 1P3BD 5AY8A 1P3GD 3AZEC 3REKD 3AZEA 3KFUG 3LELC 3AFAD 3KXBD 5B0ZB 2CV5B 4QLCB 3LELA 4J8XB 4KUDB 3B0CT 3R45A 5E5AB 5GT0C 4J8VC 3W97C 3UT9B 3AZGC 3MGQC 2W8SA 3W97A 5GT0A 3WTPE 1BH9B 4UUZB 3AZGA 5BS7C 3MGQA 4R8PB 4WU8D 1M18C 5BS7A 3WAAB 3AN2C 2PYOB 3C1CB 4WU9C 1S32C 1M18A 3RELC 2J8PA 3AN2A 2NZDD 1S32A 4WU9A 5AV6C 2JCHA 3REJB 3WA9B 3RELA 3AZIC 3MGSB 1P3KB 5AV6A 3P5JB 4X23D 3AZIA 1P3MB 5B40B 1P3LC 3X1TC 1P3LA 1M1AC 5AV9B 3LJAB 5AVBC 3X1TA 3A1IA 3X1UC 1M1AA 1KX4C 5CPJB 5AVBA 3AV2D 1KX4A 5B32D 3X1UA 3B6FC 3W98D 4Z5TB 3AZKD 1KX5D 2NQBC 4JJNB 3B6FA 3B0DC 5AVCB 1B67A 4H9PA 4EO5C 3MVDB 5CP6B 3KWQD 5DNMC 3MGRB 3REHC 3UTBC 3AZNC 3AV1B 4YM6B 3REHA 3AZNA 5DNMA 3UTBA 3A6NC 2FJ7C 2Y2KA 5B1LB 5G49A 5AY8B 3A6NA 2FJ7A 5BNVB 5GXQC 5B24C 1TZYB 5GXQA 5F99C 2IO5C 5B24A 3AZEB 4WJ3C 4AWLC 5F99A 2G5IC 3AZJD 3LELB 3MNND 2Y2NA 1M19C 1U35C 4Z66D 5GT0B 3TU4D 3W97B 4J8VB 1M19A 1U35A 3AZGB 3MGQB 3X1VD 3REIC 5CPIC 3H0LC 3AYWD 1P3OD 1P3AC 3REIA 1M18B 5CPIA 5DNND 4J8UC 3AN2B 1PZRA 1S32B 5JA4A 4WU9B 1HQ3D 4DQYB 1P3AA 4J8UA 4UPKA 5B2IC 5AV6B 2HUEC 3AZLC 3AZIB 3UTAC 1P3IC 5B2IA 3AZLA 2F8NG 5B0ZD 1P3LB 5AV8C 3UTAA 2CV5D 1P3IA 4QLCD 4J8XD 4KUDD 5E5AD 3X1TB 1M1AB 5AV8A 3UT9D 5AVBB 1KX4B 3X1UB 3AL0C 4YS3C 4R8PD 4H9QB 3B6FB 3WAAD 2PYOD 3C1CD 4YS3A 3AZFC 5FUGA 1BH8A 3LZ1C 3B0DB 4EO5B 2LY8A 3AZFA 3AZNB 5DNMB 3REJD 3LZ0C 3WA9D 5JRGC 3LZ1A 1P3PC 1EQZC 3VH5W 3MGSD 2JE5A 2JSSA 2Y2QA 5G49B 3LZ0A 1P3KD 2FJ7B 5JRGA 1P3MD 1P3PA 5B40D 1EQZA 2NQBA 5GXQB 4H9OA 5B24B 5AV9D 3LJAD 2BYKB 3NQUA 5F99B 2IO5B 4HGAC 5CPJD 5GT3C 4AWLB 1P3FB 5B33D 5B0YC 2BYMA 4Z5TD 5GT3A 2YFVA 4JJND 1M19B 5B0YA 2YFWA 5AVCD 3MVDD 1W2EA 5CP6D 3MGRD 3AV1D 2RIQA 2HIOC 4YM6D 3REIB 5CPIB 2HIOA 5JA4B 4H9SC 5B1LD 5BNXA 5AY8D 4J8UB 5B31B 4H9SA 5CPKC 1TZYD 4H9NA 3AZED 4NFTA 5B2IB 2HUEB 3AZLB 5CPKA 1KX3B 4XZQC 1ZLAA 3UTAB 3WTPC 1P3IB 3B6GC 3LELD 4XZQA 3B0CW 5AV8B 3WTPA 3B6GA 5GT0D 3W97D 3MGPC 4J8VD 3AZGD 3MGQD 5KDMA 3MGPA 3AZHC 1M18D 3AZHA 5FUGB 2RVQD 1BH8B 5BT1D 3AN2D 1S32D 4WU9D 3AZFB 4J8WC 4LD9C 3LZ1B 5AV6D 4J8WA 4LD9A 5JRGB 3AZID 1P3PB 1EQZB 1JFIA 2NQBB 1P3LD 3X1SC 3X1TD 1M1AD 3X1SA 3W96C 5AVBD 1KX4D 3X1UD 3W96A 4HGAB 5C3IC 2YFVB 5GT3B 5B0YB 2YFWB 4H9RA 4KGCC 2Y2JA 3AZND 5DNMD 4KGCA 1TAFA 5BNXB 4NE6A 2FJ7D 4X23C 3B0BA 5GXQD 4X23A 4H9NB 5B24D 5CPKB 5B32G 2ZY4A 1F66C 3NQJA 5F99D 1F66A 1P3FD 4G91C 2ZM5A 3B6GB 1Q9CA 3R45B 1KX5C 5KDMB 1KX5A 3REID 2Y2IA 3AZHB 5CPID 4J8UD 5B31D 5B1MC 3O62C 4LD9B 1ID3C 3RELB 5B1MA 1JFIB 3H0MC 3O62A 1ID3A 1KX3D 3V9RA 3UTAD 1P3ID 3EPKA 4WV4B 5AV8D 3X1SB 4CSRA 4Z66C 3VH6T 3TU4C 3W96B 4Z66A 3TU4A 2BG1A 3VH6A 2F8NA 3AYWC 1P3OC 3C1BC 4CAYA 4H9PB 3AYWA 1P3OA 4KGCB 5B2JC 2XD5A 3LZ1D 3C1BA 1TAFB 2F8NH 3REHB 3UTBB 5B2JA 5JRGD 1EQZD 3WKJC 1AOIC 3KUYC 2NQBD 3A6NB 3WKJA 1AOIA 3KUYA 2ZY2A 4WNNA 3NQJB 1F66B 4Z2MG 4G91B 5GSUC 4R8PC 5AV5C 2DF4C 1P34C 1BH9A 3WAAC 4NE5A 5GSUA 1KU5A 3AZMC 5AV5A 4R8PA 1KX5B 1U35B 1P34A 3WAAA 3AZMA 3WA9C 4ZUXC 4Z2MH 3WA9A 1P3AB 1WWIA 2AROC 4ZUXA 1P3KA 2AROA 5B1MB 3VH5A 4XUJC 3O62B 1ID3B 3V9RB 1ZLAC 4XUJA 5CPJC 4ZBJC 4CSRB 5B33C 3B6GD 5CPJA 3F6TA 5B33A 4Z66B 5CP6C 1BFMA 2F8NB 4YM6C 3AZHD 5CP6A 4CAYB 4YS3B 4E45A 4YM6A 1P3OB 1T3UA 3C1BB 3W99C 4LD9D 5B2JB 3RELD 1P3BC 1TZYC 3W99A 4G92C 5BNVA 4DRBA 1P3GC 3LZ0B 1P3BA 1TZYA 3WKJB 1AOIB 2G5HC 3KUYB 3REKC 4WNNB 1P3GA 3FDDA 3X1SD 3KXBC 3AFAC 4H9OB 3REKA 3NQUB 3KXBA 3H0RC 3AFAA 4E44A 3W96D 4J8VA 4M6BA 2BYMB 5GSUB 5AV5B 4WU8C 3B6FD 1P34B 2RVQC 5BT1C 3AZMB 4KGCD 4WU8A 4KHAA 3EPJA
chains in the Genus database with same CATH topology
4NE3A 3REHD 2NZDC 3UTBD 2HIOB 2NZDA 3A6ND 4ZUXB 2CWEA 2AROB 3IP4C 1R4VA 4WZSB 4XUJB 1F66D 2Y2HA 1ZLAB 2F2AC 4ZBJB 4XZQB 1N1JA 5B33B 3WTPB 5B32C 3AV2C 3W98C 3EPHA 3AZKC 1M19D 4H9QA 3AV2A 1U35D 2UWXA 5B32A 3W98A 3MGPB 3KWQC 3AZKA 1HTAA 3KWQA 2DQNC 5BO0A 1H3OA 1P3AD 4DRAA 3W99B 5B1MD 3O62D 4J8WB 1ID3D 1P3BB 4G92B 1P3GB 2ZY5A 5B2ID 3AZLD 2BYKA 1P3FC 3REKB 2Y2OA 3AZJC 3MNNC 3KXBB 3AFAB 1P3FA 3VH6W 1Z2CB 3AZJA 3MNNA 2F8ND 1WWSA 3X1VC 5B31G 5C3IB 4YS3D 4H9RB 3X1VA 4WU8B 4KHAB 3C1BD 2L5AA 5DNNC 5B31C 3AZFD 2FFFB 1HQ3C 3EG5B 5B2JD 5DNNA 5B31A 2NZDB 2Y2MA 1HQ3A 3LZ0D 1P3PD 1KX3C 3WKJD 1AOID 3KUYD 1KX3A 4X23B 5B0ZC 2CV5C 4QLCC 4J8XC 4KUDC 5E5AC 5B0ZA 1A7WA 3UT9C 2CV5A 2VQRA 1F1EA 4QLCA 4J8XA 4KUDA 5E5AA 1N1JB 2F8NK 3UT9A 5GT3D 5GSUD 5AV5D 3AV2B 5B32B 5B0YD 1P34D 3W98B 4UUZA 3AZMD 3AZKB 3EPLA 3C1CC 2PYOC 3KWQB 2PYOA 3C1CA 5BO0B 3REJC 2HIOD 1H3OB 4ZUXD 3MGSC 1P3KC 3A1KA 3REJA 3VH5T 1P3MC 2AROD 5B40C 3MGSA 1P3MA 5B40A 4XUJD 5CPKD 1B6WA 5AV9C 3LJAC 1ZLAD 1ULYA 5AV9A 3LJAA 5CHLB 4XZQD 3WTPD 3AZJB 2ZY3A 4Z5TC 3MNNB 4JJNC 2XD1A 2Y2PA 4Z5TA 5AVCC 3MVDC 3MGPD 3TU4B 4JJNA 3MGRC 3AV1C 5AVCA 3MVDA 3X1VB 3MGRA 3AYWB 3AV1A 2Y2GA 3KSYA 5B1LC 5AY8C 3W99D 5DNNB 2Y2LA 4J8WD 1HQ3B 5B1LA 1P3BD 5AY8A 1P3GD 3AZEC 3REKD 3AZEA 3KFUG 3LELC 3AFAD 3KXBD 5B0ZB 2CV5B 4QLCB 3LELA 4J8XB 4KUDB 3B0CT 3R45A 5E5AB 5GT0C 4J8VC 3W97C 3UT9B 3AZGC 3MGQC 2W8SA 3W97A 5GT0A 3WTPE 1BH9B 4UUZB 3AZGA 5BS7C 3MGQA 4R8PB 4WU8D 1M18C 5BS7A 3WAAB 3AN2C 2PYOB 3C1CB 4WU9C 1S32C 1M18A 3RELC 2J8PA 3AN2A 2NZDD 1S32A 4WU9A 5AV6C 2JCHA 3REJB 3WA9B 3RELA 3AZIC 3MGSB 1P3KB 5AV6A 3P5JB 4X23D 3AZIA 1P3MB 5B40B 1P3LC 3X1TC 1P3LA 1M1AC 5AV9B 3LJAB 5AVBC 3X1TA 3A1IA 3X1UC 1M1AA 1KX4C 5CPJB 5AVBA 3AV2D 1KX4A 5B32D 3X1UA 3B6FC 3W98D 4Z5TB 3AZKD 1KX5D 2NQBC 4JJNB 3B6FA 3B0DC 5AVCB 1B67A 4H9PA 4EO5C 3MVDB 5CP6B 3KWQD 5DNMC 3MGRB 3REHC 3UTBC 3AZNC 3AV1B 4YM6B 3REHA 3AZNA 5DNMA 3UTBA 3A6NC 2FJ7C 2Y2KA 5B1LB 5G49A 5AY8B 3A6NA 2FJ7A 5BNVB 5GXQC 5B24C 1TZYB 5GXQA 5F99C 2IO5C 5B24A 3AZEB 4WJ3C 4AWLC 5F99A 2G5IC 3AZJD 3LELB 3MNND 2Y2NA 1M19C 1U35C 4Z66D 5GT0B 3TU4D 3W97B 4J8VB 1M19A 1U35A 3AZGB 3MGQB 3X1VD 3REIC 5CPIC 3H0LC 3AYWD 1P3OD 1P3AC 3REIA 1M18B 5CPIA 5DNND 4J8UC 3AN2B 1PZRA 1S32B 5JA4A 4WU9B 1HQ3D 4DQYB 1P3AA 4J8UA 4UPKA 5B2IC 5AV6B 2HUEC 3AZLC 3AZIB 3UTAC 1P3IC 5B2IA 3AZLA 2F8NG 5B0ZD 1P3LB 5AV8C 3UTAA 2CV5D 1P3IA 4QLCD 4J8XD 4KUDD 5E5AD 3X1TB 1M1AB 5AV8A 3UT9D 5AVBB 1KX4B 3X1UB 3AL0C 4YS3C 4R8PD 4H9QB 3B6FB 3WAAD 2PYOD 3C1CD 4YS3A 3AZFC 5FUGA 1BH8A 3LZ1C 3B0DB 4EO5B 2LY8A 3AZFA 3AZNB 5DNMB 3REJD 3LZ0C 3WA9D 5JRGC 3LZ1A 1P3PC 1EQZC 3VH5W 3MGSD 2JE5A 2JSSA 2Y2QA 5G49B 3LZ0A 1P3KD 2FJ7B 5JRGA 1P3MD 1P3PA 5B40D 1EQZA 2NQBA 5GXQB 4H9OA 5B24B 5AV9D 3LJAD 2BYKB 3NQUA 5F99B 2IO5B 4HGAC 5CPJD 5GT3C 4AWLB 1P3FB 5B33D 5B0YC 2BYMA 4Z5TD 5GT3A 2YFVA 4JJND 1M19B 5B0YA 2YFWA 5AVCD 3MVDD 1W2EA 5CP6D 3MGRD 3AV1D 2RIQA 2HIOC 4YM6D 3REIB 5CPIB 2HIOA 5JA4B 4H9SC 5B1LD 5BNXA 5AY8D 4J8UB 5B31B 4H9SA 5CPKC 1TZYD 4H9NA 3AZED 4NFTA 5B2IB 2HUEB 3AZLB 5CPKA 1KX3B 4XZQC 1ZLAA 3UTAB 3WTPC 1P3IB 3B6GC 3LELD 4XZQA 3B0CW 5AV8B 3WTPA 3B6GA 5GT0D 3W97D 3MGPC 4J8VD 3AZGD 3MGQD 5KDMA 3MGPA 3AZHC 1M18D 3AZHA 5FUGB 2RVQD 1BH8B 5BT1D 3AN2D 1S32D 4WU9D 3AZFB 4J8WC 4LD9C 3LZ1B 5AV6D 4J8WA 4LD9A 5JRGB 3AZID 1P3PB 1EQZB 1JFIA 2NQBB 1P3LD 3X1SC 3X1TD 1M1AD 3X1SA 3W96C 5AVBD 1KX4D 3X1UD 3W96A 4HGAB 5C3IC 2YFVB 5GT3B 5B0YB 2YFWB 4H9RA 4KGCC 2Y2JA 3AZND 5DNMD 4KGCA 1TAFA 5BNXB 4NE6A 2FJ7D 4X23C 3B0BA 5GXQD 4X23A 4H9NB 5B24D 5CPKB 5B32G 2ZY4A 1F66C 3NQJA 5F99D 1F66A 1P3FD 4G91C 2ZM5A 3B6GB 1Q9CA 3R45B 1KX5C 5KDMB 1KX5A 3REID 2Y2IA 3AZHB 5CPID 4J8UD 5B31D 5B1MC 3O62C 4LD9B 1ID3C 3RELB 5B1MA 1JFIB 3H0MC 3O62A 1ID3A 1KX3D 3V9RA 3UTAD 1P3ID 3EPKA 4WV4B 5AV8D 3X1SB 4CSRA 4Z66C 3VH6T 3TU4C 3W96B 4Z66A 3TU4A 2BG1A 3VH6A 2F8NA 3AYWC 1P3OC 3C1BC 4CAYA 4H9PB 3AYWA 1P3OA 4KGCB 5B2JC 2XD5A 3LZ1D 3C1BA 1TAFB 2F8NH 3REHB 3UTBB 5B2JA 5JRGD 1EQZD 3WKJC 1AOIC 3KUYC 2NQBD 3A6NB 3WKJA 1AOIA 3KUYA 2ZY2A 4WNNA 3NQJB 1F66B 4Z2MG 4G91B 5GSUC 4R8PC 5AV5C 2DF4C 1P34C 1BH9A 3WAAC 4NE5A 5GSUA 1KU5A 3AZMC 5AV5A 4R8PA 1KX5B 1U35B 1P34A 3WAAA 3AZMA 3WA9C 4ZUXC 4Z2MH 3WA9A 1P3AB 1WWIA 2AROC 4ZUXA 1P3KA 2AROA 5B1MB 3VH5A 4XUJC 3O62B 1ID3B 3V9RB 1ZLAC 4XUJA 5CPJC 4ZBJC 4CSRB 5B33C 3B6GD 5CPJA 3F6TA 5B33A 4Z66B 5CP6C 1BFMA 2F8NB 4YM6C 3AZHD 5CP6A 4CAYB 4YS3B 4E45A 4YM6A 1P3OB 1T3UA 3C1BB 3W99C 4LD9D 5B2JB 3RELD 1P3BC 1TZYC 3W99A 4G92C 5BNVA 4DRBA 1P3GC 3LZ0B 1P3BA 1TZYA 3WKJB 1AOIB 2G5HC 3KUYB 3REKC 4WNNB 1P3GA 3FDDA 3X1SD 3KXBC 3AFAC 4H9OB 3REKA 3NQUB 3KXBA 3H0RC 3AFAA 4E44A 3W96D 4J8VA 4M6BA 2BYMB 5GSUB 5AV5B 4WU8C 3B6FD 1P34B 2RVQC 5BT1C 3AZMB 4KGCD 4WU8A 4KHAA 3EPJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NE3 A;  3REH D;  2NZD C;  3UTB D;  2HIO B;  2NZD A;  3A6N D;  4ZUX B;  2CWE A;  2ARO B;  1R4V A;  4WZS B;  4XUJ B;  1F66 D;  1ZLA B;  4ZBJ B;  4XZQ B;  1N1J A;  5B33 B;  3WTP B;  5B32 C;  3AV2 C;  3W98 C;  3AZK C;  1M19 D;  4H9Q A;  3AV2 A;  1U35 D;  5B32 A;  3W98 A;  3MGP B;  3KWQ C;  3AZK A;  1HTA A;  3KWQ A;  5BO0 A;  1H3O A;  1P3A D;  4DRA A;  3W99 B;  5B1M D;  3O62 D;  4J8W B;  1ID3 D;  1P3B B;  4G92 B;  1P3G B;  5B2I D;  3AZL D;  2BYK A;  1P3F C;  3REK B;  3AZJ C;  3MNN C;  3KXB B;  3AFA B;  1P3F A;  3VH6 W;  3AZJ A;  3MNN A;  2F8N D;  1WWS A;  3X1V C;  5B31 G;  5C3I B;  4YS3 D;  4H9R B;  3X1V A;  4WU8 B;  4KHA B;  3C1B D;  2L5A A;  5DNN C;  5B31 C;  3AZF D;  1HQ3 C;  5B2J D;  5DNN A;  5B31 A;  2NZD B;  1HQ3 A;  3LZ0 D;  1P3P D;  1KX3 C;  3WKJ D;  1AOI D;  3KUY D;  1KX3 A;  4X23 B;  5B0Z C;  2CV5 C;  4QLC C;  4J8X C;  4KUD C;  5E5A C;  5B0Z A;  1A7W A;  3UT9 C;  2CV5 A;  1F1E A;  4QLC A;  4J8X A;  4KUD A;  5E5A A;  1N1J B;  2F8N K;  3UT9 A;  5GT3 D;  5GSU D;  5AV5 D;  3AV2 B;  5B32 B;  5B0Y D;  1P34 D;  3W98 B;  4UUZ A;  3AZM D;  3AZK B;  2PYO C;  3C1C C;  3KWQ B;  2PYO A;  3C1C A;  5BO0 B;  3REJ C;  2HIO D;  1H3O B;  4ZUX D;  3MGS C;  1P3K C;  3REJ A;  3VH5 T;  1P3M C;  2ARO D;  5B40 C;  3MGS A;  1P3M A;  5B40 A;  4XUJ D;  5CPK D;  1B6W A;  5AV9 C;  3LJA C;  1ZLA D;  1ULY A;  5AV9 A;  3LJA A;  5CHL B;  4XZQ D;  3WTP D;  3AZJ B;  4Z5T C;  3MNN B;  4JJN C;  4Z5T A;  5AVC C;  3MVD C;  3MGP D;  3TU4 B;  4JJN A;  3MGR C;  3AV1 C;  5AVC A;  3MVD A;  3X1V B;  3MGR A;  3AYW B;  3AV1 A;  5B1L C;  3KSY A;  5AY8 C;  3W99 D;  5DNN B;  4J8W D;  1HQ3 B;  5B1L A;  1P3B D;  5AY8 A;  1P3G D;  3AZE C;  3REK D;  3AZE A;  3LEL C;  3AFA D;  3KXB D;  5B0Z B;  2CV5 B;  4QLC B;  3LEL A;  4J8X B;  4KUD B;  3B0C T;  3R45 A;  5E5A B;  5GT0 C;  4J8V C;  3W97 C;  3UT9 B;  3AZG C;  3MGQ C;  3W97 A;  5GT0 A;  3WTP E;  1BH9 B;  4UUZ B;  3AZG A;  5BS7 C;  3MGQ A;  4R8P B;  4WU8 D;  1M18 C;  5BS7 A;  3WAA B;  3AN2 C;  2PYO B;  3C1C B;  4WU9 C;  1S32 C;  1M18 A;  3REL C;  3AN2 A;  2NZD D;  1S32 A;  4WU9 A;  5AV6 C;  3REJ B;  3WA9 B;  3REL A;  3AZI C;  3MGS B;  1P3K B;  5AV6 A;  4X23 D;  1P3M B;  3AZI A;  1P3L C;  5B40 B;  3X1T C;  1P3L A;  1M1A C;  5AV9 B;  3LJA B;  5AVB C;  3X1T A;  1M1A A;  3X1U C;  1KX4 C;  5CPJ B;  5AVB A;  3AV2 D;  1KX4 A;  5B32 D;  3X1U A;  3B6F C;  3W98 D;  4Z5T B;  3AZK D;  1KX5 D;  4JJN B;  3B6F A;  3B0D C;  5AVC B;  1B67 A;  4H9P A;  4EO5 C;  3MVD B;  5CP6 B;  3KWQ D;  5DNM C;  3MGR B;  3REH C;  3UTB C;  3AZN C;  3AV1 B;  4YM6 B;  3REH A;  3AZN A;  5DNM A;  3UTB A;  3A6N C;  2FJ7 C;  5B1L B;  5G49 A;  5AY8 B;  3A6N A;  2FJ7 A;  5BNV B;  5GXQ C;  5B24 C;  1TZY B;  5GXQ A;  5F99 C;  2IO5 C;  5B24 A;  3AZE B;  4AWL C;  5F99 A;  3AZJ D;  3LEL B;  3MNN D;  1M19 C;  1U35 C;  4Z66 D;  5GT0 B;  3TU4 D;  3W97 B;  4J8V B;  1M19 A;  1U35 A;  3AZG B;  3MGQ B;  3X1V D;  3REI C;  5CPI C;  3AYW D;  1P3O D;  1P3A C;  3REI A;  1M18 B;  5CPI A;  5DNN D;  4J8U C;  3AN2 B;  1S32 B;  5JA4 A;  4WU9 B;  1HQ3 D;  1P3A A;  4J8U A;  5B2I C;  5AV6 B;  2HUE C;  3AZL C;  3AZI B;  3UTA C;  1P3I C;  5B2I A;  3AZL A;  2F8N G;  5B0Z D;  1P3L B;  5AV8 C;  3UTA A;  2CV5 D;  1P3I A;  4QLC D;  4J8X D;  4KUD D;  5E5A D;  3X1T B;  1M1A B;  5AV8 A;  3UT9 D;  5AVB B;  1KX4 B;  3X1U B;  4YS3 C;  4R8P D;  4H9Q B;  3B6F B;  3WAA D;  2PYO D;  3C1C D;  4YS3 A;  3AZF C;  5FUG A;  1BH8 A;  3LZ1 C;  3B0D B;  4EO5 B;  2LY8 A;  3AZF A;  3AZN B;  5DNM B;  3REJ D;  3LZ0 C;  3WA9 D;  5JRG C;  3LZ1 A;  1P3P C;  1EQZ C;  3VH5 W;  3MGS D;  5G49 B;  2JSS A;  1P3K D;  2NQB C;  3LZ0 A;  2FJ7 B;  5JRG A;  1P3M D;  1P3P A;  5B40 D;  1EQZ A;  2NQB A;  5GXQ B;  4H9O A;  5B24 B;  5AV9 D;  3LJA D;  2BYK B;  3NQU A;  5F99 B;  2IO5 B;  4HGA C;  5CPJ D;  5GT3 C;  4AWL B;  1P3F B;  5B33 D;  5B0Y C;  2BYM A;  4Z5T D;  5GT3 A;  2YFV A;  4JJN D;  1M19 B;  5B0Y A;  2YFW A;  5AVC D;  3MVD D;  5CP6 D;  3MGR D;  3AV1 D;  2HIO C;  4YM6 D;  3REI B;  5CPI B;  2HIO A;  5JA4 B;  4H9S C;  5B1L D;  5BNX A;  5AY8 D;  4J8U B;  5B31 B;  4H9S A;  5CPK C;  1TZY D;  4H9N A;  3AZE D;  4NFT A;  5B2I B;  2HUE B;  3AZL B;  5CPK A;  1KX3 B;  4XZQ C;  1ZLA A;  3UTA B;  3WTP C;  1P3I B;  3B6G C;  3LEL D;  4XZQ A;  3B0C W;  5AV8 B;  3WTP A;  3B6G A;  5GT0 D;  3W97 D;  3MGP C;  4J8V D;  3AZG D;  3MGQ D;  5KDM A;  3MGP A;  3AZH C;  1M18 D;  3AZH A;  5FUG B;  2RVQ D;  1BH8 B;  5BT1 D;  3AN2 D;  1S32 D;  4WU9 D;  3AZF B;  4J8W C;  4LD9 C;  3LZ1 B;  5AV6 D;  4J8W A;  4LD9 A;  5JRG B;  3AZI D;  1P3P B;  1EQZ B;  1JFI A;  2NQB B;  1P3L D;  3X1S C;  3X1T D;  1M1A D;  3X1S A;  3W96 C;  5AVB D;  1KX4 D;  3X1U D;  3W96 A;  4HGA B;  5C3I C;  2YFV B;  5GT3 B;  5B0Y B;  2YFW B;  4H9R A;  4KGC C;  3AZN D;  5DNM D;  4KGC A;  1TAF A;  5BNX B;  4NE6 A;  2FJ7 D;  4X23 C;  3B0B A;  5GXQ D;  4X23 A;  4H9N B;  5B24 D;  5CPK B;  5B32 G;  1F66 C;  3NQJ A;  5F99 D;  1F66 A;  1P3F D;  4G91 C;  3B6G B;  1Q9C A;  3R45 B;  1KX5 C;  5KDM B;  1KX5 A;  3REI D;  3AZH B;  5CPI D;  4J8U D;  5B31 D;  5B1M C;  3O62 C;  4LD9 B;  1ID3 C;  3REL B;  5B1M A;  1JFI B;  3O62 A;  1ID3 A;  1KX3 D;  3V9R A;  3UTA D;  1P3I D;  4WV4 B;  5AV8 D;  3X1S B;  4CSR A;  4Z66 C;  3VH6 T;  3TU4 C;  3W96 B;  4Z66 A;  3TU4 A;  3VH6 A;  2F8N A;  3AYW C;  1P3O C;  3C1B C;  4CAY A;  4H9P B;  3AYW A;  1P3O A;  4KGC B;  5B2J C;  3C1B A;  3LZ1 D;  2F8N H;  1TAF B;  3REH B;  3UTB B;  5B2J A;  5JRG D;  1EQZ D;  3WKJ C;  1AOI C;  3KUY C;  2NQB D;  3A6N B;  3WKJ A;  1AOI A;  3KUY A;  4WNN A;  3NQJ B;  1F66 B;  4Z2M G;  4G91 B;  5GSU C;  4R8P C;  5AV5 C;  1P34 C;  1BH9 A;  3WAA C;  4NE5 A;  5GSU A;  1KU5 A;  3AZM C;  5AV5 A;  4R8P A;  1KX5 B;  1U35 B;  1P34 A;  3WAA A;  3AZM A;  3WA9 C;  4ZUX C;  4Z2M H;  3WA9 A;  1P3A B;  1WWI A;  2ARO C;  4ZUX A;  1P3K A;  2ARO A;  5B1M B;  3VH5 A;  4XUJ C;  3O62 B;  1ID3 B;  3V9R B;  1ZLA C;  4XUJ A;  5CPJ C;  4ZBJ C;  4CSR B;  5B33 C;  3B6G D;  5CPJ A;  5B33 A;  4Z66 B;  5CP6 C;  1BFM A;  2F8N B;  4YM6 C;  3AZH D;  5CP6 A;  4CAY B;  4YS3 B;  4E45 A;  4YM6 A;  1P3O B;  3C1B B;  3W99 C;  4LD9 D;  5B2J B;  3REL D;  1P3B C;  1TZY C;  3W99 A;  4G92 C;  5BNV A;  4DRB A;  1P3G C;  3LZ0 B;  1P3B A;  1TZY A;  3WKJ B;  1AOI B;  3KUY B;  3REK C;  1P3G A;  4WNN B;  3X1S D;  3KXB C;  3AFA C;  4H9O B;  3REK A;  3NQU B;  3KXB A;  3AFA A;  4E44 A;  3W96 D;  4J8V A;  4M6B A;  2BYM B;  5GSU B;  5AV5 B;  4WU8 C;  3B6F D;  1P34 B;  2RVQ C;  5BT1 C;  3AZM B;  4KGC D;  4WU8 A;  4KHA A; 
#chains in the Genus database with same CATH topology
 4NE3 A;  3REH D;  2NZD C;  3UTB D;  2HIO B;  2NZD A;  3A6N D;  4ZUX B;  2CWE A;  2ARO B;  3IP4 C;  1R4V A;  4WZS B;  4XUJ B;  1F66 D;  2Y2H A;  1ZLA B;  2F2A C;  4ZBJ B;  4XZQ B;  1N1J A;  5B33 B;  3WTP B;  5B32 C;  3AV2 C;  3W98 C;  3EPH A;  3AZK C;  1M19 D;  4H9Q A;  3AV2 A;  1U35 D;  2UWX A;  5B32 A;  3W98 A;  3MGP B;  3KWQ C;  3AZK A;  1HTA A;  3KWQ A;  2DQN C;  5BO0 A;  1H3O A;  1P3A D;  4DRA A;  3W99 B;  5B1M D;  3O62 D;  4J8W B;  1ID3 D;  1P3B B;  4G92 B;  1P3G B;  2ZY5 A;  5B2I D;  3AZL D;  2BYK A;  1P3F C;  3REK B;  2Y2O A;  3AZJ C;  3MNN C;  3KXB B;  3AFA B;  1P3F A;  3VH6 W;  1Z2C B;  3AZJ A;  3MNN A;  2F8N D;  1WWS A;  3X1V C;  5B31 G;  5C3I B;  4YS3 D;  4H9R B;  3X1V A;  4WU8 B;  4KHA B;  3C1B D;  2L5A A;  5DNN C;  5B31 C;  3AZF D;  2FFF B;  1HQ3 C;  3EG5 B;  5B2J D;  5DNN A;  5B31 A;  2NZD B;  2Y2M A;  1HQ3 A;  3LZ0 D;  1P3P D;  1KX3 C;  3WKJ D;  1AOI D;  3KUY D;  1KX3 A;  4X23 B;  5B0Z C;  2CV5 C;  4QLC C;  4J8X C;  4KUD C;  5E5A C;  5B0Z A;  1A7W A;  3UT9 C;  2CV5 A;  2VQR A;  1F1E A;  4QLC A;  4J8X A;  4KUD A;  5E5A A;  1N1J B;  2F8N K;  3UT9 A;  5GT3 D;  5GSU D;  5AV5 D;  3AV2 B;  5B32 B;  5B0Y D;  1P34 D;  3W98 B;  4UUZ A;  3AZM D;  3AZK B;  3EPL A;  3C1C C;  2PYO C;  3KWQ B;  2PYO A;  3C1C A;  5BO0 B;  3REJ C;  2HIO D;  1H3O B;  4ZUX D;  3MGS C;  1P3K C;  3A1K A;  3REJ A;  3VH5 T;  1P3M C;  2ARO D;  5B40 C;  3MGS A;  1P3M A;  5B40 A;  4XUJ D;  5CPK D;  1B6W A;  5AV9 C;  3LJA C;  1ZLA D;  1ULY A;  5AV9 A;  3LJA A;  5CHL B;  4XZQ D;  3WTP D;  3AZJ B;  2ZY3 A;  4Z5T C;  3MNN B;  4JJN C;  2XD1 A;  2Y2P A;  4Z5T A;  5AVC C;  3MVD C;  3MGP D;  3TU4 B;  4JJN A;  3MGR C;  3AV1 C;  5AVC A;  3MVD A;  3X1V B;  3MGR A;  3AYW B;  3AV1 A;  2Y2G A;  3KSY A;  5B1L C;  5AY8 C;  3W99 D;  5DNN B;  2Y2L A;  4J8W D;  1HQ3 B;  5B1L A;  1P3B D;  5AY8 A;  1P3G D;  3AZE C;  3REK D;  3AZE A;  3KFU G;  3LEL C;  3AFA D;  3KXB D;  5B0Z B;  2CV5 B;  4QLC B;  3LEL A;  4J8X B;  4KUD B;  3B0C T;  3R45 A;  5E5A B;  5GT0 C;  4J8V C;  3W97 C;  3UT9 B;  3AZG C;  3MGQ C;  2W8S A;  3W97 A;  5GT0 A;  3WTP E;  1BH9 B;  4UUZ B;  3AZG A;  5BS7 C;  3MGQ A;  4R8P B;  4WU8 D;  1M18 C;  5BS7 A;  3WAA B;  3AN2 C;  2PYO B;  3C1C B;  4WU9 C;  1S32 C;  1M18 A;  3REL C;  2J8P A;  3AN2 A;  2NZD D;  1S32 A;  4WU9 A;  5AV6 C;  2JCH A;  3REJ B;  3WA9 B;  3REL A;  3AZI C;  3MGS B;  1P3K B;  5AV6 A;  3P5J B;  4X23 D;  3AZI A;  1P3M B;  5B40 B;  1P3L C;  3X1T C;  1P3L A;  1M1A C;  5AV9 B;  3LJA B;  5AVB C;  3X1T A;  3A1I A;  3X1U C;  1M1A A;  1KX4 C;  5CPJ B;  5AVB A;  3AV2 D;  1KX4 A;  5B32 D;  3X1U A;  3B6F C;  3W98 D;  4Z5T B;  3AZK D;  1KX5 D;  2NQB C;  4JJN B;  3B6F A;  3B0D C;  5AVC B;  1B67 A;  4H9P A;  4EO5 C;  3MVD B;  5CP6 B;  3KWQ D;  5DNM C;  3MGR B;  3REH C;  3UTB C;  3AZN C;  3AV1 B;  4YM6 B;  3REH A;  3AZN A;  5DNM A;  3UTB A;  3A6N C;  2FJ7 C;  2Y2K A;  5B1L B;  5G49 A;  5AY8 B;  3A6N A;  2FJ7 A;  5BNV B;  5GXQ C;  5B24 C;  1TZY B;  5GXQ A;  5F99 C;  2IO5 C;  5B24 A;  3AZE B;  4WJ3 C;  4AWL C;  5F99 A;  2G5I C;  3AZJ D;  3LEL B;  3MNN D;  2Y2N A;  1M19 C;  1U35 C;  4Z66 D;  5GT0 B;  3TU4 D;  3W97 B;  4J8V B;  1M19 A;  1U35 A;  3AZG B;  3MGQ B;  3X1V D;  3REI C;  5CPI C;  3H0L C;  3AYW D;  1P3O D;  1P3A C;  3REI A;  1M18 B;  5CPI A;  5DNN D;  4J8U C;  3AN2 B;  1PZR A;  1S32 B;  5JA4 A;  4WU9 B;  1HQ3 D;  4DQY B;  1P3A A;  4J8U A;  4UPK A;  5B2I C;  5AV6 B;  2HUE C;  3AZL C;  3AZI B;  3UTA C;  1P3I C;  5B2I A;  3AZL A;  2F8N G;  5B0Z D;  1P3L B;  5AV8 C;  3UTA A;  2CV5 D;  1P3I A;  4QLC D;  4J8X D;  4KUD D;  5E5A D;  3X1T B;  1M1A B;  5AV8 A;  3UT9 D;  5AVB B;  1KX4 B;  3X1U B;  3AL0 C;  4YS3 C;  4R8P D;  4H9Q B;  3B6F B;  3WAA D;  2PYO D;  3C1C D;  4YS3 A;  3AZF C;  5FUG A;  1BH8 A;  3LZ1 C;  3B0D B;  4EO5 B;  2LY8 A;  3AZF A;  3AZN B;  5DNM B;  3REJ D;  3LZ0 C;  3WA9 D;  5JRG C;  3LZ1 A;  1P3P C;  1EQZ C;  3VH5 W;  3MGS D;  2JE5 A;  2JSS A;  2Y2Q A;  5G49 B;  3LZ0 A;  1P3K D;  2FJ7 B;  5JRG A;  1P3M D;  1P3P A;  5B40 D;  1EQZ A;  2NQB A;  5GXQ B;  4H9O A;  5B24 B;  5AV9 D;  3LJA D;  2BYK B;  3NQU A;  5F99 B;  2IO5 B;  4HGA C;  5CPJ D;  5GT3 C;  4AWL B;  1P3F B;  5B33 D;  5B0Y C;  2BYM A;  4Z5T D;  5GT3 A;  2YFV A;  4JJN D;  1M19 B;  5B0Y A;  2YFW A;  5AVC D;  3MVD D;  1W2E A;  5CP6 D;  3MGR D;  3AV1 D;  2RIQ A;  2HIO C;  4YM6 D;  3REI B;  5CPI B;  2HIO A;  5JA4 B;  4H9S C;  5B1L D;  5BNX A;  5AY8 D;  4J8U B;  5B31 B;  4H9S A;  5CPK C;  1TZY D;  4H9N A;  3AZE D;  4NFT A;  5B2I B;  2HUE B;  3AZL B;  5CPK A;  1KX3 B;  4XZQ C;  1ZLA A;  3UTA B;  3WTP C;  1P3I B;  3B6G C;  3LEL D;  4XZQ A;  3B0C W;  5AV8 B;  3WTP A;  3B6G A;  5GT0 D;  3W97 D;  3MGP C;  4J8V D;  3AZG D;  3MGQ D;  5KDM A;  3MGP A;  3AZH C;  1M18 D;  3AZH A;  5FUG B;  2RVQ D;  1BH8 B;  5BT1 D;  3AN2 D;  1S32 D;  4WU9 D;  3AZF B;  4J8W C;  4LD9 C;  3LZ1 B;  5AV6 D;  4J8W A;  4LD9 A;  5JRG B;  3AZI D;  1P3P B;  1EQZ B;  1JFI A;  2NQB B;  1P3L D;  3X1S C;  3X1T D;  1M1A D;  3X1S A;  3W96 C;  5AVB D;  1KX4 D;  3X1U D;  3W96 A;  4HGA B;  5C3I C;  2YFV B;  5GT3 B;  5B0Y B;  2YFW B;  4H9R A;  4KGC C;  2Y2J A;  3AZN D;  5DNM D;  4KGC A;  1TAF A;  5BNX B;  4NE6 A;  2FJ7 D;  4X23 C;  3B0B A;  5GXQ D;  4X23 A;  4H9N B;  5B24 D;  5CPK B;  5B32 G;  2ZY4 A;  1F66 C;  3NQJ A;  5F99 D;  1F66 A;  1P3F D;  4G91 C;  2ZM5 A;  3B6G B;  1Q9C A;  3R45 B;  1KX5 C;  5KDM B;  1KX5 A;  3REI D;  2Y2I A;  3AZH B;  5CPI D;  4J8U D;  5B31 D;  5B1M C;  3O62 C;  4LD9 B;  1ID3 C;  3REL B;  5B1M A;  1JFI B;  3H0M C;  3O62 A;  1ID3 A;  1KX3 D;  3V9R A;  3UTA D;  1P3I D;  3EPK A;  4WV4 B;  5AV8 D;  3X1S B;  4CSR A;  4Z66 C;  3VH6 T;  3TU4 C;  3W96 B;  4Z66 A;  3TU4 A;  2BG1 A;  3VH6 A;  2F8N A;  3AYW C;  1P3O C;  3C1B C;  4CAY A;  4H9P B;  3AYW A;  1P3O A;  4KGC B;  5B2J C;  2XD5 A;  3LZ1 D;  3C1B A;  1TAF B;  2F8N H;  3REH B;  3UTB B;  5B2J A;  5JRG D;  1EQZ D;  3WKJ C;  1AOI C;  3KUY C;  2NQB D;  3A6N B;  3WKJ A;  1AOI A;  3KUY A;  2ZY2 A;  4WNN A;  3NQJ B;  1F66 B;  4Z2M G;  4G91 B;  5GSU C;  4R8P C;  5AV5 C;  2DF4 C;  1P34 C;  1BH9 A;  3WAA C;  4NE5 A;  5GSU A;  1KU5 A;  3AZM C;  5AV5 A;  4R8P A;  1KX5 B;  1U35 B;  1P34 A;  3WAA A;  3AZM A;  3WA9 C;  4ZUX C;  4Z2M H;  3WA9 A;  1P3A B;  1WWI A;  2ARO C;  4ZUX A;  1P3K A;  2ARO A;  5B1M B;  3VH5 A;  4XUJ C;  3O62 B;  1ID3 B;  3V9R B;  1ZLA C;  4XUJ A;  5CPJ C;  4ZBJ C;  4CSR B;  5B33 C;  3B6G D;  5CPJ A;  3F6T A;  5B33 A;  4Z66 B;  5CP6 C;  1BFM A;  2F8N B;  4YM6 C;  3AZH D;  5CP6 A;  4CAY B;  4YS3 B;  4E45 A;  4YM6 A;  1P3O B;  1T3U A;  3C1B B;  3W99 C;  4LD9 D;  5B2J B;  3REL D;  1P3B C;  1TZY C;  3W99 A;  4G92 C;  5BNV A;  4DRB A;  1P3G C;  3LZ0 B;  1P3B A;  1TZY A;  3WKJ B;  1AOI B;  2G5H C;  3KUY B;  3REK C;  4WNN B;  1P3G A;  3FDD A;  3X1S D;  3KXB C;  3AFA C;  4H9O B;  3REK A;  3NQU B;  3KXB A;  3H0R C;  3AFA A;  4E44 A;  3W96 D;  4J8V A;  4M6B A;  2BYM B;  5GSU B;  5AV5 B;  4WU8 C;  3B6F D;  1P34 B;  2RVQ C;  5BT1 C;  3AZM B;  4KGC D;  4WU8 A;  4KHA A;  3EPJ A; 
#chains in the Genus database with same CATH homology
 4NE3 A;  3REH D;  2NZD C;  3UTB D;  2HIO B;  2NZD A;  3A6N D;  4ZUX B;  2CWE A;  2ARO B;  3IP4 C;  1R4V A;  4WZS B;  4XUJ B;  1F66 D;  2Y2H A;  1ZLA B;  2F2A C;  4ZBJ B;  4XZQ B;  1N1J A;  5B33 B;  3WTP B;  5B32 C;  3AV2 C;  3W98 C;  3EPH A;  3AZK C;  1M19 D;  4H9Q A;  3AV2 A;  1U35 D;  2UWX A;  5B32 A;  3W98 A;  3MGP B;  3KWQ C;  3AZK A;  1HTA A;  3KWQ A;  2DQN C;  5BO0 A;  1H3O A;  1P3A D;  4DRA A;  3W99 B;  5B1M D;  3O62 D;  4J8W B;  1ID3 D;  1P3B B;  4G92 B;  1P3G B;  2ZY5 A;  5B2I D;  3AZL D;  2BYK A;  1P3F C;  3REK B;  2Y2O A;  3AZJ C;  3MNN C;  3KXB B;  3AFA B;  1P3F A;  3VH6 W;  1Z2C B;  3AZJ A;  3MNN A;  2F8N D;  1WWS A;  3X1V C;  5B31 G;  5C3I B;  4YS3 D;  4H9R B;  3X1V A;  4WU8 B;  4KHA B;  3C1B D;  2L5A A;  5DNN C;  5B31 C;  3AZF D;  2FFF B;  1HQ3 C;  3EG5 B;  5B2J D;  5DNN A;  5B31 A;  2NZD B;  2Y2M A;  1HQ3 A;  3LZ0 D;  1P3P D;  1KX3 C;  3WKJ D;  1AOI D;  3KUY D;  1KX3 A;  4X23 B;  5B0Z C;  2CV5 C;  4QLC C;  4J8X C;  4KUD C;  5E5A C;  5B0Z A;  1A7W A;  3UT9 C;  2CV5 A;  2VQR A;  1F1E A;  4QLC A;  4J8X A;  4KUD A;  5E5A A;  1N1J B;  2F8N K;  3UT9 A;  5GT3 D;  5GSU D;  5AV5 D;  3AV2 B;  5B32 B;  5B0Y D;  1P34 D;  3W98 B;  4UUZ A;  3AZM D;  3AZK B;  3EPL A;  3C1C C;  2PYO C;  3KWQ B;  2PYO A;  3C1C A;  5BO0 B;  3REJ C;  2HIO D;  1H3O B;  4ZUX D;  3MGS C;  1P3K C;  3A1K A;  3REJ A;  3VH5 T;  1P3M C;  2ARO D;  5B40 C;  3MGS A;  1P3M A;  5B40 A;  4XUJ D;  5CPK D;  1B6W A;  5AV9 C;  3LJA C;  1ZLA D;  1ULY A;  5AV9 A;  3LJA A;  5CHL B;  4XZQ D;  3WTP D;  3AZJ B;  2ZY3 A;  4Z5T C;  3MNN B;  4JJN C;  2XD1 A;  2Y2P A;  4Z5T A;  5AVC C;  3MVD C;  3MGP D;  3TU4 B;  4JJN A;  3MGR C;  3AV1 C;  5AVC A;  3MVD A;  3X1V B;  3MGR A;  3AYW B;  3AV1 A;  2Y2G A;  3KSY A;  5B1L C;  5AY8 C;  3W99 D;  5DNN B;  2Y2L A;  4J8W D;  1HQ3 B;  5B1L A;  1P3B D;  5AY8 A;  1P3G D;  3AZE C;  3REK D;  3AZE A;  3KFU G;  3LEL C;  3AFA D;  3KXB D;  5B0Z B;  2CV5 B;  4QLC B;  3LEL A;  4J8X B;  4KUD B;  3B0C T;  3R45 A;  5E5A B;  5GT0 C;  4J8V C;  3W97 C;  3UT9 B;  3AZG C;  3MGQ C;  2W8S A;  3W97 A;  5GT0 A;  3WTP E;  1BH9 B;  4UUZ B;  3AZG A;  5BS7 C;  3MGQ A;  4R8P B;  4WU8 D;  1M18 C;  5BS7 A;  3WAA B;  3AN2 C;  2PYO B;  3C1C B;  4WU9 C;  1S32 C;  1M18 A;  3REL C;  2J8P A;  3AN2 A;  2NZD D;  1S32 A;  4WU9 A;  5AV6 C;  2JCH A;  3REJ B;  3WA9 B;  3REL A;  3AZI C;  3MGS B;  1P3K B;  5AV6 A;  3P5J B;  4X23 D;  3AZI A;  1P3M B;  5B40 B;  1P3L C;  3X1T C;  1P3L A;  1M1A C;  5AV9 B;  3LJA B;  5AVB C;  3X1T A;  3A1I A;  3X1U C;  1M1A A;  1KX4 C;  5CPJ B;  5AVB A;  3AV2 D;  1KX4 A;  5B32 D;  3X1U A;  3B6F C;  3W98 D;  4Z5T B;  3AZK D;  1KX5 D;  2NQB C;  4JJN B;  3B6F A;  3B0D C;  5AVC B;  1B67 A;  4H9P A;  4EO5 C;  3MVD B;  5CP6 B;  3KWQ D;  5DNM C;  3MGR B;  3REH C;  3UTB C;  3AZN C;  3AV1 B;  4YM6 B;  3REH A;  3AZN A;  5DNM A;  3UTB A;  3A6N C;  2FJ7 C;  2Y2K A;  5B1L B;  5G49 A;  5AY8 B;  3A6N A;  2FJ7 A;  5BNV B;  5GXQ C;  5B24 C;  1TZY B;  5GXQ A;  5F99 C;  2IO5 C;  5B24 A;  3AZE B;  4WJ3 C;  4AWL C;  5F99 A;  2G5I C;  3AZJ D;  3LEL B;  3MNN D;  2Y2N A;  1M19 C;  1U35 C;  4Z66 D;  5GT0 B;  3TU4 D;  3W97 B;  4J8V B;  1M19 A;  1U35 A;  3AZG B;  3MGQ B;  3X1V D;  3REI C;  5CPI C;  3H0L C;  3AYW D;  1P3O D;  1P3A C;  3REI A;  1M18 B;  5CPI A;  5DNN D;  4J8U C;  3AN2 B;  1PZR A;  1S32 B;  5JA4 A;  4WU9 B;  1HQ3 D;  4DQY B;  1P3A A;  4J8U A;  4UPK A;  5B2I C;  5AV6 B;  2HUE C;  3AZL C;  3AZI B;  3UTA C;  1P3I C;  5B2I A;  3AZL A;  2F8N G;  5B0Z D;  1P3L B;  5AV8 C;  3UTA A;  2CV5 D;  1P3I A;  4QLC D;  4J8X D;  4KUD D;  5E5A D;  3X1T B;  1M1A B;  5AV8 A;  3UT9 D;  5AVB B;  1KX4 B;  3X1U B;  3AL0 C;  4YS3 C;  4R8P D;  4H9Q B;  3B6F B;  3WAA D;  2PYO D;  3C1C D;  4YS3 A;  3AZF C;  5FUG A;  1BH8 A;  3LZ1 C;  3B0D B;  4EO5 B;  2LY8 A;  3AZF A;  3AZN B;  5DNM B;  3REJ D;  3LZ0 C;  3WA9 D;  5JRG C;  3LZ1 A;  1P3P C;  1EQZ C;  3VH5 W;  3MGS D;  2JE5 A;  2JSS A;  2Y2Q A;  5G49 B;  3LZ0 A;  1P3K D;  2FJ7 B;  5JRG A;  1P3M D;  1P3P A;  5B40 D;  1EQZ A;  2NQB A;  5GXQ B;  4H9O A;  5B24 B;  5AV9 D;  3LJA D;  2BYK B;  3NQU A;  5F99 B;  2IO5 B;  4HGA C;  5CPJ D;  5GT3 C;  4AWL B;  1P3F B;  5B33 D;  5B0Y C;  2BYM A;  4Z5T D;  5GT3 A;  2YFV A;  4JJN D;  1M19 B;  5B0Y A;  2YFW A;  5AVC D;  3MVD D;  1W2E A;  5CP6 D;  3MGR D;  3AV1 D;  2RIQ A;  2HIO C;  4YM6 D;  3REI B;  5CPI B;  2HIO A;  5JA4 B;  4H9S C;  5B1L D;  5BNX A;  5AY8 D;  4J8U B;  5B31 B;  4H9S A;  5CPK C;  1TZY D;  4H9N A;  3AZE D;  4NFT A;  5B2I B;  2HUE B;  3AZL B;  5CPK A;  1KX3 B;  4XZQ C;  1ZLA A;  3UTA B;  3WTP C;  1P3I B;  3B6G C;  3LEL D;  4XZQ A;  3B0C W;  5AV8 B;  3WTP A;  3B6G A;  5GT0 D;  3W97 D;  3MGP C;  4J8V D;  3AZG D;  3MGQ D;  5KDM A;  3MGP A;  3AZH C;  1M18 D;  3AZH A;  5FUG B;  2RVQ D;  1BH8 B;  5BT1 D;  3AN2 D;  1S32 D;  4WU9 D;  3AZF B;  4J8W C;  4LD9 C;  3LZ1 B;  5AV6 D;  4J8W A;  4LD9 A;  5JRG B;  3AZI D;  1P3P B;  1EQZ B;  1JFI A;  2NQB B;  1P3L D;  3X1S C;  3X1T D;  1M1A D;  3X1S A;  3W96 C;  5AVB D;  1KX4 D;  3X1U D;  3W96 A;  4HGA B;  5C3I C;  2YFV B;  5GT3 B;  5B0Y B;  2YFW B;  4H9R A;  4KGC C;  2Y2J A;  3AZN D;  5DNM D;  4KGC A;  1TAF A;  5BNX B;  4NE6 A;  2FJ7 D;  4X23 C;  3B0B A;  5GXQ D;  4X23 A;  4H9N B;  5B24 D;  5CPK B;  5B32 G;  2ZY4 A;  1F66 C;  3NQJ A;  5F99 D;  1F66 A;  1P3F D;  4G91 C;  2ZM5 A;  3B6G B;  1Q9C A;  3R45 B;  1KX5 C;  5KDM B;  1KX5 A;  3REI D;  2Y2I A;  3AZH B;  5CPI D;  4J8U D;  5B31 D;  5B1M C;  3O62 C;  4LD9 B;  1ID3 C;  3REL B;  5B1M A;  1JFI B;  3H0M C;  3O62 A;  1ID3 A;  1KX3 D;  3V9R A;  3UTA D;  1P3I D;  3EPK A;  4WV4 B;  5AV8 D;  3X1S B;  4CSR A;  4Z66 C;  3VH6 T;  3TU4 C;  3W96 B;  4Z66 A;  3TU4 A;  2BG1 A;  3VH6 A;  2F8N A;  3AYW C;  1P3O C;  3C1B C;  4CAY A;  4H9P B;  3AYW A;  1P3O A;  4KGC B;  5B2J C;  2XD5 A;  3LZ1 D;  3C1B A;  1TAF B;  2F8N H;  3REH B;  3UTB B;  5B2J A;  5JRG D;  1EQZ D;  3WKJ C;  1AOI C;  3KUY C;  2NQB D;  3A6N B;  3WKJ A;  1AOI A;  3KUY A;  2ZY2 A;  4WNN A;  3NQJ B;  1F66 B;  4Z2M G;  4G91 B;  5GSU C;  4R8P C;  5AV5 C;  2DF4 C;  1P34 C;  1BH9 A;  3WAA C;  4NE5 A;  5GSU A;  1KU5 A;  3AZM C;  5AV5 A;  4R8P A;  1KX5 B;  1U35 B;  1P34 A;  3WAA A;  3AZM A;  3WA9 C;  4ZUX C;  4Z2M H;  3WA9 A;  1P3A B;  1WWI A;  2ARO C;  4ZUX A;  1P3K A;  2ARO A;  5B1M B;  3VH5 A;  4XUJ C;  3O62 B;  1ID3 B;  3V9R B;  1ZLA C;  4XUJ A;  5CPJ C;  4ZBJ C;  4CSR B;  5B33 C;  3B6G D;  5CPJ A;  3F6T A;  5B33 A;  4Z66 B;  5CP6 C;  1BFM A;  2F8N B;  4YM6 C;  3AZH D;  5CP6 A;  4CAY B;  4YS3 B;  4E45 A;  4YM6 A;  1P3O B;  1T3U A;  3C1B B;  3W99 C;  4LD9 D;  5B2J B;  3REL D;  1P3B C;  1TZY C;  3W99 A;  4G92 C;  5BNV A;  4DRB A;  1P3G C;  3LZ0 B;  1P3B A;  1TZY A;  3WKJ B;  1AOI B;  2G5H C;  3KUY B;  3REK C;  4WNN B;  1P3G A;  3FDD A;  3X1S D;  3KXB C;  3AFA C;  4H9O B;  3REK A;  3NQU B;  3KXB A;  3H0R C;  3AFA A;  4E44 A;  3W96 D;  4J8V A;  4M6B A;  2BYM B;  5GSU B;  5AV5 B;  4WU8 C;  3B6F D;  1P34 B;  2RVQ C;  5BT1 C;  3AZM B;  4KGC D;  4WU8 A;  4KHA A;  3EPJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...