3KWQA

Structural characterization of h3k56q nucleosomes and nucleosomal arrays
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
98
structure length
98
Chain Sequence
PHRYRPGTVALREIRRYQESTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Structural characterization of H3K56Q nucleosomes and nucleosomal arrays.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 32
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2009-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3kwqA00
1BFMA 3AZJD 3KXBC 3MGPD 1KX4C 3UTBD 4E45A 5CPKB 3X1TC 3UTAA 5DNMD 5CPJD 3MGSC 4UUZA 4NFTA 5F99C 3W96A 3B0BA 4J8WA 3UTAB 5AV8A 4KGCD 4WU8C 1ID3A 1BH8A 3W96B 5B2JA 4J8WB 3REJC 3UT9B 5AV8B 5BT1D 1ID3B 2NQBD 1BH8B 3MVDC 3X1UD 5GT3C 1P3IA 3B6FD 1HQ3D 5B2JB 3W98D 1KX3B 3WA9D 5AV6C 1P3IB 5B0YD 3B0DC 3A6NC 3KUYC 1R4VA 1M1AD 3TU4A 1S32D 4HGAC 4LD9C 5B1MA 4R8PD 5JRGC 1KX5D 2PYOC 4WNNA 3TU4B 1P3OA 5B1MB 3AZIC 3O62B 4G91C 3LJAC 3AN2C 4WNNB 1M18C 2AROB 3AZJA 2HIOC 3REKC 3MGPA 5B40C 3UTBA 2BYMA 3AZGD 5DNMA 5CPJA 2F8ND 1F66D 5B0ZA 3AZJB 5CP6C 3UTBB 2BYMB 4ZBJB 5GSUB 4Z66C 5DNMB 3VH6T 4AWLC 1P3BC 3KXBD 1KX4D 4J8XA 5B0ZB 5AV9B 5B2IC 4DRBA 1U35C 3MGSD 5F99D 4NE5A 4J8XB 1TZYA 4YS3C 3X1UA 3B6FA 3AYWB 3W98A 4WU8D 3LZ0C 2FJ7C 1TZYB 3WA9A 3REJD 2L5AA 3KSYA 4CAYB 5BS7C 3MGQB 3WTPC 1M1AA 3MVDD 3KWQC 5GT3D 3WA9B 4R8PA 2CV5C 1KX5A 3AZFA 4G92B 4KGCC 1M19C 1KX5B 3AZFB 4LD9D 4WU9A 1P3PD 3WTPE 3VH6A 5C3IC 5GT0C 5JRGD 2PYOD 5BT1C 2NQBC 1HQ3C 4WU9B 1P3MC 3W97C 3LJAD 3AN2D 2JSSA 1F66A 3C1CB 5CHLB 3AZND 2IO5B 5GXQC 1M18D 3KXBA 3REKD 1KX4A 3VH6W 1F66B 5B40D 3AV2C 3X1TA 1P3GC 1P3LC 3MGSA 5F99A 1KX4B 3X1SA 5CP6D 4Z66D 3X1TB 1AOIA 1WWSA 1P3BD 4WU8A 3NQUA 3LZ1C 5B2ID 3X1SB 3WAAD 2LY8A 4ZUXA 3REJA 1AOIB 5B33D 4YS3D 3NQUB 5GT3A 4ZUXB 3V9RB 1P3KC 3LZ0D 3REJB 5AV6A 5GT3B 3B6GC 3A6NA 5B24C 3KUYA 3WTPD 3AFAC 3KWQD 4J8UA 5AV6B 2CV5D 3B0CT 4LD9A 5DNNC 2PYOA 3B0DB 5BNXA 4Z2MH 3A6NB 3KUYB 4J8UB 5B31A 4X23C 3AV1C 4LD9B 3AZIA 1M19D 4UUZB 3AZKC 3LJAA 3AN2A 3W99C 5BNXB 5B31B 5GT0D 1M18A 3AZIB 3X1VC 2HIOA 3LJAB 4G91B 3REKA 3AN2B 5B40A 5CPIC 4Z5TD 5B31G 1P3MD 3W97D 2HIOB 3MGRC 5B1LA 3R45A 5CP6A 5GXQD 3REIC 3WKJC 1P3BA 3AV2D 2YFWA 5B1LB 5B2IA 3R45B 3AZMC 1P3GD 1P3LD 1U35A 1P3PC 2HUEC 4YS3A 4J8VC 3LELC 2YFWB 5B2IB 4XUJC 3AZEC 1U35B 3LZ0A 3LZ1D 2FJ7A 3AZNC 5AVBC 1P3OB 5BS7A 5AY8C 3KWQA 2FJ7B 2CV5A 4DRAA 1P3KD 3MGPB 3REHC 1B6WA 5JA4A 3KWQB 3B6GD 5CPJB 2CV5B 4KGCA 5B24D 3UT9C 3AFAD 5AV8C 3WAAC 4XZQD 1ID3C 5BO0A 5JA4B 5DNND 4KGCB 5B33C 2NQBA 1KX3C 1B67A 4X23D 1HQ3A 5BO0B 3AV1D 5B32C 1ZLAC 3W97A 3AZKD 2F8NK 3W99D 1N1JA 3AZHC 2NQBB 3X1UB 3B6FB 5B0YA 5GXQA 1HQ3B 5AV5C 3W98B 5E5AD 3X1VD 3W97B 4WZSB 1N1JB 1S32A 3AV2A 5CPID 1P3LA 5B0YB 5B1MC 1P3AD 4KHAA 3MGRD 3O62C 1M1AB 1JFIA 1S32B 3REID 4R8PB 1KU5A 1P3LB 3WKJD 2AROC 4JJND 3LZ1A 1JFIB 3AZMD 3VH5T 3AZLC 4J8VD 4WV4B 3LELD 4Z5TC 3AZGA 4XUJD 3AZED 1EQZD 2F8NA 4ZBJC 5GSUC 5B0ZC 5AVBD 5AV9C 3AZGB 5CPKD 4H9QA 2F8NB 4H9PA 5B24A 5AY8D 3AFAA 4J8XC 5DNNA 4H9QB 2F8NG 3AYWC 3KXBB 3REHD 5BNVA 4X23A 3MGSB 3AZKA 3UT9D 5F99B 5AV8D 3W99A 3MGQC 1ID3D 3RELC 5AVCC 5BNVB 4WU8B 5B2JD 3MVDA 1KX3D 3W99B 4KUDC 3VH5A 5B32D 1ZLAD 2NZDC 2YFVA 4G92C 3AZHD 3MGRA 3MVDB 3AZFC 3MNNC 5AV5D 4E44A 4QLCC 3WKJA 2YFVB 4XZQC 3MGRB 1P3PA 5JRGA 3TU4D 5B1MD 3VH5W 1BH9A 3O62D 4J8VA 4HGAB 3LELA 3C1CC 4XUJA 1P3PB 5JRGB 3AZEA 2PYOB 2AROD 2HUEB 1Q9CA 3AZNA 5AVBA 3LELB 4XUJB 5E5AC 1F1EA 4YM6C 5AY8A 3AZLD 4EO5C 3AZNB 5AVBB 1M18B 1P34C 5GSUD 1P3AC 5KDMA 3REKB 3REHA 5AY8B 5B0ZD 5B40B 3C1BC 5AV9D 4Z66A 4H9NA 3X1SC 4JJNC 1P3FC 3UT9A 5KDMB 1AOIC 3REHB 4J8XD 3WAAA 5CP6B 4Z66B 4H9NB 4AWLB 3AYWD 1P3BB 5B33A 4ZUXC 1KX3A 4H9SC 1TZYD 1EQZC 3WAAB 5B32A 1ZLAA 5B33B 3MGQD 3AZHA 4YS3B 3RELD 5AVCD 4CSRA 4H9OA 5CPKC 5AV5A 5B32B 1ZLAB 3WTPA 3LZ0B 3AZHB 4KUDD 4J8UC 2RVQC 4H9OB 3B0CW 4CSRB 3UTAC 2NZDD 5AV5B 5B32G 3WTPB 3O62A 3AZFD 3W96C 3MNND 1M19A 5B31C 4J8WC 4QLCD 2AROA 3NQJA 5GT0A 1M19B 5B2JC 4WU9D 3AZLA 3NQJB 3C1CD 4Z5TA 1TAFA 1P3MA 5C3IB 5GT0B 2CWEA 1P3IC 5GSUA 3AZLB 4Z5TB 5AV9A 1TAFB 5B1LC 1P3MB 4YM6D 1P3GA 3TU4C 5GXQB 1P34D 1A7WA 3X1TD 3AYWA 5G49A 3C1BD 3AV2B 1P3GB 3X1SD 4NE6A 1P3OC 1P3FD 4KHAB 1AOID 5G49B 3MGQA 4CAYA 3RELA 5AVCA 4ZUXD 3AZJC 3LZ1B 1H3OA 4KUDA 3MGPC 3UTBC 3RELB 5AVCB 1P3KA 2NZDA 5DNMC 5CPJC 1H3OB 4KUDB 3MNNA 3B6GA 5AV6D 1P3KB 2NZDB 4QLCA 3A6ND 4XZQA 3KUYD 4NE3A 2RVQD 4J8UD 1HTAA 3MNNB 3UTAD 3B6GB 4H9PB 5B24B 4QLCB 3AFAB 4XZQB 1TZYC 3C1CA 3AV1A 3W96D 5DNNB 5B31D 3X1UC 4J8WD 3B6FC 5FUGA 3AZID 3W98C 4X23B 3WA9C 3AV1B 5E5AA 3X1VA 3AZKB 4YM6A 5B0YC 5FUGB 2F8NH 5CPIA 2HIOD 1M1AC 1ULYA 1P3ID 1S32C 1P34A 4R8PC 1P3AA 5E5AB 3X1VB 4YM6B 1KX5C 3C1BA 3REIA 5CPIB 5B1LD 4EO5B 1P34B 4JJNA 1WWIA 1P3AB 1P3FA 3AZMA 3C1BB 3REIB 4WU9C 3WKJB 1U35D 4JJNB 2BYKA 3V9RA 4H9RA 1P3FB 3AZMB 4H9SA 1EQZA 2IO5C 1P3OD 3AZGC 1BH9B 4Z2MG 2BYKB 1F66C 4J8VB 4H9RB 5CPKA 4M6BA 2FJ7D 3AZEB 1EQZB
chains in the Genus database with same CATH superfamily
1BFMA 3AZJD 3KXBC 3MGPD 1KX4C 2XD5A 3UTBD 4E45A 5CPKB 3X1TC 3H0LC 5DNMD 3UTAA 5CPJD 3MGSC 4UUZA 4NFTA 5F99C 3W96A 3B0BA 4J8WA 3UTAB 5AV8A 4KGCD 4WU8C 2Y2MA 1ID3A 1BH8A 3W96B 5B2JA 4J8WB 3REJC 3UT9B 5AV8B 5BT1D 1ID3B 2NQBD 1BH8B 3MVDC 3X1UD 5GT3C 1P3IA 3B6FD 1HQ3D 5B2JB 3W98D 1KX3B 3H0RC 3WA9D 5AV6C 1P3IB 3AL0C 5B0YD 3B0DC 3A6NC 3KUYC 1R4VA 1M1AD 3TU4A 1S32D 4HGAC 4LD9C 5B1MA 4R8PD 5JRGC 1KX5D 2PYOC 4WNNA 3TU4B 3KFUG 1P3OA 5B1MB 3AZIC 3O62B 4G91C 2BG1A 3LJAC 3AN2C 4WNNB 2DF4C 1M18C 2AROB 2ZM5A 3AZJA 2HIOC 3REKC 3MGPA 5B40C 3UTBA 2BYMA 3AZGD 5DNMA 5CPJA 2F8ND 1F66D 5B0ZA 3AZJB 5CP6C 3UTBB 2BYMB 1PZRA 4ZBJB 5GSUB 4Z66C 5DNMB 3VH6T 4AWLC 1P3BC 3KXBD 2W8SA 4J8XA 5B0ZB 1KX4D 5AV9B 5B2IC 4DRBA 1U35C 3MGSD 5F99D 4NE5A 4J8XB 1TZYA 4YS3C 3X1UA 3B6FA 3AYWB 3W98A 4WU8D 3LZ0C 2FJ7C 1TZYB 3WA9A 3REJD 2L5AA 3KSYA 4CAYB 5BS7C 3MGQB 3WTPC 1M1AA 3MVDD 3KWQC 5GT3D 3WA9B 4R8PA 2CV5C 1KX5A 3AZFA 4G92B 4KGCC 1M19C 1KX5B 3AZFB 4LD9D 4WU9A 1P3PD 3WTPE 3VH6A 5C3IC 5GT0C 5JRGD 2PYOD 5BT1C 2NQBC 1HQ3C 4WU9B 1P3MC 3W97C 3LJAD 3AN2D 2JSSA 1F66A 3C1CB 5CHLB 3AZND 2IO5B 5GXQC 1M18D 2Y2GA 3KXBA 3REKD 1KX4A 3VH6W 1F66B 5B40D 3AV2C 3X1TA 1P3GC 1P3LC 3MGSA 2ZY4A 5F99A 1KX4B 3X1SA 5CP6D 4Z66D 2Y2NA 3X1TB 1AOIA 1WWSA 1P3BD 4WU8A 3NQUA 3LZ1C 5B2ID 3X1SB 3WAAD 2LY8A 4ZUXA 3REJA 1AOIB 5B33D 4YS3D 3NQUB 5GT3A 1W2EA 4ZUXB 3V9RB 1P3KC 3LZ0D 3REJB 5AV6A 2VQRA 5GT3B 3B6GC 3A6NA 5B24C 3KUYA 3WTPD 3AFAC 3KWQD 4J8UA 2DQNC 5AV6B 2CV5D 3B0CT 4LD9A 5DNNC 2PYOA 3B0DB 5BNXA 4Z2MH 3A6NB 3KUYB 4J8UB 5B31A 4X23C 3AV1C 4LD9B 3AZIA 1M19D 4UUZB 3AZKC 3LJAA 3AN2A 3W99C 5BNXB 3A1KA 5B31B 5GT0D 1M18A 3AZIB 3X1VC 2HIOA 3LJAB 4G91B 3REKA 3AN2B 5B40A 5CPIC 4Z5TD 5B31G 1P3MD 3W97D 2HIOB 3MGRC 5B1LA 3R45A 5CP6A 5GXQD 3REIC 3WKJC 1P3BA 3AV2D 2YFWA 5B1LB 5B2IA 3R45B 3AZMC 1P3GD 1P3LD 1U35A 1P3PC 2HUEC 4YS3A 4J8VC 3LELC 2YFWB 5B2IB 4XUJC 3AZEC 1U35B 3LZ0A 3LZ1D 2FJ7A 3AZNC 2ZY3A 5AVBC 1P3OB 5BS7A 5AY8C 3KWQA 2FJ7B 2CV5A 4DRAA 1P3KD 3MGPB 3REHC 1B6WA 5JA4A 3KWQB 3B6GD 5CPJB 2CV5B 4KGCA 5B24D 3UT9C 3AFAD 5AV8C 3WAAC 4XZQD 1ID3C 5BO0A 5JA4B 5DNND 2G5HC 4KGCB 5B33C 2NQBA 2RIQA 1B67A 1KX3C 4UPKA 4X23D 1HQ3A 5BO0B 3AV1D 5B32C 1ZLAC 3W97A 3AZKD 2F8NK 3W99D 1N1JA 2Y2LA 3AZHC 2NQBB 3X1UB 3B6FB 5B0YA 5GXQA 1HQ3B 5AV5C 4DQYB 3W98B 5E5AD 3X1VD 3W97B 4WZSB 1N1JB 1S32A 3AV2A 5CPID 1P3LA 5B0YB 5B1MC 1P3AD 3EPJA 4KHAA 3MGRD 3O62C 1M1AB 1JFIA 1S32B 3REID 4R8PB 1KU5A 1P3LB 3WKJD 2ZY2A 2AROC 4JJND 3LZ1A 1JFIB 3AZMD 3VH5T 3AZLC 4J8VD 4WV4B 3LELD 4Z5TC 3AZGA 4XUJD 3AZED 1EQZD 2F8NA 4ZBJC 5GSUC 5B0ZC 5AVBD 5AV9C 3AZGB 5CPKD 4H9QA 2F8NB 4H9PA 5B24A 5AY8D 3EPKA 3AFAA 4J8XC 4WJ3C 5DNNA 3H0MC 4H9QB 2Y2IA 3AYWC 2F8NG 3KXBB 3REHD 2JE5A 5BNVA 4X23A 3MGSB 3AZKA 3UT9D 5F99B 5AV8D 3W99A 3MGQC 1ID3D 3RELC 5AVCC 5BNVB 3EPLA 2UWXA 4WU8B 5B2JD 3MVDA 1KX3D 3W99B 4KUDC 3VH5A 3EG5B 5B32D 1ZLAD 2NZDC 2YFVA 4G92C 3AZHD 3MGRA 3MVDB 2ZY5A 3AZFC 3MNNC 5AV5D 4E44A 4QLCC 3WKJA 2YFVB 2XD1A 4XZQC 3MGRB 1P3PA 5JRGA 3TU4D 5B1MD 3VH5W 1Z2CB 1BH9A 3O62D 4J8VA 4HGAB 3LELA 3C1CC 4XUJA 1P3PB 2Y2OA 5JRGB 3AZEA 2PYOB 2AROD 2HUEB 1Q9CA 3AZNA 5AVBA 3LELB 4XUJB 5E5AC 1F1EA 4YM6C 5AY8A 3AZLD 4EO5C 3AZNB 5AVBB 1M18B 1P34C 5GSUD 1P3AC 2Y2HA 5KDMA 3REKB 3REHA 5AY8B 5B0ZD 5B40B 3C1BC 5AV9D 4Z66A 4H9NA 3X1SC 4JJNC 1P3FC 3UT9A 5KDMB 1AOIC 3REHB 4J8XD 3WAAA 5CP6B 3IP4C 4Z66B 4H9NB 4AWLB 3AYWD 2JCHA 1P3BB 5B33A 4ZUXC 3EPHA 1KX3A 4H9SC 1TZYD 1EQZC 3WAAB 5B32A 1ZLAA 5B33B 3MGQD 3AZHA 4YS3B 2Y2PA 3RELD 4CSRA 4H9OA 5AVCD 5CPKC 5AV5A 5B32B 1ZLAB 3WTPA 3LZ0B 3AZHB 4KUDD 4J8UC 2RVQC 4H9OB 3B0CW 4CSRB 3FDDA 3UTAC 5AV5B 2NZDD 5B32G 3WTPB 3O62A 3AZFD 3W96C 3MNND 1M19A 5B31C 4J8WC 4QLCD 2AROA 3NQJA 3P5JB 5GT0A 1M19B 5B2JC 4WU9D 3AZLA 3NQJB 3C1CD 4Z5TA 1TAFA 1P3MA 5C3IB 5GT0B 2CWEA 1P3IC 5GSUA 3AZLB 4Z5TB 5AV9A 1TAFB 5B1LC 1P3MB 4YM6D 1P3GA 3TU4C 5GXQB 2Y2JA 1P34D 1A7WA 3X1TD 3AYWA 5G49A 2Y2KA 3C1BD 3AV2B 1P3GB 3X1SD 4NE6A 1P3OC 1P3FD 4KHAB 1AOID 5G49B 3MGQA 4CAYA 1T3UA 5AVCA 3RELA 4ZUXD 3AZJC 3LZ1B 1H3OA 4KUDA 3MGPC 2FFFB 3UTBC 3RELB 5AVCB 1P3KA 2NZDA 2G5IC 5DNMC 5CPJC 3F6TA 1H3OB 4KUDB 3MNNA 3B6GA 5AV6D 1P3KB 2NZDB 4QLCA 3A6ND 4XZQA 3KUYD 4NE3A 2RVQD 4J8UD 1HTAA 3MNNB 3UTAD 3B6GB 4H9PB 5B24B 4QLCB 3AFAB 4XZQB 1TZYC 3C1CA 3AV1A 3W96D 5DNNB 5B31D 3X1UC 4J8WD 3B6FC 2F2AC 5FUGA 3AZID 3W98C 2Y2QA 4X23B 3WA9C 3AV1B 3A1IA 5E5AA 3X1VA 3AZKB 4YM6A 5B0YC 5FUGB 2F8NH 5CPIA 2HIOD 1M1AC 1ULYA 1P3ID 1S32C 1P34A 4R8PC 1P3AA 5E5AB 3X1VB 4YM6B 1KX5C 3C1BA 3REIA 5CPIB 5B1LD 4EO5B 1P34B 4JJNA 1WWIA 1P3AB 1P3FA 2J8PA 3AZMA 3C1BB 3REIB 4WU9C 3WKJB 1U35D 4JJNB 2BYKA 3V9RA 4H9RA 1P3FB 3AZMB 4H9SA 1EQZA 2IO5C 1P3OD 3AZGC 1BH9B 4Z2MG 2BYKB 1F66C 4J8VB 4H9RB 5CPKA 4M6BA 2FJ7D 3AZEB 1EQZB
chains in the Genus database with same CATH topology
1BFMA 3AZJD 3KXBC 3MGPD 1KX4C 2XD5A 3UTBD 4E45A 5CPKB 3X1TC 3H0LC 5DNMD 3UTAA 5CPJD 3MGSC 4UUZA 4NFTA 5F99C 3W96A 3B0BA 4J8WA 3UTAB 5AV8A 4KGCD 4WU8C 2Y2MA 1ID3A 1BH8A 3W96B 5B2JA 4J8WB 3REJC 3UT9B 5AV8B 5BT1D 1ID3B 2NQBD 1BH8B 3MVDC 3X1UD 5GT3C 1P3IA 3B6FD 1HQ3D 5B2JB 3W98D 1KX3B 3H0RC 3WA9D 5AV6C 1P3IB 3AL0C 5B0YD 3B0DC 3A6NC 3KUYC 1R4VA 1M1AD 3TU4A 1S32D 4HGAC 4LD9C 5B1MA 4R8PD 5JRGC 1KX5D 2PYOC 4WNNA 3TU4B 3KFUG 1P3OA 5B1MB 3AZIC 3O62B 4G91C 2BG1A 3LJAC 3AN2C 4WNNB 2DF4C 1M18C 2AROB 2ZM5A 3AZJA 2HIOC 3REKC 3MGPA 5B40C 3UTBA 2BYMA 3AZGD 5DNMA 5CPJA 2F8ND 1F66D 5B0ZA 3AZJB 5CP6C 3UTBB 2BYMB 1PZRA 4ZBJB 5GSUB 4Z66C 5DNMB 3VH6T 4AWLC 1P3BC 3KXBD 2W8SA 4J8XA 5B0ZB 1KX4D 5AV9B 5B2IC 4DRBA 1U35C 3MGSD 5F99D 4NE5A 4J8XB 1TZYA 4YS3C 3X1UA 3B6FA 3AYWB 3W98A 4WU8D 3LZ0C 2FJ7C 1TZYB 3WA9A 3REJD 2L5AA 3KSYA 4CAYB 5BS7C 3MGQB 3WTPC 1M1AA 3MVDD 3KWQC 5GT3D 3WA9B 4R8PA 2CV5C 1KX5A 3AZFA 4G92B 4KGCC 1M19C 1KX5B 3AZFB 4LD9D 4WU9A 1P3PD 3WTPE 3VH6A 5C3IC 5GT0C 5JRGD 2PYOD 5BT1C 2NQBC 1HQ3C 4WU9B 1P3MC 3W97C 3LJAD 3AN2D 2JSSA 1F66A 3C1CB 5CHLB 3AZND 2IO5B 5GXQC 1M18D 2Y2GA 3KXBA 3REKD 1KX4A 3VH6W 1F66B 5B40D 3AV2C 3X1TA 1P3GC 1P3LC 3MGSA 2ZY4A 5F99A 1KX4B 3X1SA 5CP6D 4Z66D 2Y2NA 3X1TB 1AOIA 1WWSA 1P3BD 4WU8A 3NQUA 3LZ1C 5B2ID 3X1SB 3WAAD 2LY8A 4ZUXA 3REJA 1AOIB 5B33D 4YS3D 3NQUB 5GT3A 1W2EA 4ZUXB 3V9RB 1P3KC 3LZ0D 3REJB 5AV6A 2VQRA 5GT3B 3B6GC 3A6NA 5B24C 3KUYA 3WTPD 3AFAC 3KWQD 4J8UA 2DQNC 5AV6B 2CV5D 3B0CT 4LD9A 5DNNC 2PYOA 3B0DB 5BNXA 4Z2MH 3A6NB 3KUYB 4J8UB 5B31A 4X23C 3AV1C 4LD9B 3AZIA 1M19D 4UUZB 3AZKC 3LJAA 3AN2A 3W99C 5BNXB 3A1KA 5B31B 5GT0D 1M18A 3AZIB 3X1VC 2HIOA 3LJAB 4G91B 3REKA 3AN2B 5B40A 5CPIC 4Z5TD 5B31G 1P3MD 3W97D 2HIOB 3MGRC 5B1LA 3R45A 5CP6A 5GXQD 3REIC 3WKJC 1P3BA 3AV2D 2YFWA 5B1LB 5B2IA 3R45B 3AZMC 1P3GD 1P3LD 1U35A 1P3PC 2HUEC 4YS3A 4J8VC 3LELC 2YFWB 5B2IB 4XUJC 3AZEC 1U35B 3LZ0A 3LZ1D 2FJ7A 3AZNC 2ZY3A 5AVBC 1P3OB 5BS7A 5AY8C 3KWQA 2FJ7B 2CV5A 4DRAA 1P3KD 3MGPB 3REHC 1B6WA 5JA4A 3KWQB 3B6GD 5CPJB 2CV5B 4KGCA 5B24D 3UT9C 3AFAD 5AV8C 3WAAC 4XZQD 1ID3C 5BO0A 5JA4B 5DNND 2G5HC 4KGCB 5B33C 2NQBA 2RIQA 1B67A 1KX3C 4UPKA 4X23D 1HQ3A 5BO0B 3AV1D 5B32C 1ZLAC 3W97A 3AZKD 2F8NK 3W99D 1N1JA 2Y2LA 3AZHC 2NQBB 3X1UB 3B6FB 5B0YA 5GXQA 1HQ3B 5AV5C 4DQYB 3W98B 5E5AD 3X1VD 3W97B 4WZSB 1N1JB 1S32A 3AV2A 5CPID 1P3LA 5B0YB 5B1MC 1P3AD 3EPJA 4KHAA 3MGRD 3O62C 1M1AB 1JFIA 1S32B 3REID 4R8PB 1KU5A 1P3LB 3WKJD 2ZY2A 2AROC 4JJND 3LZ1A 1JFIB 3AZMD 3VH5T 3AZLC 4J8VD 4WV4B 3LELD 4Z5TC 3AZGA 4XUJD 3AZED 1EQZD 2F8NA 4ZBJC 5GSUC 5B0ZC 5AVBD 5AV9C 3AZGB 5CPKD 4H9QA 2F8NB 4H9PA 5B24A 5AY8D 3EPKA 3AFAA 4J8XC 4WJ3C 5DNNA 3H0MC 4H9QB 2Y2IA 3AYWC 2F8NG 3KXBB 3REHD 2JE5A 5BNVA 4X23A 3MGSB 3AZKA 3UT9D 5F99B 5AV8D 3W99A 3MGQC 1ID3D 3RELC 5AVCC 5BNVB 3EPLA 2UWXA 4WU8B 5B2JD 3MVDA 1KX3D 3W99B 4KUDC 3VH5A 3EG5B 5B32D 1ZLAD 2NZDC 2YFVA 4G92C 3AZHD 3MGRA 3MVDB 2ZY5A 3AZFC 3MNNC 5AV5D 4E44A 4QLCC 3WKJA 2YFVB 2XD1A 4XZQC 3MGRB 1P3PA 5JRGA 3TU4D 5B1MD 3VH5W 1Z2CB 1BH9A 3O62D 4J8VA 4HGAB 3LELA 3C1CC 4XUJA 1P3PB 2Y2OA 5JRGB 3AZEA 2PYOB 2AROD 2HUEB 1Q9CA 3AZNA 5AVBA 3LELB 4XUJB 5E5AC 1F1EA 4YM6C 5AY8A 3AZLD 4EO5C 3AZNB 5AVBB 1M18B 1P34C 5GSUD 1P3AC 2Y2HA 5KDMA 3REKB 3REHA 5AY8B 5B0ZD 5B40B 3C1BC 5AV9D 4Z66A 4H9NA 3X1SC 4JJNC 1P3FC 3UT9A 5KDMB 1AOIC 3REHB 4J8XD 3WAAA 5CP6B 3IP4C 4Z66B 4H9NB 4AWLB 3AYWD 2JCHA 1P3BB 5B33A 4ZUXC 3EPHA 1KX3A 4H9SC 1TZYD 1EQZC 3WAAB 5B32A 1ZLAA 5B33B 3MGQD 3AZHA 4YS3B 2Y2PA 3RELD 4CSRA 4H9OA 5AVCD 5CPKC 5AV5A 5B32B 1ZLAB 3WTPA 3LZ0B 3AZHB 4KUDD 4J8UC 2RVQC 4H9OB 3B0CW 4CSRB 3FDDA 3UTAC 5AV5B 2NZDD 5B32G 3WTPB 3O62A 3AZFD 3W96C 3MNND 1M19A 5B31C 4J8WC 4QLCD 2AROA 3NQJA 3P5JB 5GT0A 1M19B 5B2JC 4WU9D 3AZLA 3NQJB 3C1CD 4Z5TA 1TAFA 1P3MA 5C3IB 5GT0B 2CWEA 1P3IC 5GSUA 3AZLB 4Z5TB 5AV9A 1TAFB 5B1LC 1P3MB 4YM6D 1P3GA 3TU4C 5GXQB 2Y2JA 1P34D 1A7WA 3X1TD 3AYWA 5G49A 2Y2KA 3C1BD 3AV2B 1P3GB 3X1SD 4NE6A 1P3OC 1P3FD 4KHAB 1AOID 5G49B 3MGQA 4CAYA 1T3UA 5AVCA 3RELA 4ZUXD 3AZJC 3LZ1B 1H3OA 4KUDA 3MGPC 2FFFB 3UTBC 3RELB 5AVCB 1P3KA 2NZDA 2G5IC 5DNMC 5CPJC 3F6TA 1H3OB 4KUDB 3MNNA 3B6GA 5AV6D 1P3KB 2NZDB 4QLCA 3A6ND 4XZQA 3KUYD 4NE3A 2RVQD 4J8UD 1HTAA 3MNNB 3UTAD 3B6GB 4H9PB 5B24B 4QLCB 3AFAB 4XZQB 1TZYC 3C1CA 3AV1A 3W96D 5DNNB 5B31D 3X1UC 4J8WD 3B6FC 2F2AC 5FUGA 3AZID 3W98C 2Y2QA 4X23B 3WA9C 3AV1B 3A1IA 5E5AA 3X1VA 3AZKB 4YM6A 5B0YC 5FUGB 2F8NH 5CPIA 2HIOD 1M1AC 1ULYA 1P3ID 1S32C 1P34A 4R8PC 1P3AA 5E5AB 3X1VB 4YM6B 1KX5C 3C1BA 3REIA 5CPIB 5B1LD 4EO5B 1P34B 4JJNA 1WWIA 1P3AB 1P3FA 2J8PA 3AZMA 3C1BB 3REIB 4WU9C 3WKJB 1U35D 4JJNB 2BYKA 3V9RA 4H9RA 1P3FB 3AZMB 4H9SA 1EQZA 2IO5C 1P3OD 3AZGC 1BH9B 4Z2MG 2BYKB 1F66C 4J8VB 4H9RB 5CPKA 4M6BA 2FJ7D 3AZEB 1EQZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BFM A;  3AZJ D;  3KXB C;  3MGP D;  1KX4 C;  3UTB D;  4E45 A;  5CPK B;  3X1T C;  3UTA A;  5DNM D;  5CPJ D;  3MGS C;  4UUZ A;  4NFT A;  5F99 C;  3W96 A;  3B0B A;  4J8W A;  3UTA B;  5AV8 A;  4KGC D;  4WU8 C;  1ID3 A;  1BH8 A;  3W96 B;  5B2J A;  4J8W B;  3REJ C;  3UT9 B;  5AV8 B;  5BT1 D;  1ID3 B;  2NQB D;  1BH8 B;  3MVD C;  3X1U D;  5GT3 C;  1P3I A;  3B6F D;  1HQ3 D;  5B2J B;  3W98 D;  1KX3 B;  3WA9 D;  5AV6 C;  1P3I B;  5B0Y D;  3B0D C;  3A6N C;  3KUY C;  1R4V A;  1M1A D;  3TU4 A;  1S32 D;  4HGA C;  4LD9 C;  5B1M A;  4R8P D;  5JRG C;  1KX5 D;  2PYO C;  4WNN A;  3TU4 B;  1P3O A;  5B1M B;  3AZI C;  3O62 B;  4G91 C;  3LJA C;  3AN2 C;  4WNN B;  1M18 C;  2ARO B;  3AZJ A;  2HIO C;  3REK C;  3MGP A;  5B40 C;  3UTB A;  2BYM A;  3AZG D;  5DNM A;  5CPJ A;  2F8N D;  1F66 D;  5B0Z A;  3AZJ B;  5CP6 C;  3UTB B;  2BYM B;  4ZBJ B;  5GSU B;  4Z66 C;  5DNM B;  3VH6 T;  4AWL C;  1P3B C;  3KXB D;  1KX4 D;  4J8X A;  5B0Z B;  5AV9 B;  5B2I C;  4DRB A;  1U35 C;  3MGS D;  5F99 D;  4NE5 A;  4J8X B;  1TZY A;  4YS3 C;  3X1U A;  3B6F A;  3AYW B;  3W98 A;  4WU8 D;  3LZ0 C;  2FJ7 C;  1TZY B;  3WA9 A;  3REJ D;  2L5A A;  3KSY A;  4CAY B;  5BS7 C;  3MGQ B;  3WTP C;  1M1A A;  3MVD D;  3KWQ C;  5GT3 D;  3WA9 B;  4R8P A;  2CV5 C;  1KX5 A;  3AZF A;  4G92 B;  4KGC C;  1M19 C;  1KX5 B;  3AZF B;  4LD9 D;  4WU9 A;  1P3P D;  3WTP E;  3VH6 A;  5C3I C;  5GT0 C;  5JRG D;  2PYO D;  5BT1 C;  2NQB C;  1HQ3 C;  4WU9 B;  1P3M C;  3W97 C;  3LJA D;  3AN2 D;  2JSS A;  1F66 A;  3C1C B;  5CHL B;  3AZN D;  2IO5 B;  5GXQ C;  1M18 D;  3KXB A;  3REK D;  1KX4 A;  3VH6 W;  1F66 B;  5B40 D;  3AV2 C;  3X1T A;  1P3G C;  1P3L C;  3MGS A;  5F99 A;  1KX4 B;  3X1S A;  5CP6 D;  4Z66 D;  3X1T B;  1AOI A;  1WWS A;  1P3B D;  4WU8 A;  3NQU A;  3LZ1 C;  5B2I D;  3X1S B;  3WAA D;  2LY8 A;  4ZUX A;  3REJ A;  1AOI B;  5B33 D;  4YS3 D;  3NQU B;  5GT3 A;  4ZUX B;  3V9R B;  1P3K C;  3LZ0 D;  3REJ B;  5AV6 A;  5GT3 B;  3B6G C;  3A6N A;  5B24 C;  3KUY A;  3WTP D;  3AFA C;  3KWQ D;  4J8U A;  5AV6 B;  2CV5 D;  3B0C T;  4LD9 A;  5DNN C;  2PYO A;  3B0D B;  5BNX A;  4Z2M H;  3A6N B;  3KUY B;  4J8U B;  5B31 A;  4X23 C;  3AV1 C;  4LD9 B;  3AZI A;  1M19 D;  4UUZ B;  3AZK C;  3LJA A;  3AN2 A;  3W99 C;  5BNX B;  5B31 B;  5GT0 D;  1M18 A;  3AZI B;  3X1V C;  2HIO A;  3LJA B;  4G91 B;  3REK A;  3AN2 B;  5B40 A;  5CPI C;  4Z5T D;  5B31 G;  1P3M D;  3W97 D;  2HIO B;  3MGR C;  5B1L A;  3R45 A;  5CP6 A;  5GXQ D;  3REI C;  3WKJ C;  1P3B A;  3AV2 D;  2YFW A;  5B1L B;  5B2I A;  3R45 B;  3AZM C;  1P3G D;  1P3L D;  1U35 A;  1P3P C;  2HUE C;  4YS3 A;  4J8V C;  3LEL C;  2YFW B;  5B2I B;  4XUJ C;  3AZE C;  1U35 B;  3LZ0 A;  3LZ1 D;  2FJ7 A;  3AZN C;  5AVB C;  1P3O B;  5BS7 A;  5AY8 C;  3KWQ A;  2FJ7 B;  2CV5 A;  4DRA A;  1P3K D;  3MGP B;  3REH C;  1B6W A;  5JA4 A;  3KWQ B;  3B6G D;  5CPJ B;  2CV5 B;  4KGC A;  5B24 D;  3UT9 C;  3AFA D;  5AV8 C;  3WAA C;  4XZQ D;  1ID3 C;  5BO0 A;  5JA4 B;  5DNN D;  4KGC B;  5B33 C;  2NQB A;  1KX3 C;  1B67 A;  4X23 D;  1HQ3 A;  5BO0 B;  3AV1 D;  5B32 C;  1ZLA C;  3W97 A;  3AZK D;  2F8N K;  3W99 D;  1N1J A;  3AZH C;  2NQB B;  3X1U B;  3B6F B;  5B0Y A;  5GXQ A;  1HQ3 B;  5AV5 C;  3W98 B;  5E5A D;  3X1V D;  3W97 B;  4WZS B;  1N1J B;  1S32 A;  3AV2 A;  5CPI D;  1P3L A;  5B0Y B;  5B1M C;  1P3A D;  4KHA A;  3MGR D;  3O62 C;  1M1A B;  1JFI A;  1S32 B;  3REI D;  4R8P B;  1KU5 A;  1P3L B;  3WKJ D;  2ARO C;  4JJN D;  3LZ1 A;  1JFI B;  3AZM D;  3VH5 T;  3AZL C;  4J8V D;  4WV4 B;  3LEL D;  4Z5T C;  3AZG A;  4XUJ D;  3AZE D;  1EQZ D;  2F8N A;  4ZBJ C;  5GSU C;  5B0Z C;  5AVB D;  5AV9 C;  3AZG B;  5CPK D;  4H9Q A;  2F8N B;  4H9P A;  5B24 A;  5AY8 D;  3AFA A;  4J8X C;  5DNN A;  4H9Q B;  2F8N G;  3AYW C;  3KXB B;  3REH D;  5BNV A;  4X23 A;  3MGS B;  3AZK A;  3UT9 D;  5F99 B;  5AV8 D;  3W99 A;  3MGQ C;  1ID3 D;  3REL C;  5AVC C;  5BNV B;  4WU8 B;  5B2J D;  3MVD A;  1KX3 D;  3W99 B;  4KUD C;  3VH5 A;  5B32 D;  1ZLA D;  2NZD C;  2YFV A;  4G92 C;  3AZH D;  3MGR A;  3MVD B;  3AZF C;  3MNN C;  5AV5 D;  4E44 A;  4QLC C;  3WKJ A;  2YFV B;  4XZQ C;  3MGR B;  1P3P A;  5JRG A;  3TU4 D;  5B1M D;  3VH5 W;  1BH9 A;  3O62 D;  4J8V A;  4HGA B;  3LEL A;  3C1C C;  4XUJ A;  1P3P B;  5JRG B;  3AZE A;  2PYO B;  2ARO D;  2HUE B;  1Q9C A;  3AZN A;  5AVB A;  3LEL B;  4XUJ B;  5E5A C;  1F1E A;  4YM6 C;  5AY8 A;  3AZL D;  4EO5 C;  3AZN B;  5AVB B;  1M18 B;  1P34 C;  5GSU D;  1P3A C;  5KDM A;  3REK B;  3REH A;  5AY8 B;  5B0Z D;  5B40 B;  3C1B C;  5AV9 D;  4Z66 A;  4H9N A;  3X1S C;  4JJN C;  1P3F C;  3UT9 A;  5KDM B;  1AOI C;  3REH B;  4J8X D;  3WAA A;  5CP6 B;  4Z66 B;  4H9N B;  4AWL B;  3AYW D;  1P3B B;  5B33 A;  4ZUX C;  1KX3 A;  4H9S C;  1TZY D;  1EQZ C;  3WAA B;  5B32 A;  1ZLA A;  5B33 B;  3MGQ D;  3AZH A;  4YS3 B;  3REL D;  5AVC D;  4CSR A;  4H9O A;  5CPK C;  5AV5 A;  5B32 B;  1ZLA B;  3WTP A;  3LZ0 B;  3AZH B;  4KUD D;  4J8U C;  2RVQ C;  4H9O B;  3B0C W;  4CSR B;  3UTA C;  2NZD D;  5AV5 B;  5B32 G;  3WTP B;  3O62 A;  3AZF D;  3W96 C;  3MNN D;  1M19 A;  5B31 C;  4J8W C;  4QLC D;  2ARO A;  3NQJ A;  5GT0 A;  1M19 B;  5B2J C;  4WU9 D;  3AZL A;  3NQJ B;  3C1C D;  4Z5T A;  1TAF A;  1P3M A;  5C3I B;  5GT0 B;  2CWE A;  1P3I C;  5GSU A;  3AZL B;  4Z5T B;  5AV9 A;  1TAF B;  5B1L C;  1P3M B;  4YM6 D;  1P3G A;  3TU4 C;  5GXQ B;  1P34 D;  1A7W A;  3X1T D;  3AYW A;  5G49 A;  3C1B D;  3AV2 B;  1P3G B;  3X1S D;  4NE6 A;  1P3O C;  1P3F D;  4KHA B;  1AOI D;  5G49 B;  3MGQ A;  4CAY A;  3REL A;  5AVC A;  4ZUX D;  3AZJ C;  3LZ1 B;  1H3O A;  4KUD A;  3MGP C;  3UTB C;  3REL B;  5AVC B;  1P3K A;  2NZD A;  5DNM C;  5CPJ C;  1H3O B;  4KUD B;  3MNN A;  3B6G A;  5AV6 D;  1P3K B;  2NZD B;  4QLC A;  3A6N D;  4XZQ A;  3KUY D;  4NE3 A;  2RVQ D;  4J8U D;  1HTA A;  3MNN B;  3UTA D;  3B6G B;  4H9P B;  5B24 B;  4QLC B;  3AFA B;  4XZQ B;  1TZY C;  3C1C A;  3AV1 A;  3W96 D;  5DNN B;  5B31 D;  3X1U C;  4J8W D;  3B6F C;  5FUG A;  3AZI D;  3W98 C;  4X23 B;  3WA9 C;  3AV1 B;  5E5A A;  3X1V A;  3AZK B;  4YM6 A;  5B0Y C;  5FUG B;  2F8N H;  5CPI A;  2HIO D;  1M1A C;  1ULY A;  1P3I D;  1S32 C;  1P34 A;  4R8P C;  1P3A A;  5E5A B;  3X1V B;  4YM6 B;  1KX5 C;  3C1B A;  3REI A;  5CPI B;  5B1L D;  4EO5 B;  1P34 B;  4JJN A;  1WWI A;  1P3A B;  1P3F A;  3AZM A;  3C1B B;  3REI B;  4WU9 C;  3WKJ B;  1U35 D;  4JJN B;  2BYK A;  3V9R A;  4H9R A;  1P3F B;  3AZM B;  4H9S A;  1EQZ A;  2IO5 C;  1P3O D;  3AZG C;  1BH9 B;  4Z2M G;  2BYK B;  1F66 C;  4J8V B;  4H9R B;  5CPK A;  4M6B A;  2FJ7 D;  3AZE B;  1EQZ B; 
#chains in the Genus database with same CATH topology
 1BFM A;  3AZJ D;  3KXB C;  3MGP D;  1KX4 C;  2XD5 A;  3UTB D;  4E45 A;  5CPK B;  3X1T C;  3H0L C;  5DNM D;  3UTA A;  5CPJ D;  3MGS C;  4UUZ A;  4NFT A;  5F99 C;  3W96 A;  3B0B A;  4J8W A;  3UTA B;  5AV8 A;  4KGC D;  4WU8 C;  2Y2M A;  1ID3 A;  1BH8 A;  3W96 B;  5B2J A;  4J8W B;  3REJ C;  3UT9 B;  5AV8 B;  5BT1 D;  1ID3 B;  2NQB D;  1BH8 B;  3MVD C;  3X1U D;  5GT3 C;  1P3I A;  3B6F D;  1HQ3 D;  5B2J B;  3W98 D;  1KX3 B;  3H0R C;  3WA9 D;  5AV6 C;  1P3I B;  3AL0 C;  5B0Y D;  3B0D C;  3A6N C;  3KUY C;  1R4V A;  1M1A D;  3TU4 A;  1S32 D;  4HGA C;  4LD9 C;  5B1M A;  4R8P D;  5JRG C;  1KX5 D;  2PYO C;  4WNN A;  3TU4 B;  3KFU G;  1P3O A;  5B1M B;  3AZI C;  3O62 B;  4G91 C;  2BG1 A;  3LJA C;  3AN2 C;  4WNN B;  2DF4 C;  1M18 C;  2ARO B;  2ZM5 A;  3AZJ A;  2HIO C;  3REK C;  3MGP A;  5B40 C;  3UTB A;  2BYM A;  3AZG D;  5DNM A;  5CPJ A;  2F8N D;  1F66 D;  5B0Z A;  3AZJ B;  5CP6 C;  3UTB B;  2BYM B;  1PZR A;  4ZBJ B;  5GSU B;  4Z66 C;  5DNM B;  3VH6 T;  4AWL C;  1P3B C;  3KXB D;  2W8S A;  4J8X A;  5B0Z B;  1KX4 D;  5AV9 B;  5B2I C;  4DRB A;  1U35 C;  3MGS D;  5F99 D;  4NE5 A;  4J8X B;  1TZY A;  4YS3 C;  3X1U A;  3B6F A;  3AYW B;  3W98 A;  4WU8 D;  3LZ0 C;  2FJ7 C;  1TZY B;  3WA9 A;  3REJ D;  2L5A A;  3KSY A;  4CAY B;  5BS7 C;  3MGQ B;  3WTP C;  1M1A A;  3MVD D;  3KWQ C;  5GT3 D;  3WA9 B;  4R8P A;  2CV5 C;  1KX5 A;  3AZF A;  4G92 B;  4KGC C;  1M19 C;  1KX5 B;  3AZF B;  4LD9 D;  4WU9 A;  1P3P D;  3WTP E;  3VH6 A;  5C3I C;  5GT0 C;  5JRG D;  2PYO D;  5BT1 C;  2NQB C;  1HQ3 C;  4WU9 B;  1P3M C;  3W97 C;  3LJA D;  3AN2 D;  2JSS A;  1F66 A;  3C1C B;  5CHL B;  3AZN D;  2IO5 B;  5GXQ C;  1M18 D;  2Y2G A;  3KXB A;  3REK D;  1KX4 A;  3VH6 W;  1F66 B;  5B40 D;  3AV2 C;  3X1T A;  1P3G C;  1P3L C;  3MGS A;  2ZY4 A;  5F99 A;  1KX4 B;  3X1S A;  5CP6 D;  4Z66 D;  2Y2N A;  3X1T B;  1AOI A;  1WWS A;  1P3B D;  4WU8 A;  3NQU A;  3LZ1 C;  5B2I D;  3X1S B;  3WAA D;  2LY8 A;  4ZUX A;  3REJ A;  1AOI B;  5B33 D;  4YS3 D;  3NQU B;  5GT3 A;  1W2E A;  4ZUX B;  3V9R B;  1P3K C;  3LZ0 D;  3REJ B;  5AV6 A;  2VQR A;  5GT3 B;  3B6G C;  3A6N A;  5B24 C;  3KUY A;  3WTP D;  3AFA C;  3KWQ D;  4J8U A;  2DQN C;  5AV6 B;  2CV5 D;  3B0C T;  4LD9 A;  5DNN C;  2PYO A;  3B0D B;  5BNX A;  4Z2M H;  3A6N B;  3KUY B;  4J8U B;  5B31 A;  4X23 C;  3AV1 C;  4LD9 B;  3AZI A;  1M19 D;  4UUZ B;  3AZK C;  3LJA A;  3AN2 A;  3W99 C;  5BNX B;  3A1K A;  5B31 B;  5GT0 D;  1M18 A;  3AZI B;  3X1V C;  2HIO A;  3LJA B;  4G91 B;  3REK A;  3AN2 B;  5B40 A;  5CPI C;  4Z5T D;  5B31 G;  1P3M D;  3W97 D;  2HIO B;  3MGR C;  5B1L A;  3R45 A;  5CP6 A;  5GXQ D;  3REI C;  3WKJ C;  1P3B A;  3AV2 D;  2YFW A;  5B1L B;  5B2I A;  3R45 B;  3AZM C;  1P3G D;  1P3L D;  1U35 A;  1P3P C;  2HUE C;  4YS3 A;  4J8V C;  3LEL C;  2YFW B;  5B2I B;  4XUJ C;  3AZE C;  1U35 B;  3LZ0 A;  3LZ1 D;  2FJ7 A;  3AZN C;  2ZY3 A;  5AVB C;  1P3O B;  5BS7 A;  5AY8 C;  3KWQ A;  2FJ7 B;  2CV5 A;  4DRA A;  1P3K D;  3MGP B;  3REH C;  1B6W A;  5JA4 A;  3KWQ B;  3B6G D;  5CPJ B;  2CV5 B;  4KGC A;  5B24 D;  3UT9 C;  3AFA D;  5AV8 C;  3WAA C;  4XZQ D;  1ID3 C;  5BO0 A;  5JA4 B;  5DNN D;  2G5H C;  4KGC B;  5B33 C;  2NQB A;  2RIQ A;  1B67 A;  1KX3 C;  4UPK A;  4X23 D;  1HQ3 A;  5BO0 B;  3AV1 D;  5B32 C;  1ZLA C;  3W97 A;  3AZK D;  2F8N K;  3W99 D;  1N1J A;  2Y2L A;  3AZH C;  2NQB B;  3X1U B;  3B6F B;  5B0Y A;  5GXQ A;  1HQ3 B;  5AV5 C;  4DQY B;  3W98 B;  5E5A D;  3X1V D;  3W97 B;  4WZS B;  1N1J B;  1S32 A;  3AV2 A;  5CPI D;  1P3L A;  5B0Y B;  5B1M C;  1P3A D;  3EPJ A;  4KHA A;  3MGR D;  3O62 C;  1M1A B;  1JFI A;  1S32 B;  3REI D;  4R8P B;  1KU5 A;  1P3L B;  3WKJ D;  2ZY2 A;  2ARO C;  4JJN D;  3LZ1 A;  1JFI B;  3AZM D;  3VH5 T;  3AZL C;  4J8V D;  4WV4 B;  3LEL D;  4Z5T C;  3AZG A;  4XUJ D;  3AZE D;  1EQZ D;  2F8N A;  4ZBJ C;  5GSU C;  5B0Z C;  5AVB D;  5AV9 C;  3AZG B;  5CPK D;  4H9Q A;  2F8N B;  4H9P A;  5B24 A;  5AY8 D;  3EPK A;  3AFA A;  4J8X C;  4WJ3 C;  5DNN A;  3H0M C;  4H9Q B;  2Y2I A;  3AYW C;  2F8N G;  3KXB B;  3REH D;  2JE5 A;  5BNV A;  4X23 A;  3MGS B;  3AZK A;  3UT9 D;  5F99 B;  5AV8 D;  3W99 A;  3MGQ C;  1ID3 D;  3REL C;  5AVC C;  5BNV B;  3EPL A;  2UWX A;  4WU8 B;  5B2J D;  3MVD A;  1KX3 D;  3W99 B;  4KUD C;  3VH5 A;  3EG5 B;  5B32 D;  1ZLA D;  2NZD C;  2YFV A;  4G92 C;  3AZH D;  3MGR A;  3MVD B;  2ZY5 A;  3AZF C;  3MNN C;  5AV5 D;  4E44 A;  4QLC C;  3WKJ A;  2YFV B;  2XD1 A;  4XZQ C;  3MGR B;  1P3P A;  5JRG A;  3TU4 D;  5B1M D;  3VH5 W;  1Z2C B;  1BH9 A;  3O62 D;  4J8V A;  4HGA B;  3LEL A;  3C1C C;  4XUJ A;  1P3P B;  2Y2O A;  5JRG B;  3AZE A;  2PYO B;  2ARO D;  2HUE B;  1Q9C A;  3AZN A;  5AVB A;  3LEL B;  4XUJ B;  5E5A C;  1F1E A;  4YM6 C;  5AY8 A;  3AZL D;  4EO5 C;  3AZN B;  5AVB B;  1M18 B;  1P34 C;  5GSU D;  1P3A C;  2Y2H A;  5KDM A;  3REK B;  3REH A;  5AY8 B;  5B0Z D;  5B40 B;  3C1B C;  5AV9 D;  4Z66 A;  4H9N A;  3X1S C;  4JJN C;  1P3F C;  3UT9 A;  5KDM B;  1AOI C;  3REH B;  4J8X D;  3WAA A;  5CP6 B;  3IP4 C;  4Z66 B;  4H9N B;  4AWL B;  3AYW D;  2JCH A;  1P3B B;  5B33 A;  4ZUX C;  3EPH A;  1KX3 A;  4H9S C;  1TZY D;  1EQZ C;  3WAA B;  5B32 A;  1ZLA A;  5B33 B;  3MGQ D;  3AZH A;  4YS3 B;  2Y2P A;  3REL D;  4CSR A;  4H9O A;  5AVC D;  5CPK C;  5AV5 A;  5B32 B;  1ZLA B;  3WTP A;  3LZ0 B;  3AZH B;  4KUD D;  4J8U C;  2RVQ C;  4H9O B;  3B0C W;  4CSR B;  3FDD A;  3UTA C;  5AV5 B;  2NZD D;  5B32 G;  3WTP B;  3O62 A;  3AZF D;  3W96 C;  3MNN D;  1M19 A;  5B31 C;  4J8W C;  4QLC D;  2ARO A;  3NQJ A;  3P5J B;  5GT0 A;  1M19 B;  5B2J C;  4WU9 D;  3AZL A;  3NQJ B;  3C1C D;  4Z5T A;  1TAF A;  1P3M A;  5C3I B;  5GT0 B;  2CWE A;  1P3I C;  5GSU A;  3AZL B;  4Z5T B;  5AV9 A;  1TAF B;  5B1L C;  1P3M B;  4YM6 D;  1P3G A;  3TU4 C;  5GXQ B;  2Y2J A;  1P34 D;  1A7W A;  3X1T D;  3AYW A;  5G49 A;  2Y2K A;  3C1B D;  3AV2 B;  1P3G B;  3X1S D;  4NE6 A;  1P3O C;  1P3F D;  4KHA B;  1AOI D;  5G49 B;  3MGQ A;  4CAY A;  1T3U A;  5AVC A;  3REL A;  4ZUX D;  3AZJ C;  3LZ1 B;  1H3O A;  4KUD A;  3MGP C;  2FFF B;  3UTB C;  3REL B;  5AVC B;  1P3K A;  2NZD A;  2G5I C;  5DNM C;  5CPJ C;  3F6T A;  1H3O B;  4KUD B;  3MNN A;  3B6G A;  5AV6 D;  1P3K B;  2NZD B;  4QLC A;  3A6N D;  4XZQ A;  3KUY D;  4NE3 A;  2RVQ D;  4J8U D;  1HTA A;  3MNN B;  3UTA D;  3B6G B;  4H9P B;  5B24 B;  4QLC B;  3AFA B;  4XZQ B;  1TZY C;  3C1C A;  3AV1 A;  3W96 D;  5DNN B;  5B31 D;  3X1U C;  4J8W D;  3B6F C;  2F2A C;  5FUG A;  3AZI D;  3W98 C;  2Y2Q A;  4X23 B;  3WA9 C;  3AV1 B;  3A1I A;  5E5A A;  3X1V A;  3AZK B;  4YM6 A;  5B0Y C;  5FUG B;  2F8N H;  5CPI A;  2HIO D;  1M1A C;  1ULY A;  1P3I D;  1S32 C;  1P34 A;  4R8P C;  1P3A A;  5E5A B;  3X1V B;  4YM6 B;  1KX5 C;  3C1B A;  3REI A;  5CPI B;  5B1L D;  4EO5 B;  1P34 B;  4JJN A;  1WWI A;  1P3A B;  1P3F A;  2J8P A;  3AZM A;  3C1B B;  3REI B;  4WU9 C;  3WKJ B;  1U35 D;  4JJN B;  2BYK A;  3V9R A;  4H9R A;  1P3F B;  3AZM B;  4H9S A;  1EQZ A;  2IO5 C;  1P3O D;  3AZG C;  1BH9 B;  4Z2M G;  2BYK B;  1F66 C;  4J8V B;  4H9R B;  5CPK A;  4M6B A;  2FJ7 D;  3AZE B;  1EQZ B; 
#chains in the Genus database with same CATH homology
 1BFM A;  3AZJ D;  3KXB C;  3MGP D;  1KX4 C;  2XD5 A;  3UTB D;  4E45 A;  5CPK B;  3X1T C;  3H0L C;  5DNM D;  3UTA A;  5CPJ D;  3MGS C;  4UUZ A;  4NFT A;  5F99 C;  3W96 A;  3B0B A;  4J8W A;  3UTA B;  5AV8 A;  4KGC D;  4WU8 C;  2Y2M A;  1ID3 A;  1BH8 A;  3W96 B;  5B2J A;  4J8W B;  3REJ C;  3UT9 B;  5AV8 B;  5BT1 D;  1ID3 B;  2NQB D;  1BH8 B;  3MVD C;  3X1U D;  5GT3 C;  1P3I A;  3B6F D;  1HQ3 D;  5B2J B;  3W98 D;  1KX3 B;  3H0R C;  3WA9 D;  5AV6 C;  1P3I B;  3AL0 C;  5B0Y D;  3B0D C;  3A6N C;  3KUY C;  1R4V A;  1M1A D;  3TU4 A;  1S32 D;  4HGA C;  4LD9 C;  5B1M A;  4R8P D;  5JRG C;  1KX5 D;  2PYO C;  4WNN A;  3TU4 B;  3KFU G;  1P3O A;  5B1M B;  3AZI C;  3O62 B;  4G91 C;  2BG1 A;  3LJA C;  3AN2 C;  4WNN B;  2DF4 C;  1M18 C;  2ARO B;  2ZM5 A;  3AZJ A;  2HIO C;  3REK C;  3MGP A;  5B40 C;  3UTB A;  2BYM A;  3AZG D;  5DNM A;  5CPJ A;  2F8N D;  1F66 D;  5B0Z A;  3AZJ B;  5CP6 C;  3UTB B;  2BYM B;  1PZR A;  4ZBJ B;  5GSU B;  4Z66 C;  5DNM B;  3VH6 T;  4AWL C;  1P3B C;  3KXB D;  2W8S A;  4J8X A;  5B0Z B;  1KX4 D;  5AV9 B;  5B2I C;  4DRB A;  1U35 C;  3MGS D;  5F99 D;  4NE5 A;  4J8X B;  1TZY A;  4YS3 C;  3X1U A;  3B6F A;  3AYW B;  3W98 A;  4WU8 D;  3LZ0 C;  2FJ7 C;  1TZY B;  3WA9 A;  3REJ D;  2L5A A;  3KSY A;  4CAY B;  5BS7 C;  3MGQ B;  3WTP C;  1M1A A;  3MVD D;  3KWQ C;  5GT3 D;  3WA9 B;  4R8P A;  2CV5 C;  1KX5 A;  3AZF A;  4G92 B;  4KGC C;  1M19 C;  1KX5 B;  3AZF B;  4LD9 D;  4WU9 A;  1P3P D;  3WTP E;  3VH6 A;  5C3I C;  5GT0 C;  5JRG D;  2PYO D;  5BT1 C;  2NQB C;  1HQ3 C;  4WU9 B;  1P3M C;  3W97 C;  3LJA D;  3AN2 D;  2JSS A;  1F66 A;  3C1C B;  5CHL B;  3AZN D;  2IO5 B;  5GXQ C;  1M18 D;  2Y2G A;  3KXB A;  3REK D;  1KX4 A;  3VH6 W;  1F66 B;  5B40 D;  3AV2 C;  3X1T A;  1P3G C;  1P3L C;  3MGS A;  2ZY4 A;  5F99 A;  1KX4 B;  3X1S A;  5CP6 D;  4Z66 D;  2Y2N A;  3X1T B;  1AOI A;  1WWS A;  1P3B D;  4WU8 A;  3NQU A;  3LZ1 C;  5B2I D;  3X1S B;  3WAA D;  2LY8 A;  4ZUX A;  3REJ A;  1AOI B;  5B33 D;  4YS3 D;  3NQU B;  5GT3 A;  1W2E A;  4ZUX B;  3V9R B;  1P3K C;  3LZ0 D;  3REJ B;  5AV6 A;  2VQR A;  5GT3 B;  3B6G C;  3A6N A;  5B24 C;  3KUY A;  3WTP D;  3AFA C;  3KWQ D;  4J8U A;  2DQN C;  5AV6 B;  2CV5 D;  3B0C T;  4LD9 A;  5DNN C;  2PYO A;  3B0D B;  5BNX A;  4Z2M H;  3A6N B;  3KUY B;  4J8U B;  5B31 A;  4X23 C;  3AV1 C;  4LD9 B;  3AZI A;  1M19 D;  4UUZ B;  3AZK C;  3LJA A;  3AN2 A;  3W99 C;  5BNX B;  3A1K A;  5B31 B;  5GT0 D;  1M18 A;  3AZI B;  3X1V C;  2HIO A;  3LJA B;  4G91 B;  3REK A;  3AN2 B;  5B40 A;  5CPI C;  4Z5T D;  5B31 G;  1P3M D;  3W97 D;  2HIO B;  3MGR C;  5B1L A;  3R45 A;  5CP6 A;  5GXQ D;  3REI C;  3WKJ C;  1P3B A;  3AV2 D;  2YFW A;  5B1L B;  5B2I A;  3R45 B;  3AZM C;  1P3G D;  1P3L D;  1U35 A;  1P3P C;  2HUE C;  4YS3 A;  4J8V C;  3LEL C;  2YFW B;  5B2I B;  4XUJ C;  3AZE C;  1U35 B;  3LZ0 A;  3LZ1 D;  2FJ7 A;  3AZN C;  2ZY3 A;  5AVB C;  1P3O B;  5BS7 A;  5AY8 C;  3KWQ A;  2FJ7 B;  2CV5 A;  4DRA A;  1P3K D;  3MGP B;  3REH C;  1B6W A;  5JA4 A;  3KWQ B;  3B6G D;  5CPJ B;  2CV5 B;  4KGC A;  5B24 D;  3UT9 C;  3AFA D;  5AV8 C;  3WAA C;  4XZQ D;  1ID3 C;  5BO0 A;  5JA4 B;  5DNN D;  2G5H C;  4KGC B;  5B33 C;  2NQB A;  2RIQ A;  1B67 A;  1KX3 C;  4UPK A;  4X23 D;  1HQ3 A;  5BO0 B;  3AV1 D;  5B32 C;  1ZLA C;  3W97 A;  3AZK D;  2F8N K;  3W99 D;  1N1J A;  2Y2L A;  3AZH C;  2NQB B;  3X1U B;  3B6F B;  5B0Y A;  5GXQ A;  1HQ3 B;  5AV5 C;  4DQY B;  3W98 B;  5E5A D;  3X1V D;  3W97 B;  4WZS B;  1N1J B;  1S32 A;  3AV2 A;  5CPI D;  1P3L A;  5B0Y B;  5B1M C;  1P3A D;  3EPJ A;  4KHA A;  3MGR D;  3O62 C;  1M1A B;  1JFI A;  1S32 B;  3REI D;  4R8P B;  1KU5 A;  1P3L B;  3WKJ D;  2ZY2 A;  2ARO C;  4JJN D;  3LZ1 A;  1JFI B;  3AZM D;  3VH5 T;  3AZL C;  4J8V D;  4WV4 B;  3LEL D;  4Z5T C;  3AZG A;  4XUJ D;  3AZE D;  1EQZ D;  2F8N A;  4ZBJ C;  5GSU C;  5B0Z C;  5AVB D;  5AV9 C;  3AZG B;  5CPK D;  4H9Q A;  2F8N B;  4H9P A;  5B24 A;  5AY8 D;  3EPK A;  3AFA A;  4J8X C;  4WJ3 C;  5DNN A;  3H0M C;  4H9Q B;  2Y2I A;  3AYW C;  2F8N G;  3KXB B;  3REH D;  2JE5 A;  5BNV A;  4X23 A;  3MGS B;  3AZK A;  3UT9 D;  5F99 B;  5AV8 D;  3W99 A;  3MGQ C;  1ID3 D;  3REL C;  5AVC C;  5BNV B;  3EPL A;  2UWX A;  4WU8 B;  5B2J D;  3MVD A;  1KX3 D;  3W99 B;  4KUD C;  3VH5 A;  3EG5 B;  5B32 D;  1ZLA D;  2NZD C;  2YFV A;  4G92 C;  3AZH D;  3MGR A;  3MVD B;  2ZY5 A;  3AZF C;  3MNN C;  5AV5 D;  4E44 A;  4QLC C;  3WKJ A;  2YFV B;  2XD1 A;  4XZQ C;  3MGR B;  1P3P A;  5JRG A;  3TU4 D;  5B1M D;  3VH5 W;  1Z2C B;  1BH9 A;  3O62 D;  4J8V A;  4HGA B;  3LEL A;  3C1C C;  4XUJ A;  1P3P B;  2Y2O A;  5JRG B;  3AZE A;  2PYO B;  2ARO D;  2HUE B;  1Q9C A;  3AZN A;  5AVB A;  3LEL B;  4XUJ B;  5E5A C;  1F1E A;  4YM6 C;  5AY8 A;  3AZL D;  4EO5 C;  3AZN B;  5AVB B;  1M18 B;  1P34 C;  5GSU D;  1P3A C;  2Y2H A;  5KDM A;  3REK B;  3REH A;  5AY8 B;  5B0Z D;  5B40 B;  3C1B C;  5AV9 D;  4Z66 A;  4H9N A;  3X1S C;  4JJN C;  1P3F C;  3UT9 A;  5KDM B;  1AOI C;  3REH B;  4J8X D;  3WAA A;  5CP6 B;  3IP4 C;  4Z66 B;  4H9N B;  4AWL B;  3AYW D;  2JCH A;  1P3B B;  5B33 A;  4ZUX C;  3EPH A;  1KX3 A;  4H9S C;  1TZY D;  1EQZ C;  3WAA B;  5B32 A;  1ZLA A;  5B33 B;  3MGQ D;  3AZH A;  4YS3 B;  2Y2P A;  3REL D;  4CSR A;  4H9O A;  5AVC D;  5CPK C;  5AV5 A;  5B32 B;  1ZLA B;  3WTP A;  3LZ0 B;  3AZH B;  4KUD D;  4J8U C;  2RVQ C;  4H9O B;  3B0C W;  4CSR B;  3FDD A;  3UTA C;  5AV5 B;  2NZD D;  5B32 G;  3WTP B;  3O62 A;  3AZF D;  3W96 C;  3MNN D;  1M19 A;  5B31 C;  4J8W C;  4QLC D;  2ARO A;  3NQJ A;  3P5J B;  5GT0 A;  1M19 B;  5B2J C;  4WU9 D;  3AZL A;  3NQJ B;  3C1C D;  4Z5T A;  1TAF A;  1P3M A;  5C3I B;  5GT0 B;  2CWE A;  1P3I C;  5GSU A;  3AZL B;  4Z5T B;  5AV9 A;  1TAF B;  5B1L C;  1P3M B;  4YM6 D;  1P3G A;  3TU4 C;  5GXQ B;  2Y2J A;  1P34 D;  1A7W A;  3X1T D;  3AYW A;  5G49 A;  2Y2K A;  3C1B D;  3AV2 B;  1P3G B;  3X1S D;  4NE6 A;  1P3O C;  1P3F D;  4KHA B;  1AOI D;  5G49 B;  3MGQ A;  4CAY A;  1T3U A;  5AVC A;  3REL A;  4ZUX D;  3AZJ C;  3LZ1 B;  1H3O A;  4KUD A;  3MGP C;  2FFF B;  3UTB C;  3REL B;  5AVC B;  1P3K A;  2NZD A;  2G5I C;  5DNM C;  5CPJ C;  3F6T A;  1H3O B;  4KUD B;  3MNN A;  3B6G A;  5AV6 D;  1P3K B;  2NZD B;  4QLC A;  3A6N D;  4XZQ A;  3KUY D;  4NE3 A;  2RVQ D;  4J8U D;  1HTA A;  3MNN B;  3UTA D;  3B6G B;  4H9P B;  5B24 B;  4QLC B;  3AFA B;  4XZQ B;  1TZY C;  3C1C A;  3AV1 A;  3W96 D;  5DNN B;  5B31 D;  3X1U C;  4J8W D;  3B6F C;  2F2A C;  5FUG A;  3AZI D;  3W98 C;  2Y2Q A;  4X23 B;  3WA9 C;  3AV1 B;  3A1I A;  5E5A A;  3X1V A;  3AZK B;  4YM6 A;  5B0Y C;  5FUG B;  2F8N H;  5CPI A;  2HIO D;  1M1A C;  1ULY A;  1P3I D;  1S32 C;  1P34 A;  4R8P C;  1P3A A;  5E5A B;  3X1V B;  4YM6 B;  1KX5 C;  3C1B A;  3REI A;  5CPI B;  5B1L D;  4EO5 B;  1P34 B;  4JJN A;  1WWI A;  1P3A B;  1P3F A;  2J8P A;  3AZM A;  3C1B B;  3REI B;  4WU9 C;  3WKJ B;  1U35 D;  4JJN B;  2BYK A;  3V9R A;  4H9R A;  1P3F B;  3AZM B;  4H9S A;  1EQZ A;  2IO5 C;  1P3O D;  3AZG C;  1BH9 B;  4Z2M G;  2BYK B;  1F66 C;  4J8V B;  4H9R B;  5CPK A;  4M6B A;  2FJ7 D;  3AZE B;  1EQZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...