3LELC

Structural insight into the sequence-dependence of nucleosome positioning
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
104
structure length
104
Chain Sequence
KTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Structural insight into the sequence dependence of nucleosome positioning
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 32
structure length 104
sequence length 104
chains with identical sequence G, M, Q
ec nomenclature
pdb deposition date 2010-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3lelC00
5FUGB 4NE3A 5JRGC 4ZUXB 2NQBA 3WAAB 3KWQC 1BFMA 4CAYA 5AVBB 3KSYA 3UTBD 3W98B 4YM6B 3REHB 5B0YC 1P34B 1M18D 3W99C 3MGSD 2FJ7C 1TZYD 5B1MC 4EO5C 2AROD 1KX4C 5CPIA 4Z66D 3O62A 1P3KB 3W96B 5AV8D 4H9RB 3AZJD 3AZHA 1HQ3D 4DRAA 5B2JD 1P3MC 4J8XC 5E5AD 1S32C 1F66A 5AV6C 5BT1D 3AFAC 5CPKC 3R45B 3AV2D 3AZHB 5DNNC 5B2IC 4XUJA 5F99D 5B0ZB 2YFVA 3AV1C 1P3LD 1ZLAC 2NQBB 3REKD 3AZND 4JJNC 4H9SC 3LJAC 5AVBD 3AN2B 3MNNC 4X23A 3LELD 2PYOC 3REJB 3W98D 3KUYA 3MGQC 1P3IB 4YM6D 5B33B 3REHD 2F8NA 4G92B 4J8UD 3O62B 2NZDC 3UT9C 4ZBJC 1P3KD 1KX4A 5BNXA 1F66B 1A7WA 5B31C 3A6NC 3WA9A 3WTPD 1KX5C 4YS3B 4XUJB 3TU4B 3VH6A 2YFVB 5GT3A 3AZGD 4QLCA 1P3OC 3UTBA 3WTPE 4AWLC 2NQBD 5GXQB 3MGRC 1U35C 4X23B 1P3AC 3KUYB 4HGAC 1TZYA 5B1LC 2HUEB 4ZUXC 5AV9D 3WAAC 4J8VB 3B6FC 4R8PA 2PYOA 5CPID 3MVDC 1EQZA 4XZQA 3O62D 4CSRA 4Z2MH 1P34C 5BNXB 1AOIB 3AZIA 1F66D 4KGCC 5GT3B 2NZDA 4QLCB 1WWIA 3VH5A 4XUJD 3NQUB 5B31A 3UTBB 3UTAA 3AZFA 1M1AC 1KX3C 4WU9C 5GT0C 1ULYA 3X1SD 1B67A 3MGSB 4H9OA 5AV5C 1TZYB 1P3BA 5B0ZC 3NQJA 4Z66B 1TAFA 2JSSA 4R8PB 3AZMA 5B2JB 2F8ND 1EQZB 3LZ0C 3X1UC 3REJC 5CP6C 4KUDA 5GSUC 5B1MD 1KX4D 3RELC 1P3LB 3WA9D 1KU5A 3MVDA 1BH9A 5BNVA 3AZEA 3REKB 3AZNB 5GT3D 3AZKA 4Z5TC 4QLCD 1P3GC 3C1CA 2CV5A 3AZFB 3X1TC 3KXBA 3LELB 5AVCA 4H9OB 5DNND 1P3BB 4YS3C 2BYMA 3TU4C 3AYWC 5DNMC 4WU8A 5AV9A 1ZLAD 3AZLA 3MGPA 3NQJB 1TAFB 4J8UB 3AZMB 3X1VA 4LD9C 5GXQC 3WKJC 4R8PD 2PYOD 4G91C 1EQZD 4XZQD 3WTPB 5B24A 5CPJC 1BH8B 1P3PA 2HUEC 5AY8C 3AZGB 3AZID 1M19C 4J8VC 5B32A 1ID3A 1BH9B 5BNVB 3AZEB 3REIA 5B40C 3LZ1A 2NZDD 3W97A 4Z2MG 5BO0A 5CP6A 4J8WA 3AZKB 3B6GA 3V9RA 2CV5B 4CAYB 2HIOC 5B31D 3KXBB 1AOIC 5AVCB 5C3IC 3X1SA 3UTAD 3AZFD 1KX5D 2BYMB 5JRGA 4Z5TA 4WU8B 5AV9B 1P3GA 3AZLB 3KWQA 3MGPB 1P3BD 5CPIB 3X1VB 2L5AA 3MGRD 1U35D 5B0YA 3AZMD 1M18C 3W99A 3MGSC 5BS7C 2FJ7A 5B1MA 2AROC 1P3PB 3VH6T 4KUDD 4Z66C 2YFWA 3B6FD 5B32B 1ID3B 2IO5B 4H9PA 5AV8C 3AZJC 3LZ1B 1HQ3C 5B2JC 1P3FC 5BO0B 4J8WB 3MVDD 1P3MA 2F8NG 3B6GB 3W97B 4J8XA 3V9RB 3AZED 5E5AC 1S32A 5AV6A 3AFAA 5CPKA 3AZKD 4E44A 3X1SB 3C1CD 3AV2C 2CWEA 2CV5D 5DNNA 5B2IA 5F99C 3C1BC 3KXBD 3AV1A 5AVCD 5JRGB 1ZLAA 4H9NA 3VH6W 4JJNA 3AZNC 4WU8D 4H9SA 2F8NB 3AZLD 4NFTA 3MGPD 3LJAA 5AVBC 3MNNA 5B0YB 4UUZA 3X1VD 3W98C 3W99B 3MGQA 4YM6C 4EO5B 5B1MB 5G49A 3REHC 1KX4B 2RVQD 2BYKA 3WA9B 2YFWB 5B24D 1P3PD 4H9PB 3VH5T 4KHAA 3UT9A 5B32D 1ID3D 1P3KC 1R4VA 3W96C 4J8XB 3LZ0D 2LY8A 3REID 1S32B 3LZ1D 3AFAB 3A6NA 4J8WD 5CPKB 3B6GD 5CP6D 3W97D 1KX5A 5DNNB 5B2IB 1B6WA 1P3OA 3AV1B 1ZLAB 4H9NB 3AZHC 4JJNB 5JRGD 4Z5TD 3VH5W 1P3GD 2NQBC 3KWQD 3MGRA 3LJAB 1U35A 3MNNB 2PYOB 4UUZB 5B31G 1P3AA 3MGQB 4XZQB 3AN2C 4CSRB 5G49B 5B1LA 5B0YD 4ZUXA 3W99D 3AZIB 4WZSB 1P3IC 2FJ7D 3B6FA 3WAAA 5B33C 2NZDB 4KHAB 4ZBJB 4G92C 3O62C 1HTAA 3B0DB 3WKJD 1P34A 5B31B 1P3MD 3UTAB 4J8XD 1S32D 1KX5B 5AV6D 1F66C 3AFAD 5CPKD 4KGCA 1P3OB 5B2ID 4XUJC 3AV1D 4AWLB 3B0CT 1M1AA 3MGRB 1KX3A 4WU9A 1U35B 5GT0A 4JJND 2HIOD 1P3AB 4HGAB 3LJAD 5AV5A 5B0ZA 3MNND 4X23C 5B1LB 3KUYC 4KUDB 3MGQD 3B6FB 4WNNA 3MVDB 3AN2A 3LZ0A 3B0CW 3X1UA 3REJA 3UT9D 1N1JA 5GSUA 1P3IA 3C1CB 5B33A 3RELA 3A6ND 3WA9C 4KGCB 5GT3C 1P3FD 4NE5A 4QLCC 1P3OD 5B32G 1M1AB 1KX3B 3X1TA 4WU9B 5GT0B 3UTBC 1H3OA 5AV5B 4YS3A 3TU4A 3C1BD 3AYWA 5DNMA 1P3AD 1TZYC 5B24B 4WNNB 5B1LD 4LD9A 4ZUXD 3WAAD 5GXQA 3WKJA 3LZ0B 4R8PC 3REIB 3X1UB 5CP6B 1N1JB 5GSUB 4XZQC 1EQZC 4H9QA 5CPJA 5BT1C 1P34D 5AY8A 3RELB 3AZIC 4J8VA 1M19A 5B40A 1P3LC 4KGCD 4E45A 4Z5TB 1P3GB 3KWQB 3REKC 3B0DC 3W96D 3X1TB 2HIOA 1AOIA 3UTAC 1H3OB 3AZFC 1M1AD 1KX3D 5KDMA 4WU9D 5GT0D 3LELC 3AYWB 5DNMB 1JFIA 3AZHD 2FJ7B 5AV5D 4NE6A 1P3BC 5B0ZD 3NQUA 5CHLB 4LD9B 4J8UC 4WV4B 3WKJB 3AZMC 1P3MB 1M18A 4G91B 3MGSA 5BS7A 3AN2D 2AROA 5AV6B 4H9QB 3X1UD 5CPJB 3REJD 5AY8B 4KUDC 5GSUD 4Z66A 1P3ID 1M19B 3WTPC 5B33D 5B40B 5AV8A 3RELD 3AZGC 1HQ3A 1WWSA 5B2JA 3AZJA 5JA4A 1P3FA 3AZEC 4DRBA 5E5AA 1F1EA 2HIOB 3AZKC 5C3IB 3AV2A 3C1CC 2CV5C 5F99A 3X1TD 3C1BA 5KDMB 3KXBC 1P3LA 4M6BA 5AVCC 1JFIB 5FUGA 3REKA 4YS3D 3TU4D 3AZNA 3AYWD 5DNMD 4WU8C 2BYKB 5AV9C 3AZLC 3MGPC 5AVBA 3LELA 5CPIC 3W98A 3X1VC 4LD9D 1M18B 3UT9B 5GXQD 4YM6A 3REHA 2AROB 4X23D 2RVQC 3A6NB 3KUYD 4J8UA 5B24C 5CPJD 1P3PC 2F8NK 5AY8D 5AV8B 3AZJB 1P3FB 1HQ3B 5JA4B 4J8VD 1M19D 5B32C 3B0BA 1P3KA 3W96A 1ID3C 5E5AB 3REIC 2IO5C 5B40D 4H9RA 2F8NH 3LZ1C 4J8WC 3B6GC 3W97C 3AV2B 3WTPA 1BH8A 5F99B 3C1BB 3AZGA 3R45A 1AOID 3X1SC 1Q9CA
chains in the Genus database with same CATH superfamily
5FUGB 2G5HC 4NE3A 5JRGC 4ZUXB 2NQBA 3WAAB 3KWQC 4DQYB 4CAYA 5AVBB 1BFMA 3KSYA 3UTBD 3W98B 4YM6B 3REHB 5B0YC 1P34B 1M18D 3W99C 3MGSD 2FJ7C 1TZYD 5B1MC 4EO5C 2AROD 1KX4C 5CPIA 4Z66D 3O62A 1P3KB 3W96B 5AV8D 4H9RB 3AZJD 3AZHA 1HQ3D 4DRAA 5B2JD 1P3MC 4J8XC 5E5AD 1S32C 1F66A 5AV6C 5BT1D 3AFAC 5CPKC 3R45B 3AV2D 3AZHB 5DNNC 5B2IC 4XUJA 5F99D 5B0ZB 2YFVA 3AV1C 1P3LD 1ZLAC 2NQBB 3REKD 1T3UA 3AZND 4JJNC 4H9SC 3LJAC 5AVBD 3AN2B 3MNNC 4X23A 3F6TA 3LELD 2PYOC 3REJB 3W98D 3KUYA 3MGQC 1P3IB 4YM6D 5B33B 3REHD 2F8NA 4G92B 4J8UD 3O62B 3EPJA 2NZDC 3UT9C 3A1KA 4ZBJC 1P3KD 1KX4A 5BNXA 1F66B 1A7WA 5B31C 3A6NC 3WA9A 2Y2MA 3WTPD 1KX5C 4YS3B 4XUJB 3TU4B 3VH6A 2YFVB 5GT3A 3AZGD 4QLCA 1P3OC 3AL0C 3FDDA 2DF4C 3UTBA 3WTPE 4AWLC 2NQBD 5GXQB 3MGRC 1U35C 4X23B 1P3AC 3KUYB 2ZY2A 4HGAC 3P5JB 1TZYA 5B1LC 2HUEB 4ZUXC 3A1IA 5AV9D 3WAAC 4J8VB 3B6FC 4R8PA 2PYOA 5CPID 3MVDC 1EQZA 4XZQA 3O62D 4CSRA 4Z2MH 1P34C 5BNXB 3H0MC 2Y2KA 1AOIB 3AZIA 1F66D 4KGCC 5GT3B 2NZDA 4QLCB 1WWIA 3VH5A 4XUJD 3NQUB 5B31A 3UTBB 3UTAA 3AZFA 1M1AC 1KX3C 4WU9C 5GT0C 1ULYA 3X1SD 1B67A 3MGSB 4H9OA 5AV5C 1TZYB 1P3BA 5B0ZC 3NQJA 4Z66B 2Y2PA 1TAFA 2Y2IA 2JSSA 4R8PB 3AZMA 2Y2LA 5B2JB 2F8ND 1EQZB 3LZ0C 3X1UC 3REJC 5CP6C 4KUDA 5GSUC 5B1MD 1KX4D 3RELC 1P3LB 3WA9D 1KU5A 3MVDA 1BH9A 5BNVA 3AZEA 3REKB 3AZNB 5GT3D 3AZKA 4Z5TC 4QLCD 1P3GC 3C1CA 2CV5A 3AZFB 3X1TC 3KXBA 3LELB 2W8SA 5AVCA 4H9OB 5DNND 1P3BB 4YS3C 2BYMA 2Y2NA 3TU4C 3AYWC 5DNMC 4WU8A 5AV9A 1ZLAD 3AZLA 3MGPA 3NQJB 1TAFB 4J8UB 3AZMB 3X1VA 4LD9C 5GXQC 2Y2OA 3WKJC 4R8PD 2PYOD 4G91C 1EQZD 4XZQD 3WTPB 5B24A 5CPJC 1BH8B 1P3PA 2HUEC 5AY8C 3AZGB 3AZID 1M19C 4J8VC 5B32A 1ID3A 1BH9B 5BNVB 3AZEB 3REIA 5B40C 3LZ1A 2NZDD 3W97A 4Z2MG 5BO0A 5CP6A 4J8WA 3AZKB 3B6GA 3V9RA 2CV5B 4CAYB 2HIOC 5B31D 3KXBB 1AOIC 5AVCB 5C3IC 3X1SA 3UTAD 3AZFD 1KX5D 2BYMB 5JRGA 4Z5TA 1PZRA 4WU8B 5AV9B 1P3GA 3AZLB 3KWQA 3MGPB 1P3BD 5CPIB 3X1VB 2L5AA 3MGRD 1U35D 5B0YA 3AZMD 1M18C 3W99A 3MGSC 5BS7C 2FJ7A 5B1MA 2AROC 3EPKA 1P3PB 1Z2CB 3VH6T 4KUDD 4Z66C 2YFWA 3B6FD 5B32B 1ID3B 2IO5B 4H9PA 5AV8C 3AZJC 3LZ1B 1HQ3C 5B2JC 1P3FC 5BO0B 4J8WB 3MVDD 1P3MA 2F8NG 3B6GB 3W97B 4J8XA 3V9RB 3AZED 5E5AC 1S32A 5AV6A 3AFAA 5CPKA 3AZKD 4E44A 3X1SB 3C1CD 3AV2C 2CWEA 2CV5D 5DNNA 5B2IA 5F99C 3C1BC 3KXBD 3AV1A 5AVCD 5JRGB 1ZLAA 4H9NA 3VH6W 4UPKA 4JJNA 3AZNC 4WU8D 4H9SA 2F8NB 3AZLD 4NFTA 3MGPD 3LJAA 5AVBC 3MNNA 5B0YB 4UUZA 3X1VD 3W98C 3W99B 3MGQA 4YM6C 4EO5B 5B1MB 5G49A 3REHC 1KX4B 2RVQD 2BYKA 3WA9B 2YFWB 3EPHA 5B24D 1P3PD 4H9PB 3VH5T 4KHAA 3UT9A 5B32D 1ID3D 1P3KC 1R4VA 3W96C 4J8XB 3LZ0D 2LY8A 3REID 1S32B 3LZ1D 3AFAB 3A6NA 4J8WD 5CPKB 3B6GD 5CP6D 3W97D 1KX5A 5DNNB 5B2IB 1B6WA 1P3OA 3AV1B 1ZLAB 4H9NB 3AZHC 2F2AC 2ZY4A 4JJNB 5JRGD 4Z5TD 3VH5W 1P3GD 2NQBC 3KWQD 3MGRA 3LJAB 1U35A 3MNNB 2PYOB 4UUZB 5B31G 1P3AA 3MGQB 4XZQB 3EG5B 4CSRB 3AN2C 5G49B 5B1LA 5B0YD 4ZUXA 3W99D 3AZIB 4WZSB 1P3IC 2FJ7D 3B6FA 3WAAA 5B33C 2NZDB 4KHAB 4ZBJB 4G92C 3O62C 1HTAA 2Y2JA 3B0DB 3WKJD 1P34A 2DQNC 5B31B 1P3MD 3UTAB 2G5IC 4J8XD 1S32D 1KX5B 5AV6D 1F66C 2UWXA 3AFAD 5CPKD 4KGCA 1P3OB 2ZM5A 5B2ID 2Y2HA 4XUJC 3AV1D 4AWLB 3B0CT 1M1AA 3MGRB 1KX3A 4WU9A 1U35B 5GT0A 4JJND 2HIOD 1P3AB 4HGAB 3LJAD 5AV5A 4WJ3C 5B0ZA 3MNND 4X23C 5B1LB 3KUYC 4KUDB 3MGQD 3B6FB 4WNNA 3KFUG 3MVDB 3AN2A 2ZY3A 3B0CW 3LZ0A 3X1UA 3REJA 3UT9D 1N1JA 5GSUA 1P3IA 3C1CB 5B33A 3RELA 3A6ND 3WA9C 4KGCB 5GT3C 1P3FD 4NE5A 4QLCC 1P3OD 5B32G 1M1AB 1KX3B 3X1TA 4WU9B 5GT0B 3UTBC 1H3OA 5AV5B 4YS3A 3TU4A 3C1BD 3AYWA 5DNMA 1P3AD 2VQRA 1TZYC 5B24B 4WNNB 5B1LD 4LD9A 4ZUXD 3WAAD 5GXQA 3WKJA 3LZ0B 4R8PC 3REIB 3X1UB 5CP6B 1N1JB 5GSUB 4XZQC 1EQZC 4H9QA 5CPJA 5BT1C 1P34D 2ZY5A 5AY8A 3RELB 2JE5A 3AZIC 4J8VA 1M19A 3EPLA 5B40A 2Y2QA 1P3LC 4KGCD 4E45A 4Z5TB 1P3GB 3KWQB 3REKC 3B0DC 3W96D 3X1TB 2HIOA 1AOIA 3UTAC 1H3OB 3AZFC 1M1AD 1KX3D 5KDMA 4WU9D 5GT0D 3LELC 2Y2GA 3AYWB 5DNMB 1JFIA 3AZHD 1W2EA 2FJ7B 5AV5D 4NE6A 1P3BC 5B0ZD 3NQUA 2RIQA 5CHLB 4LD9B 4J8UC 4WV4B 3WKJB 3AZMC 1P3MB 1M18A 4G91B 3MGSA 5BS7A 3AN2D 2AROA 5AV6B 4H9QB 3X1UD 5CPJB 3REJD 5AY8B 4KUDC 5GSUD 4Z66A 1P3ID 1M19B 3WTPC 5B33D 5B40B 5AV8A 3RELD 3AZGC 1HQ3A 1WWSA 5B2JA 3AZJA 5JA4A 1P3FA 3AZEC 4DRBA 5E5AA 1F1EA 2HIOB 3AZKC 5C3IB 3AV2A 3C1CC 2CV5C 2XD5A 5F99A 3X1TD 3C1BA 5KDMB 3KXBC 2J8PA 4M6BA 5AVCC 1P3LA 1JFIB 5FUGA 3REKA 4YS3D 3TU4D 3AZNA 3AYWD 5DNMD 4WU8C 2BYKB 5AV9C 3AZLC 3MGPC 5AVBA 3LELA 3H0RC 3IP4C 5CPIC 3W98A 3X1VC 4LD9D 1M18B 3UT9B 5GXQD 4YM6A 3REHA 2AROB 3H0LC 2RVQC 4X23D 3A6NB 3KUYD 2JCHA 2BG1A 4J8UA 5B24C 5CPJD 1P3PC 2F8NK 5AY8D 5AV8B 3AZJB 1P3FB 1HQ3B 5JA4B 4J8VD 1M19D 5B32C 3B0BA 1P3KA 3W96A 1ID3C 5E5AB 3REIC 2IO5C 5B40D 4H9RA 2F8NH 2FFFB 3LZ1C 4J8WC 3B6GC 3W97C 3AV2B 3WTPA 1BH8A 5F99B 2XD1A 3C1BB 3AZGA 3R45A 1AOID 3X1SC 1Q9CA
chains in the Genus database with same CATH topology
5FUGB 2G5HC 4NE3A 5JRGC 4ZUXB 2NQBA 3WAAB 3KWQC 4DQYB 4CAYA 5AVBB 1BFMA 3KSYA 3UTBD 3W98B 4YM6B 3REHB 5B0YC 1P34B 1M18D 3W99C 3MGSD 2FJ7C 1TZYD 5B1MC 4EO5C 2AROD 1KX4C 5CPIA 4Z66D 3O62A 1P3KB 3W96B 5AV8D 4H9RB 3AZJD 3AZHA 1HQ3D 4DRAA 5B2JD 1P3MC 4J8XC 5E5AD 1S32C 1F66A 5AV6C 5BT1D 3AFAC 5CPKC 3R45B 3AV2D 3AZHB 5DNNC 5B2IC 4XUJA 5F99D 5B0ZB 2YFVA 3AV1C 1P3LD 1ZLAC 2NQBB 3REKD 1T3UA 3AZND 4JJNC 4H9SC 3LJAC 5AVBD 3AN2B 3MNNC 4X23A 3F6TA 3LELD 2PYOC 3REJB 3W98D 3KUYA 3MGQC 1P3IB 4YM6D 5B33B 3REHD 2F8NA 4G92B 4J8UD 3O62B 3EPJA 2NZDC 3UT9C 3A1KA 4ZBJC 1P3KD 1KX4A 5BNXA 1F66B 1A7WA 5B31C 3A6NC 3WA9A 2Y2MA 3WTPD 1KX5C 4YS3B 4XUJB 3TU4B 3VH6A 2YFVB 5GT3A 3AZGD 4QLCA 1P3OC 3AL0C 3FDDA 2DF4C 3UTBA 3WTPE 4AWLC 2NQBD 5GXQB 3MGRC 1U35C 4X23B 1P3AC 3KUYB 2ZY2A 4HGAC 3P5JB 1TZYA 5B1LC 2HUEB 4ZUXC 3A1IA 5AV9D 3WAAC 4J8VB 3B6FC 4R8PA 2PYOA 5CPID 3MVDC 1EQZA 4XZQA 3O62D 4CSRA 4Z2MH 1P34C 5BNXB 3H0MC 2Y2KA 1AOIB 3AZIA 1F66D 4KGCC 5GT3B 2NZDA 4QLCB 1WWIA 3VH5A 4XUJD 3NQUB 5B31A 3UTBB 3UTAA 3AZFA 1M1AC 1KX3C 4WU9C 5GT0C 1ULYA 3X1SD 1B67A 3MGSB 4H9OA 5AV5C 1TZYB 1P3BA 5B0ZC 3NQJA 4Z66B 2Y2PA 1TAFA 2Y2IA 2JSSA 4R8PB 3AZMA 2Y2LA 5B2JB 2F8ND 1EQZB 3LZ0C 3X1UC 3REJC 5CP6C 4KUDA 5GSUC 5B1MD 1KX4D 3RELC 1P3LB 3WA9D 1KU5A 3MVDA 1BH9A 5BNVA 3AZEA 3REKB 3AZNB 5GT3D 3AZKA 4Z5TC 4QLCD 1P3GC 3C1CA 2CV5A 3AZFB 3X1TC 3KXBA 3LELB 2W8SA 5AVCA 4H9OB 5DNND 1P3BB 4YS3C 2BYMA 2Y2NA 3TU4C 3AYWC 5DNMC 4WU8A 5AV9A 1ZLAD 3AZLA 3MGPA 3NQJB 1TAFB 4J8UB 3AZMB 3X1VA 4LD9C 5GXQC 2Y2OA 3WKJC 4R8PD 2PYOD 4G91C 1EQZD 4XZQD 3WTPB 5B24A 5CPJC 1BH8B 1P3PA 2HUEC 5AY8C 3AZGB 3AZID 1M19C 4J8VC 5B32A 1ID3A 1BH9B 5BNVB 3AZEB 3REIA 5B40C 3LZ1A 2NZDD 3W97A 4Z2MG 5BO0A 5CP6A 4J8WA 3AZKB 3B6GA 3V9RA 2CV5B 4CAYB 2HIOC 5B31D 3KXBB 1AOIC 5AVCB 5C3IC 3X1SA 3UTAD 3AZFD 1KX5D 2BYMB 5JRGA 4Z5TA 1PZRA 4WU8B 5AV9B 1P3GA 3AZLB 3KWQA 3MGPB 1P3BD 5CPIB 3X1VB 2L5AA 3MGRD 1U35D 5B0YA 3AZMD 1M18C 3W99A 3MGSC 5BS7C 2FJ7A 5B1MA 2AROC 3EPKA 1P3PB 1Z2CB 3VH6T 4KUDD 4Z66C 2YFWA 3B6FD 5B32B 1ID3B 2IO5B 4H9PA 5AV8C 3AZJC 3LZ1B 1HQ3C 5B2JC 1P3FC 5BO0B 4J8WB 3MVDD 1P3MA 2F8NG 3B6GB 3W97B 4J8XA 3V9RB 3AZED 5E5AC 1S32A 5AV6A 3AFAA 5CPKA 3AZKD 4E44A 3X1SB 3C1CD 3AV2C 2CWEA 2CV5D 5DNNA 5B2IA 5F99C 3C1BC 3KXBD 3AV1A 5AVCD 5JRGB 1ZLAA 4H9NA 3VH6W 4UPKA 4JJNA 3AZNC 4WU8D 4H9SA 2F8NB 3AZLD 4NFTA 3MGPD 3LJAA 5AVBC 3MNNA 5B0YB 4UUZA 3X1VD 3W98C 3W99B 3MGQA 4YM6C 4EO5B 5B1MB 5G49A 3REHC 1KX4B 2RVQD 2BYKA 3WA9B 2YFWB 3EPHA 5B24D 1P3PD 4H9PB 3VH5T 4KHAA 3UT9A 5B32D 1ID3D 1P3KC 1R4VA 3W96C 4J8XB 3LZ0D 2LY8A 3REID 1S32B 3LZ1D 3AFAB 3A6NA 4J8WD 5CPKB 3B6GD 5CP6D 3W97D 1KX5A 5DNNB 5B2IB 1B6WA 1P3OA 3AV1B 1ZLAB 4H9NB 3AZHC 2F2AC 2ZY4A 4JJNB 5JRGD 4Z5TD 3VH5W 1P3GD 2NQBC 3KWQD 3MGRA 3LJAB 1U35A 3MNNB 2PYOB 4UUZB 5B31G 1P3AA 3MGQB 4XZQB 3EG5B 4CSRB 3AN2C 5G49B 5B1LA 5B0YD 4ZUXA 3W99D 3AZIB 4WZSB 1P3IC 2FJ7D 3B6FA 3WAAA 5B33C 2NZDB 4KHAB 4ZBJB 4G92C 3O62C 1HTAA 2Y2JA 3B0DB 3WKJD 1P34A 2DQNC 5B31B 1P3MD 3UTAB 2G5IC 4J8XD 1S32D 1KX5B 5AV6D 1F66C 2UWXA 3AFAD 5CPKD 4KGCA 1P3OB 2ZM5A 5B2ID 2Y2HA 4XUJC 3AV1D 4AWLB 3B0CT 1M1AA 3MGRB 1KX3A 4WU9A 1U35B 5GT0A 4JJND 2HIOD 1P3AB 4HGAB 3LJAD 5AV5A 4WJ3C 5B0ZA 3MNND 4X23C 5B1LB 3KUYC 4KUDB 3MGQD 3B6FB 4WNNA 3KFUG 3MVDB 3AN2A 2ZY3A 3B0CW 3LZ0A 3X1UA 3REJA 3UT9D 1N1JA 5GSUA 1P3IA 3C1CB 5B33A 3RELA 3A6ND 3WA9C 4KGCB 5GT3C 1P3FD 4NE5A 4QLCC 1P3OD 5B32G 1M1AB 1KX3B 3X1TA 4WU9B 5GT0B 3UTBC 1H3OA 5AV5B 4YS3A 3TU4A 3C1BD 3AYWA 5DNMA 1P3AD 2VQRA 1TZYC 5B24B 4WNNB 5B1LD 4LD9A 4ZUXD 3WAAD 5GXQA 3WKJA 3LZ0B 4R8PC 3REIB 3X1UB 5CP6B 1N1JB 5GSUB 4XZQC 1EQZC 4H9QA 5CPJA 5BT1C 1P34D 2ZY5A 5AY8A 3RELB 2JE5A 3AZIC 4J8VA 1M19A 3EPLA 5B40A 2Y2QA 1P3LC 4KGCD 4E45A 4Z5TB 1P3GB 3KWQB 3REKC 3B0DC 3W96D 3X1TB 2HIOA 1AOIA 3UTAC 1H3OB 3AZFC 1M1AD 1KX3D 5KDMA 4WU9D 5GT0D 3LELC 2Y2GA 3AYWB 5DNMB 1JFIA 3AZHD 1W2EA 2FJ7B 5AV5D 4NE6A 1P3BC 5B0ZD 3NQUA 2RIQA 5CHLB 4LD9B 4J8UC 4WV4B 3WKJB 3AZMC 1P3MB 1M18A 4G91B 3MGSA 5BS7A 3AN2D 2AROA 5AV6B 4H9QB 3X1UD 5CPJB 3REJD 5AY8B 4KUDC 5GSUD 4Z66A 1P3ID 1M19B 3WTPC 5B33D 5B40B 5AV8A 3RELD 3AZGC 1HQ3A 1WWSA 5B2JA 3AZJA 5JA4A 1P3FA 3AZEC 4DRBA 5E5AA 1F1EA 2HIOB 3AZKC 5C3IB 3AV2A 3C1CC 2CV5C 2XD5A 5F99A 3X1TD 3C1BA 5KDMB 3KXBC 2J8PA 4M6BA 5AVCC 1P3LA 1JFIB 5FUGA 3REKA 4YS3D 3TU4D 3AZNA 3AYWD 5DNMD 4WU8C 2BYKB 5AV9C 3AZLC 3MGPC 5AVBA 3LELA 3H0RC 3IP4C 5CPIC 3W98A 3X1VC 4LD9D 1M18B 3UT9B 5GXQD 4YM6A 3REHA 2AROB 3H0LC 2RVQC 4X23D 3A6NB 3KUYD 2JCHA 2BG1A 4J8UA 5B24C 5CPJD 1P3PC 2F8NK 5AY8D 5AV8B 3AZJB 1P3FB 1HQ3B 5JA4B 4J8VD 1M19D 5B32C 3B0BA 1P3KA 3W96A 1ID3C 5E5AB 3REIC 2IO5C 5B40D 4H9RA 2F8NH 2FFFB 3LZ1C 4J8WC 3B6GC 3W97C 3AV2B 3WTPA 1BH8A 5F99B 2XD1A 3C1BB 3AZGA 3R45A 1AOID 3X1SC 1Q9CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FUG B;  4NE3 A;  5JRG C;  4ZUX B;  2NQB A;  3WAA B;  3KWQ C;  1BFM A;  4CAY A;  5AVB B;  3KSY A;  3UTB D;  3W98 B;  4YM6 B;  3REH B;  5B0Y C;  1P34 B;  1M18 D;  3W99 C;  3MGS D;  2FJ7 C;  1TZY D;  5B1M C;  4EO5 C;  2ARO D;  1KX4 C;  5CPI A;  4Z66 D;  3O62 A;  1P3K B;  3W96 B;  5AV8 D;  4H9R B;  3AZJ D;  3AZH A;  1HQ3 D;  4DRA A;  5B2J D;  1P3M C;  4J8X C;  5E5A D;  1S32 C;  1F66 A;  5AV6 C;  5BT1 D;  3AFA C;  5CPK C;  3R45 B;  3AV2 D;  3AZH B;  5DNN C;  5B2I C;  4XUJ A;  5F99 D;  5B0Z B;  2YFV A;  3AV1 C;  1P3L D;  1ZLA C;  2NQB B;  3REK D;  3AZN D;  4JJN C;  4H9S C;  3LJA C;  5AVB D;  3AN2 B;  3MNN C;  4X23 A;  3LEL D;  2PYO C;  3REJ B;  3W98 D;  3KUY A;  3MGQ C;  1P3I B;  4YM6 D;  5B33 B;  3REH D;  2F8N A;  4G92 B;  4J8U D;  3O62 B;  2NZD C;  3UT9 C;  4ZBJ C;  1P3K D;  1KX4 A;  5BNX A;  1F66 B;  1A7W A;  5B31 C;  3A6N C;  3WA9 A;  3WTP D;  1KX5 C;  4YS3 B;  4XUJ B;  3TU4 B;  3VH6 A;  2YFV B;  5GT3 A;  3AZG D;  4QLC A;  1P3O C;  3UTB A;  3WTP E;  4AWL C;  2NQB D;  5GXQ B;  3MGR C;  1U35 C;  4X23 B;  1P3A C;  3KUY B;  4HGA C;  1TZY A;  5B1L C;  2HUE B;  4ZUX C;  5AV9 D;  3WAA C;  4J8V B;  3B6F C;  4R8P A;  2PYO A;  5CPI D;  3MVD C;  1EQZ A;  4XZQ A;  3O62 D;  4CSR A;  4Z2M H;  1P34 C;  5BNX B;  1AOI B;  3AZI A;  1F66 D;  4KGC C;  5GT3 B;  2NZD A;  4QLC B;  1WWI A;  3VH5 A;  4XUJ D;  3NQU B;  5B31 A;  3UTB B;  3UTA A;  3AZF A;  1M1A C;  1KX3 C;  4WU9 C;  5GT0 C;  1ULY A;  3X1S D;  1B67 A;  3MGS B;  4H9O A;  5AV5 C;  1TZY B;  1P3B A;  5B0Z C;  3NQJ A;  4Z66 B;  1TAF A;  2JSS A;  4R8P B;  3AZM A;  5B2J B;  2F8N D;  1EQZ B;  3LZ0 C;  3X1U C;  3REJ C;  5CP6 C;  4KUD A;  5GSU C;  5B1M D;  1KX4 D;  3REL C;  1P3L B;  3WA9 D;  1KU5 A;  3MVD A;  1BH9 A;  5BNV A;  3AZE A;  3REK B;  3AZN B;  5GT3 D;  3AZK A;  4Z5T C;  4QLC D;  1P3G C;  3C1C A;  2CV5 A;  3AZF B;  3X1T C;  3KXB A;  3LEL B;  5AVC A;  4H9O B;  5DNN D;  1P3B B;  4YS3 C;  2BYM A;  3TU4 C;  3AYW C;  5DNM C;  4WU8 A;  5AV9 A;  1ZLA D;  3AZL A;  3MGP A;  3NQJ B;  1TAF B;  4J8U B;  3AZM B;  3X1V A;  4LD9 C;  5GXQ C;  3WKJ C;  4R8P D;  2PYO D;  4G91 C;  1EQZ D;  4XZQ D;  3WTP B;  5B24 A;  5CPJ C;  1BH8 B;  1P3P A;  2HUE C;  5AY8 C;  3AZG B;  3AZI D;  1M19 C;  4J8V C;  5B32 A;  1ID3 A;  1BH9 B;  5BNV B;  3AZE B;  3REI A;  5B40 C;  3LZ1 A;  2NZD D;  3W97 A;  4Z2M G;  5BO0 A;  5CP6 A;  4J8W A;  3AZK B;  3B6G A;  3V9R A;  2CV5 B;  4CAY B;  2HIO C;  5B31 D;  3KXB B;  1AOI C;  5AVC B;  5C3I C;  3X1S A;  3UTA D;  3AZF D;  1KX5 D;  2BYM B;  5JRG A;  4Z5T A;  4WU8 B;  5AV9 B;  1P3G A;  3AZL B;  3KWQ A;  3MGP B;  1P3B D;  5CPI B;  3X1V B;  2L5A A;  3MGR D;  1U35 D;  5B0Y A;  3AZM D;  1M18 C;  3W99 A;  3MGS C;  5BS7 C;  2FJ7 A;  5B1M A;  2ARO C;  1P3P B;  3VH6 T;  4KUD D;  4Z66 C;  2YFW A;  3B6F D;  5B32 B;  1ID3 B;  2IO5 B;  4H9P A;  5AV8 C;  3AZJ C;  3LZ1 B;  1HQ3 C;  5B2J C;  1P3F C;  5BO0 B;  4J8W B;  3MVD D;  1P3M A;  2F8N G;  3B6G B;  3W97 B;  4J8X A;  3V9R B;  3AZE D;  5E5A C;  1S32 A;  5AV6 A;  3AFA A;  5CPK A;  3AZK D;  4E44 A;  3X1S B;  3C1C D;  3AV2 C;  2CWE A;  2CV5 D;  5DNN A;  5B2I A;  5F99 C;  3C1B C;  3KXB D;  3AV1 A;  5AVC D;  5JRG B;  1ZLA A;  4H9N A;  3VH6 W;  4JJN A;  3AZN C;  4WU8 D;  4H9S A;  2F8N B;  3AZL D;  4NFT A;  3MGP D;  3LJA A;  5AVB C;  3MNN A;  5B0Y B;  4UUZ A;  3X1V D;  3W98 C;  3W99 B;  3MGQ A;  4YM6 C;  4EO5 B;  5B1M B;  5G49 A;  3REH C;  1KX4 B;  2RVQ D;  2BYK A;  3WA9 B;  2YFW B;  5B24 D;  1P3P D;  4H9P B;  3VH5 T;  4KHA A;  3UT9 A;  5B32 D;  1ID3 D;  1P3K C;  1R4V A;  3W96 C;  4J8X B;  3LZ0 D;  2LY8 A;  3REI D;  1S32 B;  3LZ1 D;  3AFA B;  3A6N A;  4J8W D;  5CPK B;  3B6G D;  5CP6 D;  3W97 D;  1KX5 A;  5DNN B;  5B2I B;  1B6W A;  1P3O A;  3AV1 B;  1ZLA B;  4H9N B;  3AZH C;  4JJN B;  5JRG D;  4Z5T D;  3VH5 W;  1P3G D;  2NQB C;  3KWQ D;  3MGR A;  3LJA B;  1U35 A;  3MNN B;  2PYO B;  4UUZ B;  5B31 G;  1P3A A;  3MGQ B;  4XZQ B;  3AN2 C;  4CSR B;  5G49 B;  5B1L A;  5B0Y D;  4ZUX A;  3W99 D;  3AZI B;  4WZS B;  1P3I C;  2FJ7 D;  3B6F A;  3WAA A;  5B33 C;  2NZD B;  4KHA B;  4ZBJ B;  4G92 C;  3O62 C;  1HTA A;  3B0D B;  3WKJ D;  1P34 A;  5B31 B;  1P3M D;  3UTA B;  4J8X D;  1S32 D;  1KX5 B;  5AV6 D;  1F66 C;  3AFA D;  5CPK D;  4KGC A;  1P3O B;  5B2I D;  4XUJ C;  3AV1 D;  4AWL B;  3B0C T;  1M1A A;  3MGR B;  1KX3 A;  4WU9 A;  1U35 B;  5GT0 A;  4JJN D;  2HIO D;  1P3A B;  4HGA B;  3LJA D;  5AV5 A;  5B0Z A;  3MNN D;  4X23 C;  5B1L B;  3KUY C;  4KUD B;  3MGQ D;  3B6F B;  4WNN A;  3MVD B;  3AN2 A;  3LZ0 A;  3B0C W;  3X1U A;  3REJ A;  3UT9 D;  1N1J A;  5GSU A;  1P3I A;  3C1C B;  5B33 A;  3REL A;  3A6N D;  3WA9 C;  4KGC B;  5GT3 C;  1P3F D;  4NE5 A;  4QLC C;  1P3O D;  5B32 G;  1M1A B;  1KX3 B;  3X1T A;  4WU9 B;  5GT0 B;  3UTB C;  1H3O A;  5AV5 B;  4YS3 A;  3TU4 A;  3C1B D;  3AYW A;  5DNM A;  1P3A D;  1TZY C;  5B24 B;  4WNN B;  5B1L D;  4LD9 A;  4ZUX D;  3WAA D;  5GXQ A;  3WKJ A;  3LZ0 B;  4R8P C;  3REI B;  3X1U B;  5CP6 B;  1N1J B;  5GSU B;  4XZQ C;  1EQZ C;  4H9Q A;  5CPJ A;  5BT1 C;  1P34 D;  5AY8 A;  3REL B;  3AZI C;  4J8V A;  1M19 A;  5B40 A;  1P3L C;  4KGC D;  4E45 A;  4Z5T B;  1P3G B;  3KWQ B;  3REK C;  3B0D C;  3W96 D;  3X1T B;  2HIO A;  1AOI A;  3UTA C;  1H3O B;  3AZF C;  1M1A D;  1KX3 D;  5KDM A;  4WU9 D;  5GT0 D;  3LEL C;  3AYW B;  5DNM B;  1JFI A;  3AZH D;  2FJ7 B;  5AV5 D;  4NE6 A;  1P3B C;  5B0Z D;  3NQU A;  5CHL B;  4LD9 B;  4J8U C;  4WV4 B;  3WKJ B;  3AZM C;  1P3M B;  1M18 A;  4G91 B;  3MGS A;  5BS7 A;  3AN2 D;  2ARO A;  5AV6 B;  4H9Q B;  3X1U D;  5CPJ B;  3REJ D;  5AY8 B;  4KUD C;  5GSU D;  4Z66 A;  1P3I D;  1M19 B;  3WTP C;  5B33 D;  5B40 B;  5AV8 A;  3REL D;  3AZG C;  1HQ3 A;  1WWS A;  5B2J A;  3AZJ A;  5JA4 A;  1P3F A;  3AZE C;  4DRB A;  5E5A A;  1F1E A;  2HIO B;  3AZK C;  5C3I B;  3AV2 A;  3C1C C;  2CV5 C;  5F99 A;  3X1T D;  3C1B A;  5KDM B;  3KXB C;  1P3L A;  4M6B A;  5AVC C;  1JFI B;  5FUG A;  3REK A;  4YS3 D;  3TU4 D;  3AZN A;  3AYW D;  5DNM D;  4WU8 C;  2BYK B;  5AV9 C;  3AZL C;  3MGP C;  5AVB A;  3LEL A;  5CPI C;  3W98 A;  3X1V C;  4LD9 D;  1M18 B;  3UT9 B;  5GXQ D;  4YM6 A;  3REH A;  2ARO B;  4X23 D;  2RVQ C;  3A6N B;  3KUY D;  4J8U A;  5B24 C;  5CPJ D;  1P3P C;  2F8N K;  5AY8 D;  5AV8 B;  3AZJ B;  1P3F B;  1HQ3 B;  5JA4 B;  4J8V D;  1M19 D;  5B32 C;  3B0B A;  1P3K A;  3W96 A;  1ID3 C;  5E5A B;  3REI C;  2IO5 C;  5B40 D;  4H9R A;  2F8N H;  3LZ1 C;  4J8W C;  3B6G C;  3W97 C;  3AV2 B;  3WTP A;  1BH8 A;  5F99 B;  3C1B B;  3AZG A;  3R45 A;  1AOI D;  3X1S C;  1Q9C A; 
#chains in the Genus database with same CATH topology
 5FUG B;  2G5H C;  4NE3 A;  5JRG C;  4ZUX B;  2NQB A;  3WAA B;  3KWQ C;  4DQY B;  4CAY A;  5AVB B;  1BFM A;  3KSY A;  3UTB D;  3W98 B;  4YM6 B;  3REH B;  5B0Y C;  1P34 B;  1M18 D;  3W99 C;  3MGS D;  2FJ7 C;  1TZY D;  5B1M C;  4EO5 C;  2ARO D;  1KX4 C;  5CPI A;  4Z66 D;  3O62 A;  1P3K B;  3W96 B;  5AV8 D;  4H9R B;  3AZJ D;  3AZH A;  1HQ3 D;  4DRA A;  5B2J D;  1P3M C;  4J8X C;  5E5A D;  1S32 C;  1F66 A;  5AV6 C;  5BT1 D;  3AFA C;  5CPK C;  3R45 B;  3AV2 D;  3AZH B;  5DNN C;  5B2I C;  4XUJ A;  5F99 D;  5B0Z B;  2YFV A;  3AV1 C;  1P3L D;  1ZLA C;  2NQB B;  3REK D;  1T3U A;  3AZN D;  4JJN C;  4H9S C;  3LJA C;  5AVB D;  3AN2 B;  3MNN C;  4X23 A;  3F6T A;  3LEL D;  2PYO C;  3REJ B;  3W98 D;  3KUY A;  3MGQ C;  1P3I B;  4YM6 D;  5B33 B;  3REH D;  2F8N A;  4G92 B;  4J8U D;  3O62 B;  3EPJ A;  2NZD C;  3UT9 C;  3A1K A;  4ZBJ C;  1P3K D;  1KX4 A;  5BNX A;  1F66 B;  1A7W A;  5B31 C;  3A6N C;  3WA9 A;  2Y2M A;  3WTP D;  1KX5 C;  4YS3 B;  4XUJ B;  3TU4 B;  3VH6 A;  2YFV B;  5GT3 A;  3AZG D;  4QLC A;  1P3O C;  3AL0 C;  3FDD A;  2DF4 C;  3UTB A;  3WTP E;  4AWL C;  2NQB D;  5GXQ B;  3MGR C;  1U35 C;  4X23 B;  1P3A C;  3KUY B;  2ZY2 A;  4HGA C;  3P5J B;  1TZY A;  5B1L C;  2HUE B;  4ZUX C;  3A1I A;  5AV9 D;  3WAA C;  4J8V B;  3B6F C;  4R8P A;  2PYO A;  5CPI D;  3MVD C;  1EQZ A;  4XZQ A;  3O62 D;  4CSR A;  4Z2M H;  1P34 C;  5BNX B;  3H0M C;  2Y2K A;  1AOI B;  3AZI A;  1F66 D;  4KGC C;  5GT3 B;  2NZD A;  4QLC B;  1WWI A;  3VH5 A;  4XUJ D;  3NQU B;  5B31 A;  3UTB B;  3UTA A;  3AZF A;  1M1A C;  1KX3 C;  4WU9 C;  5GT0 C;  1ULY A;  3X1S D;  1B67 A;  3MGS B;  4H9O A;  5AV5 C;  1TZY B;  1P3B A;  5B0Z C;  3NQJ A;  4Z66 B;  2Y2P A;  1TAF A;  2Y2I A;  2JSS A;  4R8P B;  3AZM A;  2Y2L A;  5B2J B;  2F8N D;  1EQZ B;  3LZ0 C;  3X1U C;  3REJ C;  5CP6 C;  4KUD A;  5GSU C;  5B1M D;  1KX4 D;  3REL C;  1P3L B;  3WA9 D;  1KU5 A;  3MVD A;  1BH9 A;  5BNV A;  3AZE A;  3REK B;  3AZN B;  5GT3 D;  3AZK A;  4Z5T C;  4QLC D;  1P3G C;  3C1C A;  2CV5 A;  3AZF B;  3X1T C;  3KXB A;  3LEL B;  2W8S A;  5AVC A;  4H9O B;  5DNN D;  1P3B B;  4YS3 C;  2BYM A;  2Y2N A;  3TU4 C;  3AYW C;  5DNM C;  4WU8 A;  5AV9 A;  1ZLA D;  3AZL A;  3MGP A;  3NQJ B;  1TAF B;  4J8U B;  3AZM B;  3X1V A;  4LD9 C;  5GXQ C;  2Y2O A;  3WKJ C;  4R8P D;  2PYO D;  4G91 C;  1EQZ D;  4XZQ D;  3WTP B;  5B24 A;  5CPJ C;  1BH8 B;  1P3P A;  2HUE C;  5AY8 C;  3AZG B;  3AZI D;  1M19 C;  4J8V C;  5B32 A;  1ID3 A;  1BH9 B;  5BNV B;  3AZE B;  3REI A;  5B40 C;  3LZ1 A;  2NZD D;  3W97 A;  4Z2M G;  5BO0 A;  5CP6 A;  4J8W A;  3AZK B;  3B6G A;  3V9R A;  2CV5 B;  4CAY B;  2HIO C;  5B31 D;  3KXB B;  1AOI C;  5AVC B;  5C3I C;  3X1S A;  3UTA D;  3AZF D;  1KX5 D;  2BYM B;  5JRG A;  4Z5T A;  1PZR A;  4WU8 B;  5AV9 B;  1P3G A;  3AZL B;  3KWQ A;  3MGP B;  1P3B D;  5CPI B;  3X1V B;  2L5A A;  3MGR D;  1U35 D;  5B0Y A;  3AZM D;  1M18 C;  3W99 A;  3MGS C;  5BS7 C;  2FJ7 A;  5B1M A;  2ARO C;  3EPK A;  1P3P B;  1Z2C B;  3VH6 T;  4KUD D;  4Z66 C;  2YFW A;  3B6F D;  5B32 B;  1ID3 B;  2IO5 B;  4H9P A;  5AV8 C;  3AZJ C;  3LZ1 B;  1HQ3 C;  5B2J C;  1P3F C;  5BO0 B;  4J8W B;  3MVD D;  1P3M A;  2F8N G;  3B6G B;  3W97 B;  4J8X A;  3V9R B;  3AZE D;  5E5A C;  1S32 A;  5AV6 A;  3AFA A;  5CPK A;  3AZK D;  4E44 A;  3X1S B;  3C1C D;  3AV2 C;  2CWE A;  2CV5 D;  5DNN A;  5B2I A;  5F99 C;  3C1B C;  3KXB D;  3AV1 A;  5AVC D;  5JRG B;  1ZLA A;  4H9N A;  3VH6 W;  4UPK A;  4JJN A;  3AZN C;  4WU8 D;  4H9S A;  2F8N B;  3AZL D;  4NFT A;  3MGP D;  3LJA A;  5AVB C;  3MNN A;  5B0Y B;  4UUZ A;  3X1V D;  3W98 C;  3W99 B;  3MGQ A;  4YM6 C;  4EO5 B;  5B1M B;  5G49 A;  3REH C;  1KX4 B;  2RVQ D;  2BYK A;  3WA9 B;  2YFW B;  3EPH A;  5B24 D;  1P3P D;  4H9P B;  3VH5 T;  4KHA A;  3UT9 A;  5B32 D;  1ID3 D;  1P3K C;  1R4V A;  3W96 C;  4J8X B;  3LZ0 D;  2LY8 A;  3REI D;  1S32 B;  3LZ1 D;  3AFA B;  3A6N A;  4J8W D;  5CPK B;  3B6G D;  5CP6 D;  3W97 D;  1KX5 A;  5DNN B;  5B2I B;  1B6W A;  1P3O A;  3AV1 B;  1ZLA B;  4H9N B;  3AZH C;  2F2A C;  2ZY4 A;  4JJN B;  5JRG D;  4Z5T D;  3VH5 W;  1P3G D;  2NQB C;  3KWQ D;  3MGR A;  3LJA B;  1U35 A;  3MNN B;  2PYO B;  4UUZ B;  5B31 G;  1P3A A;  3MGQ B;  4XZQ B;  3EG5 B;  4CSR B;  3AN2 C;  5G49 B;  5B1L A;  5B0Y D;  4ZUX A;  3W99 D;  3AZI B;  4WZS B;  1P3I C;  2FJ7 D;  3B6F A;  3WAA A;  5B33 C;  2NZD B;  4KHA B;  4ZBJ B;  4G92 C;  3O62 C;  1HTA A;  2Y2J A;  3B0D B;  3WKJ D;  1P34 A;  2DQN C;  5B31 B;  1P3M D;  3UTA B;  2G5I C;  4J8X D;  1S32 D;  1KX5 B;  5AV6 D;  1F66 C;  2UWX A;  3AFA D;  5CPK D;  4KGC A;  1P3O B;  2ZM5 A;  5B2I D;  2Y2H A;  4XUJ C;  3AV1 D;  4AWL B;  3B0C T;  1M1A A;  3MGR B;  1KX3 A;  4WU9 A;  1U35 B;  5GT0 A;  4JJN D;  2HIO D;  1P3A B;  4HGA B;  3LJA D;  5AV5 A;  4WJ3 C;  5B0Z A;  3MNN D;  4X23 C;  5B1L B;  3KUY C;  4KUD B;  3MGQ D;  3B6F B;  4WNN A;  3KFU G;  3MVD B;  3AN2 A;  2ZY3 A;  3B0C W;  3LZ0 A;  3X1U A;  3REJ A;  3UT9 D;  1N1J A;  5GSU A;  1P3I A;  3C1C B;  5B33 A;  3REL A;  3A6N D;  3WA9 C;  4KGC B;  5GT3 C;  1P3F D;  4NE5 A;  4QLC C;  1P3O D;  5B32 G;  1M1A B;  1KX3 B;  3X1T A;  4WU9 B;  5GT0 B;  3UTB C;  1H3O A;  5AV5 B;  4YS3 A;  3TU4 A;  3C1B D;  3AYW A;  5DNM A;  1P3A D;  2VQR A;  1TZY C;  5B24 B;  4WNN B;  5B1L D;  4LD9 A;  4ZUX D;  3WAA D;  5GXQ A;  3WKJ A;  3LZ0 B;  4R8P C;  3REI B;  3X1U B;  5CP6 B;  1N1J B;  5GSU B;  4XZQ C;  1EQZ C;  4H9Q A;  5CPJ A;  5BT1 C;  1P34 D;  2ZY5 A;  5AY8 A;  3REL B;  2JE5 A;  3AZI C;  4J8V A;  1M19 A;  3EPL A;  5B40 A;  2Y2Q A;  1P3L C;  4KGC D;  4E45 A;  4Z5T B;  1P3G B;  3KWQ B;  3REK C;  3B0D C;  3W96 D;  3X1T B;  2HIO A;  1AOI A;  3UTA C;  1H3O B;  3AZF C;  1M1A D;  1KX3 D;  5KDM A;  4WU9 D;  5GT0 D;  3LEL C;  2Y2G A;  3AYW B;  5DNM B;  1JFI A;  3AZH D;  1W2E A;  2FJ7 B;  5AV5 D;  4NE6 A;  1P3B C;  5B0Z D;  3NQU A;  2RIQ A;  5CHL B;  4LD9 B;  4J8U C;  4WV4 B;  3WKJ B;  3AZM C;  1P3M B;  1M18 A;  4G91 B;  3MGS A;  5BS7 A;  3AN2 D;  2ARO A;  5AV6 B;  4H9Q B;  3X1U D;  5CPJ B;  3REJ D;  5AY8 B;  4KUD C;  5GSU D;  4Z66 A;  1P3I D;  1M19 B;  3WTP C;  5B33 D;  5B40 B;  5AV8 A;  3REL D;  3AZG C;  1HQ3 A;  1WWS A;  5B2J A;  3AZJ A;  5JA4 A;  1P3F A;  3AZE C;  4DRB A;  5E5A A;  1F1E A;  2HIO B;  3AZK C;  5C3I B;  3AV2 A;  3C1C C;  2CV5 C;  2XD5 A;  5F99 A;  3X1T D;  3C1B A;  5KDM B;  3KXB C;  2J8P A;  4M6B A;  5AVC C;  1P3L A;  1JFI B;  5FUG A;  3REK A;  4YS3 D;  3TU4 D;  3AZN A;  3AYW D;  5DNM D;  4WU8 C;  2BYK B;  5AV9 C;  3AZL C;  3MGP C;  5AVB A;  3LEL A;  3H0R C;  3IP4 C;  5CPI C;  3W98 A;  3X1V C;  4LD9 D;  1M18 B;  3UT9 B;  5GXQ D;  4YM6 A;  3REH A;  2ARO B;  3H0L C;  2RVQ C;  4X23 D;  3A6N B;  3KUY D;  2JCH A;  2BG1 A;  4J8U A;  5B24 C;  5CPJ D;  1P3P C;  2F8N K;  5AY8 D;  5AV8 B;  3AZJ B;  1P3F B;  1HQ3 B;  5JA4 B;  4J8V D;  1M19 D;  5B32 C;  3B0B A;  1P3K A;  3W96 A;  1ID3 C;  5E5A B;  3REI C;  2IO5 C;  5B40 D;  4H9R A;  2F8N H;  2FFF B;  3LZ1 C;  4J8W C;  3B6G C;  3W97 C;  3AV2 B;  3WTP A;  1BH8 A;  5F99 B;  2XD1 A;  3C1B B;  3AZG A;  3R45 A;  1AOI D;  3X1S C;  1Q9C A; 
#chains in the Genus database with same CATH homology
 5FUG B;  2G5H C;  4NE3 A;  5JRG C;  4ZUX B;  2NQB A;  3WAA B;  3KWQ C;  4DQY B;  4CAY A;  5AVB B;  1BFM A;  3KSY A;  3UTB D;  3W98 B;  4YM6 B;  3REH B;  5B0Y C;  1P34 B;  1M18 D;  3W99 C;  3MGS D;  2FJ7 C;  1TZY D;  5B1M C;  4EO5 C;  2ARO D;  1KX4 C;  5CPI A;  4Z66 D;  3O62 A;  1P3K B;  3W96 B;  5AV8 D;  4H9R B;  3AZJ D;  3AZH A;  1HQ3 D;  4DRA A;  5B2J D;  1P3M C;  4J8X C;  5E5A D;  1S32 C;  1F66 A;  5AV6 C;  5BT1 D;  3AFA C;  5CPK C;  3R45 B;  3AV2 D;  3AZH B;  5DNN C;  5B2I C;  4XUJ A;  5F99 D;  5B0Z B;  2YFV A;  3AV1 C;  1P3L D;  1ZLA C;  2NQB B;  3REK D;  1T3U A;  3AZN D;  4JJN C;  4H9S C;  3LJA C;  5AVB D;  3AN2 B;  3MNN C;  4X23 A;  3F6T A;  3LEL D;  2PYO C;  3REJ B;  3W98 D;  3KUY A;  3MGQ C;  1P3I B;  4YM6 D;  5B33 B;  3REH D;  2F8N A;  4G92 B;  4J8U D;  3O62 B;  3EPJ A;  2NZD C;  3UT9 C;  3A1K A;  4ZBJ C;  1P3K D;  1KX4 A;  5BNX A;  1F66 B;  1A7W A;  5B31 C;  3A6N C;  3WA9 A;  2Y2M A;  3WTP D;  1KX5 C;  4YS3 B;  4XUJ B;  3TU4 B;  3VH6 A;  2YFV B;  5GT3 A;  3AZG D;  4QLC A;  1P3O C;  3AL0 C;  3FDD A;  2DF4 C;  3UTB A;  3WTP E;  4AWL C;  2NQB D;  5GXQ B;  3MGR C;  1U35 C;  4X23 B;  1P3A C;  3KUY B;  2ZY2 A;  4HGA C;  3P5J B;  1TZY A;  5B1L C;  2HUE B;  4ZUX C;  3A1I A;  5AV9 D;  3WAA C;  4J8V B;  3B6F C;  4R8P A;  2PYO A;  5CPI D;  3MVD C;  1EQZ A;  4XZQ A;  3O62 D;  4CSR A;  4Z2M H;  1P34 C;  5BNX B;  3H0M C;  2Y2K A;  1AOI B;  3AZI A;  1F66 D;  4KGC C;  5GT3 B;  2NZD A;  4QLC B;  1WWI A;  3VH5 A;  4XUJ D;  3NQU B;  5B31 A;  3UTB B;  3UTA A;  3AZF A;  1M1A C;  1KX3 C;  4WU9 C;  5GT0 C;  1ULY A;  3X1S D;  1B67 A;  3MGS B;  4H9O A;  5AV5 C;  1TZY B;  1P3B A;  5B0Z C;  3NQJ A;  4Z66 B;  2Y2P A;  1TAF A;  2Y2I A;  2JSS A;  4R8P B;  3AZM A;  2Y2L A;  5B2J B;  2F8N D;  1EQZ B;  3LZ0 C;  3X1U C;  3REJ C;  5CP6 C;  4KUD A;  5GSU C;  5B1M D;  1KX4 D;  3REL C;  1P3L B;  3WA9 D;  1KU5 A;  3MVD A;  1BH9 A;  5BNV A;  3AZE A;  3REK B;  3AZN B;  5GT3 D;  3AZK A;  4Z5T C;  4QLC D;  1P3G C;  3C1C A;  2CV5 A;  3AZF B;  3X1T C;  3KXB A;  3LEL B;  2W8S A;  5AVC A;  4H9O B;  5DNN D;  1P3B B;  4YS3 C;  2BYM A;  2Y2N A;  3TU4 C;  3AYW C;  5DNM C;  4WU8 A;  5AV9 A;  1ZLA D;  3AZL A;  3MGP A;  3NQJ B;  1TAF B;  4J8U B;  3AZM B;  3X1V A;  4LD9 C;  5GXQ C;  2Y2O A;  3WKJ C;  4R8P D;  2PYO D;  4G91 C;  1EQZ D;  4XZQ D;  3WTP B;  5B24 A;  5CPJ C;  1BH8 B;  1P3P A;  2HUE C;  5AY8 C;  3AZG B;  3AZI D;  1M19 C;  4J8V C;  5B32 A;  1ID3 A;  1BH9 B;  5BNV B;  3AZE B;  3REI A;  5B40 C;  3LZ1 A;  2NZD D;  3W97 A;  4Z2M G;  5BO0 A;  5CP6 A;  4J8W A;  3AZK B;  3B6G A;  3V9R A;  2CV5 B;  4CAY B;  2HIO C;  5B31 D;  3KXB B;  1AOI C;  5AVC B;  5C3I C;  3X1S A;  3UTA D;  3AZF D;  1KX5 D;  2BYM B;  5JRG A;  4Z5T A;  1PZR A;  4WU8 B;  5AV9 B;  1P3G A;  3AZL B;  3KWQ A;  3MGP B;  1P3B D;  5CPI B;  3X1V B;  2L5A A;  3MGR D;  1U35 D;  5B0Y A;  3AZM D;  1M18 C;  3W99 A;  3MGS C;  5BS7 C;  2FJ7 A;  5B1M A;  2ARO C;  3EPK A;  1P3P B;  1Z2C B;  3VH6 T;  4KUD D;  4Z66 C;  2YFW A;  3B6F D;  5B32 B;  1ID3 B;  2IO5 B;  4H9P A;  5AV8 C;  3AZJ C;  3LZ1 B;  1HQ3 C;  5B2J C;  1P3F C;  5BO0 B;  4J8W B;  3MVD D;  1P3M A;  2F8N G;  3B6G B;  3W97 B;  4J8X A;  3V9R B;  3AZE D;  5E5A C;  1S32 A;  5AV6 A;  3AFA A;  5CPK A;  3AZK D;  4E44 A;  3X1S B;  3C1C D;  3AV2 C;  2CWE A;  2CV5 D;  5DNN A;  5B2I A;  5F99 C;  3C1B C;  3KXB D;  3AV1 A;  5AVC D;  5JRG B;  1ZLA A;  4H9N A;  3VH6 W;  4UPK A;  4JJN A;  3AZN C;  4WU8 D;  4H9S A;  2F8N B;  3AZL D;  4NFT A;  3MGP D;  3LJA A;  5AVB C;  3MNN A;  5B0Y B;  4UUZ A;  3X1V D;  3W98 C;  3W99 B;  3MGQ A;  4YM6 C;  4EO5 B;  5B1M B;  5G49 A;  3REH C;  1KX4 B;  2RVQ D;  2BYK A;  3WA9 B;  2YFW B;  3EPH A;  5B24 D;  1P3P D;  4H9P B;  3VH5 T;  4KHA A;  3UT9 A;  5B32 D;  1ID3 D;  1P3K C;  1R4V A;  3W96 C;  4J8X B;  3LZ0 D;  2LY8 A;  3REI D;  1S32 B;  3LZ1 D;  3AFA B;  3A6N A;  4J8W D;  5CPK B;  3B6G D;  5CP6 D;  3W97 D;  1KX5 A;  5DNN B;  5B2I B;  1B6W A;  1P3O A;  3AV1 B;  1ZLA B;  4H9N B;  3AZH C;  2F2A C;  2ZY4 A;  4JJN B;  5JRG D;  4Z5T D;  3VH5 W;  1P3G D;  2NQB C;  3KWQ D;  3MGR A;  3LJA B;  1U35 A;  3MNN B;  2PYO B;  4UUZ B;  5B31 G;  1P3A A;  3MGQ B;  4XZQ B;  3EG5 B;  4CSR B;  3AN2 C;  5G49 B;  5B1L A;  5B0Y D;  4ZUX A;  3W99 D;  3AZI B;  4WZS B;  1P3I C;  2FJ7 D;  3B6F A;  3WAA A;  5B33 C;  2NZD B;  4KHA B;  4ZBJ B;  4G92 C;  3O62 C;  1HTA A;  2Y2J A;  3B0D B;  3WKJ D;  1P34 A;  2DQN C;  5B31 B;  1P3M D;  3UTA B;  2G5I C;  4J8X D;  1S32 D;  1KX5 B;  5AV6 D;  1F66 C;  2UWX A;  3AFA D;  5CPK D;  4KGC A;  1P3O B;  2ZM5 A;  5B2I D;  2Y2H A;  4XUJ C;  3AV1 D;  4AWL B;  3B0C T;  1M1A A;  3MGR B;  1KX3 A;  4WU9 A;  1U35 B;  5GT0 A;  4JJN D;  2HIO D;  1P3A B;  4HGA B;  3LJA D;  5AV5 A;  4WJ3 C;  5B0Z A;  3MNN D;  4X23 C;  5B1L B;  3KUY C;  4KUD B;  3MGQ D;  3B6F B;  4WNN A;  3KFU G;  3MVD B;  3AN2 A;  2ZY3 A;  3B0C W;  3LZ0 A;  3X1U A;  3REJ A;  3UT9 D;  1N1J A;  5GSU A;  1P3I A;  3C1C B;  5B33 A;  3REL A;  3A6N D;  3WA9 C;  4KGC B;  5GT3 C;  1P3F D;  4NE5 A;  4QLC C;  1P3O D;  5B32 G;  1M1A B;  1KX3 B;  3X1T A;  4WU9 B;  5GT0 B;  3UTB C;  1H3O A;  5AV5 B;  4YS3 A;  3TU4 A;  3C1B D;  3AYW A;  5DNM A;  1P3A D;  2VQR A;  1TZY C;  5B24 B;  4WNN B;  5B1L D;  4LD9 A;  4ZUX D;  3WAA D;  5GXQ A;  3WKJ A;  3LZ0 B;  4R8P C;  3REI B;  3X1U B;  5CP6 B;  1N1J B;  5GSU B;  4XZQ C;  1EQZ C;  4H9Q A;  5CPJ A;  5BT1 C;  1P34 D;  2ZY5 A;  5AY8 A;  3REL B;  2JE5 A;  3AZI C;  4J8V A;  1M19 A;  3EPL A;  5B40 A;  2Y2Q A;  1P3L C;  4KGC D;  4E45 A;  4Z5T B;  1P3G B;  3KWQ B;  3REK C;  3B0D C;  3W96 D;  3X1T B;  2HIO A;  1AOI A;  3UTA C;  1H3O B;  3AZF C;  1M1A D;  1KX3 D;  5KDM A;  4WU9 D;  5GT0 D;  3LEL C;  2Y2G A;  3AYW B;  5DNM B;  1JFI A;  3AZH D;  1W2E A;  2FJ7 B;  5AV5 D;  4NE6 A;  1P3B C;  5B0Z D;  3NQU A;  2RIQ A;  5CHL B;  4LD9 B;  4J8U C;  4WV4 B;  3WKJ B;  3AZM C;  1P3M B;  1M18 A;  4G91 B;  3MGS A;  5BS7 A;  3AN2 D;  2ARO A;  5AV6 B;  4H9Q B;  3X1U D;  5CPJ B;  3REJ D;  5AY8 B;  4KUD C;  5GSU D;  4Z66 A;  1P3I D;  1M19 B;  3WTP C;  5B33 D;  5B40 B;  5AV8 A;  3REL D;  3AZG C;  1HQ3 A;  1WWS A;  5B2J A;  3AZJ A;  5JA4 A;  1P3F A;  3AZE C;  4DRB A;  5E5A A;  1F1E A;  2HIO B;  3AZK C;  5C3I B;  3AV2 A;  3C1C C;  2CV5 C;  2XD5 A;  5F99 A;  3X1T D;  3C1B A;  5KDM B;  3KXB C;  2J8P A;  4M6B A;  5AVC C;  1P3L A;  1JFI B;  5FUG A;  3REK A;  4YS3 D;  3TU4 D;  3AZN A;  3AYW D;  5DNM D;  4WU8 C;  2BYK B;  5AV9 C;  3AZL C;  3MGP C;  5AVB A;  3LEL A;  3H0R C;  3IP4 C;  5CPI C;  3W98 A;  3X1V C;  4LD9 D;  1M18 B;  3UT9 B;  5GXQ D;  4YM6 A;  3REH A;  2ARO B;  3H0L C;  2RVQ C;  4X23 D;  3A6N B;  3KUY D;  2JCH A;  2BG1 A;  4J8U A;  5B24 C;  5CPJ D;  1P3P C;  2F8N K;  5AY8 D;  5AV8 B;  3AZJ B;  1P3F B;  1HQ3 B;  5JA4 B;  4J8V D;  1M19 D;  5B32 C;  3B0B A;  1P3K A;  3W96 A;  1ID3 C;  5E5A B;  3REI C;  2IO5 C;  5B40 D;  4H9R A;  2F8N H;  2FFF B;  3LZ1 C;  4J8W C;  3B6G C;  3W97 C;  3AV2 B;  3WTP A;  1BH8 A;  5F99 B;  2XD1 A;  3C1B B;  3AZG A;  3R45 A;  1AOI D;  3X1S C;  1Q9C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...