3KWQA

Structural characterization of h3k56q nucleosomes and nucleosomal arrays
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
98
structure length
98
Chain Sequence
PHRYRPGTVALREIRRYQESTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Structural characterization of H3K56Q nucleosomes and nucleosomal arrays.
pubmed doi rcsb
source organism Xenopus laevis
total genus 32
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2009-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3kwqA00
3X1VB 3WKJA 1U35B 5F99D 1P3FB 3KXBC 3B6GC 3REHD 4CAYA 5JRGC 5GT3A 4YS3B 1M18D 5BO0A 1KX3C 1R4VA 2PYOA 2YFVB 3AZEB 5AV9C 4J8WA 3X1SA 3LELA 1F66C 2BYKB 3REJD 3WAAC 4KUDA 3AZJA 4WU8D 3MVDA 1BH9A 4WU9D 1P3OC 1HQ3D 1ID3A 5AVBD 4YM6C 4ZBJC 4G92B 3REHB 5B40C 5CPID 4H9OB 1KX5C 3X1TC 1M1AB 4KGCD 5B2IB 3X1VC 1U35C 1KX4B 3AYWD 5AV6B 5CPKB 5AY8D 1HTAA 1P3PA 3REJB 2HIOD 3UTAD 3AZKC 3AZLA 3KWQD 4J8VB 4WU8B 2HUEB 3AZNA 5AVBB 3MGRC 3W96B 3WTPB 2IO5B 3MNND 2FJ7C 1P3MD 1P3LB 4ZUXA 4KHAB 1TZYD 4X23B 3MGSD 4Z66B 5BT1D 3AN2B 3B6FA 1ZLAA 1P3AD 1EQZC 1B6WA 3AFAB 5GT0C 5B33B 1S32B 1WWIA 1P3KB 5KDMB 5CPJD 5C3IB 4UUZB 3KSYA 4J8XB 5CPKC 3W98B 4NE5A 5B2JD 3TU4C 5B32A 3B0BA 5GSUB 3AZMD 3AV2A 3WA9C 3X1UA 3VH6W 3AV1C 4J8VC 3LZ1C 2FJ7A 3KXBD 5B0YA 5B1LD 1P3IB 2HUEC 5JRGD 1TZYB 2NZDC 4CAYB 1KX3D 3W97C 3AZID 5E5AC 5BO0B 3WTPC 1P3AB 3LJAA 2PYOB 3AZGC 4JJNA 5AV9D 5B1MC 1N1JA 4H9SA 3REKB 4J8WB 1P3LC 1F66D 1BFMA 3KUYA 3B0CT 3AN2C 5B24C 5B0ZB 3WAAD 3R45A 3AFAC 5B2JB 3REIB 5BNVA 3AZJB 5B33C 4H9RA 4KUDB 2AROA 1S32C 1P3OD 1P3KC 1BH9B 1BH8A 5C3IC 3NQJB 3LZ0A 4YM6D 3KXBB 3B6GB 5B40D 4J8XC 2NQBA 3W98C 4NE6A 1AOIC 1KX5D 1KX3B 4J8UA 5GSUC 3X1VD 1U35D 1P3FD 3WKJC 4WV4B 4YS3D 5GT3C 1P3PB 3WAAB 1TAFB 3AZKD 2F8ND 2PYOC 2CV5A 1P3OB 4J8WC 3LELC 3X1SC 3AZFA 3MGRD 4WU9A 4YM6B 4G91B 1HQ3A 3V9RA 5B40B 5GXQA 4KUDC 5CPIA 3X1TB 5DNMA 3MVDC 3W99A 3C1CA 5BNXA 1ID3C 4KGCA 3B6FB 1ZLAB 5GT0D 2CWEA 4WNNB 4DRAA 1KU5A 1M1AD 5B2ID 3AZKB 2F8NB 3VH5W 1KX4D 1P3GA 1M19A 5AV6D 5CPKD 3TU4D 3MGRB 3WA9D 5B32B 1P3PC 3AV1D 4J8VD 3AZLC 3MGPA 2FJ7B 5AV5A 5B0YB 5BS7A 3A6NA 5AVCA 3W96D 3AZNC 4G91C 3WTPD 3MGSA 2YFWB 3MGQA 1P3BA 5B31C 1EQZB 4XZQA 3AZGD 3AZHA 5GT0B 5B1MD 1P3LD 3RELA 4X23D 4Z66D 3AN2D 4ZUXC 5CPJA 3KUYB 5B24D 3UTBA 3B6FC 2F8NG 4QLCA 5DNNA 1ZLAC 3AFAD 3TU4B 5B33D 1S32D 1P3KD 3WA9B 5BNVB 4H9RB 2AROB 3AV1B 4HGAC 3AZMA 3LZ1B 3UT9A 4J8XD 3W98D 4CSRA 4H9NA 1AOID 2NQBB 2NZDB 5B1LA 3W97B 5GSUD 5B31A 4LD9A 5B32C 5E5AB 1B67A 3AV2C 3X1UC 4R8PA 3AZGB 3AZIA 4H9QB 5B1MB 4Z5TA 1P3ID 3WTPE 5B0YC 5CP6A 5AV8A 5B24B 5JA4A 2PYOD 3LJAC 2CV5B 3NQUB 4JJNC 3REKD 4J8WD 3LELD 4H9SC 1P34C 3KUYC 5B0ZD 1JFIB 3V9RB 5G49A 3C1BA 4KUDD 1AOIB 3REID 3AZJD 2BYMA 5GXQB 3MVDD 2AROC 3W99B 3C1CB 3WKJB 3B6GD 3LZ0C 1P3FA 2NQBC 5GT3B 4YS3A 4J8UC 4EO5B 3O62A 3AZEA 1M19B 4XUJA 3X1SB 3LELB 1P34A 2BYKA 1P3PD 2CV5C 3MVDB 3MGPB 5AV5B 1ID3B 3AZFC 4WU9C 4E44A 5F99A 3MGQB 1P3BB 1HQ3C 4XZQB 3REHA 3X1TD 5GXQC 5CPIC 1M18A 5DNMC 3W99C 1M1AA 3C1CC 5B2IA 3B6FD 1ZLAD 1KX4A 4KGCC 4QLCB 5AV6A 1ULYA 3REJA 4EO5C 3AZLB 4M6BA 1P3GC 1M19C 4Z2MG 4WU8A 3VH6T 4CSRB 5B32D 3AZNB 5B31B 5AVBA 3X1UD 3AV2D 4LD9B 3W96A 2FJ7D 5B0YD 3MGPC 5AV5C 4ZUXB 3B0DC 4KHAA 5BS7C 4X23A 4AWLC 1EQZD 4Z66A 3A6NC 5AVCC 3VH6A 3MGSC 3MGQC 1P3BC 5BT1C 3LJAD 3AYWA 4XZQC 5AY8A 3AZHC 4HGAB 3RELC 3KUYD 2HIOA 3UTAA 3KWQA 5CPJC 4UUZA 3UTBC 4QLCC 5DNNC 3C1BB 2AROD 3AV2B 3X1UB 3LZ1D 3LZ0D 3AZMC 3MNNA 3UT9C 2NZDD 2NQBD 3W97D 1P3MA 1P3IA 1TZYA 5E5AD 5B1LC 4J8UD 4LD9C 3LJAB 1P3AA 4R8PC 4DRBA 3O62B 1F1EA 4JJNB 3AZIC 4Z5TC 1N1JB 4XUJB 3REKA 1P34B 5CP6C 1A7WA 5AV8C 5B0ZA 2CV5D 3R45B 5B2JA 3REIA 1BH8B 5B32G 3AZFD 3NQJA 3LZ0B 1WWSA 5F99B 3KXBA 3B6GA 3C1BC 5GXQD 5JRGA 4J8UB 4NE3A 5DNMD 3W99D 1KX3A 1M18B 5FUGA 3C1CD 3WKJD 5AV9A 1P3FC 2F8NK 1F66A 5GT3D 3VH5T 4YS3C 2F8NH 2RVQC 3WAAA 1TAFA 1P3GD 1M19D 3B0CW 3O62C 3AZEC 3X1SD 4XUJC 1P3OA 3AZFB 4WU9B 1HQ3B 4YM6A 3VH5A 5B40A 1H3OA 3MGPD 5AV5D 5CPIB 1KX5A 4H9PA 5DNMB 3X1TA 1ID3D 3A6ND 5BNXB 5AVCD 3X1VA 1U35A 4KGCB 3MGQD 1P3BD 1Q9CA 5F99C 4XZQD 3AZHD 3AYWB 4G92C 5AY8B 4WNNA 3REHC 3RELD 1M18C 3AZKA 2YFVA 5CHLB 1P3GB 1M1AC 2F8NA 3UTBD 2HIOB 5B2IC 3UTAB 3KWQB 4QLCD 5DNND 1KX4C 5AV6C 3MGRA 3REJC 3AZLD 3UT9D 3MNNB 3B0DB 4WU8C 2JSSA 4AWLB 3AZND 1P3MB 3A6NB 5AVCB 5B31D 4LD9D 3MGSB 1EQZA 5AVBC 2YFWA 4R8PD 3W96C 3AZHB 5GT0A 2IO5C 4Z5TD 4H9OA 4ZUXD 3RELB 5CP6D 5CPJB 5AV8D 4X23C 3UTBB 4Z66C 2LY8A 5DNNB 5CPKA 3AYWC 3TU4A 5AY8C 3WA9A 3AZMB 3AV1A 3UT9B 4J8VA 3LZ1A 2HIOC 3UTAC 3KWQC 3C1BD 4H9NB 2NZDA 5B1LB 3W97A 5JRGB 4NFTA 5E5AA 3WTPA 5FUGB 4R8PB 3AZIB 3AZGA 4H9QA 4Z5TB 3MNNC 5B1MA 4WZSB 5AV9B 1P3LA 5CP6B 1F66B 1P3MC 3AN2A 2L5AA 1P3IC 5AV8B 1TZYC 2RVQD 5B24A 5JA4B 4JJND 3O62D 3AFAA 3AZED 1P3AC 5B33A 4XUJD 1S32A 3NQUA 1P3KA 5KDMA 1P34D 3REKC 4E45A 4Z2MH 5G49B 4J8XA 1JFIA 4ZBJB 3W98A 5B0ZC 2BYMB 1AOIA 1H3OB 5GSUA 5B2JC 3REIC 3AZJC 4H9PB 1KX5B 5B31G
chains in the Genus database with same CATH superfamily
3X1VB 3WKJA 1U35B 5F99D 1P3FB 3KXBC 3B6GC 3REHD 4CAYA 5JRGC 5GT3A 4YS3B 1M18D 5BO0A 1KX3C 1R4VA 2PYOA 2YFVB 3AZEB 2W8SA 5AV9C 4J8WA 3X1SA 3LELA 1F66C 2BYKB 3REJD 3WAAC 4KUDA 3AZJA 4WU8D 3MVDA 1BH9A 4WU9D 1P3OC 1HQ3D 1ID3A 5AVBD 2DF4C 4YM6C 4ZBJC 4G92B 3REHB 5B40C 5CPID 1Z2CB 4H9OB 1KX5C 3X1TC 1M1AB 4KGCD 5B2IB 3X1VC 1U35C 1KX4B 3AYWD 5AV6B 5CPKB 5AY8D 1HTAA 1P3PA 3REJB 2HIOD 3UTAD 3AZKC 3AZLA 3KWQD 4J8VB 4WU8B 2HUEB 3AZNA 5AVBB 3MGRC 3W96B 3WTPB 3EPJA 2IO5B 3MNND 1T3UA 2G5IC 1P3MD 2FJ7C 1P3LB 4ZUXA 4KHAB 1TZYD 4X23B 3MGSD 4Z66B 5BT1D 3AN2B 3B6FA 1ZLAA 1P3AD 1EQZC 1B6WA 3AFAB 5GT0C 5B33B 2BG1A 1S32B 1WWIA 1P3KB 5KDMB 5CPJD 5C3IB 3EPLA 4UUZB 3KSYA 4J8XB 5CPKC 3W98B 4NE5A 5B2JD 3TU4C 2Y2NA 2XD1A 3B0BA 5B32A 5GSUB 3AZMD 3AV2A 3WA9C 3X1UA 2Y2OA 3VH6W 3AV1C 4J8VC 3LZ1C 2FJ7A 3KXBD 5B0YA 5B1LD 1P3IB 2HUEC 5JRGD 1TZYB 2NZDC 4CAYB 1KX3D 3W97C 3AZID 5E5AC 5BO0B 3WTPC 1P3AB 3LJAA 2PYOB 3AZGC 4JJNA 5AV9D 5B1MC 1N1JA 4H9SA 3REKB 4J8WB 1P3LC 1F66D 1BFMA 3KUYA 3B0CT 3AN2C 5B24C 5B0ZB 2ZY4A 3EPKA 3WAAD 3R45A 3AFAC 5B2JB 3REIB 5BNVA 3AZJB 5B33C 4H9RA 4KUDB 2AROA 1S32C 1P3OD 1P3KC 1BH9B 1BH8A 5C3IC 3NQJB 3LZ0A 4YM6D 3KXBB 3B6GB 5B40D 4J8XC 2NQBA 3W98C 4NE6A 1AOIC 1KX5D 1KX3B 4J8UA 5GSUC 3X1VD 1U35D 1P3FD 3H0LC 4WV4B 3WKJC 4YS3D 5GT3C 1P3PB 4DQYB 3WAAB 1TAFB 3AZKD 2F8ND 2PYOC 2CV5A 2VQRA 1P3OB 4J8WC 3LELC 3X1SC 3AZFA 3MGRD 4WU9A 4YM6B 4G91B 1HQ3A 3V9RA 5B40B 5GXQA 4KUDC 5CPIA 3X1TB 5DNMA 3MVDC 3W99A 3C1CA 5BNXA 1ID3C 4KGCA 3B6FB 1ZLAB 2FFFB 5GT0D 2CWEA 4WNNB 4DRAA 1KU5A 1M1AD 5B2ID 3AZKB 2F8NB 3VH5W 1KX4D 1P3GA 1M19A 5AV6D 5CPKD 3TU4D 3MGRB 3WA9D 5B32B 1P3PC 3AV1D 4J8VD 2ZY5A 3AZLC 3MGPA 2FJ7B 2Y2JA 5AV5A 5B0YB 5BS7A 3A6NA 5AVCA 3W96D 3AZNC 4G91C 3WTPD 3MGSA 2YFWB 3MGQA 1W2EA 5B31C 1P3BA 1EQZB 4XZQA 3AZGD 3AZHA 5GT0B 5B1MD 1P3LD 3RELA 4X23D 4Z66D 3AN2D 4ZUXC 5CPJA 3KUYB 5B24D 3UTBA 3B6FC 2F8NG 4QLCA 5DNNA 1ZLAC 3AFAD 3TU4B 3H0RC 5B33D 1S32D 1P3KD 3WA9B 5BNVB 4H9RB 2AROB 3AV1B 4HGAC 3AZMA 3LZ1B 3UT9A 4J8XD 3W98D 4CSRA 4H9NA 1AOID 2NQBB 2NZDB 5B1LA 3W97B 5GSUD 5B31A 4LD9A 5B32C 5E5AB 1B67A 3AV2C 3X1UC 4R8PA 3AZGB 3AZIA 4H9QB 5B1MB 4Z5TA 1P3ID 3WTPE 5B0YC 5CP6A 5AV8A 5B24B 5JA4A 2PYOD 3LJAC 2CV5B 3NQUB 4JJNC 3REKD 4J8WD 3LELD 4H9SC 1P34C 3KUYC 5B0ZD 1JFIB 3V9RB 5G49A 3C1BA 4KUDD 1AOIB 3REID 3AZJD 2BYMA 5GXQB 3MVDD 2AROC 3W99B 3H0MC 3C1CB 3WKJB 3B6GD 3LZ0C 1P3FA 2G5HC 3IP4C 2NQBC 5GT3B 4YS3A 3EPHA 4J8UC 4EO5B 3O62A 3AZEA 1M19B 4XUJA 3X1SB 3LELB 1P34A 2BYKA 1P3PD 2CV5C 3MVDB 3MGPB 5AV5B 1ID3B 3AZFC 4WU9C 4E44A 5F99A 3MGQB 1P3BB 1HQ3C 2RIQA 2DQNC 3KFUG 4XZQB 3REHA 3X1TD 5GXQC 5CPIC 1M18A 5DNMC 3W99C 1M1AA 3C1CC 5B2IA 3B6FD 1ZLAD 1KX4A 4KGCC 4QLCB 5AV6A 1ULYA 2F2AC 3REJA 4EO5C 2JCHA 3AZLB 4M6BA 1P3GC 1M19C 4Z2MG 4WU8A 3VH6T 4CSRB 5B32D 3EG5B 3AZNB 5B31B 5AVBA 3X1UD 3AV2D 4LD9B 3W96A 2FJ7D 5B0YD 3MGPC 5AV5C 4ZUXB 3B0DC 4KHAA 5BS7C 4X23A 4AWLC 1EQZD 4Z66A 3A6NC 5AVCC 4WJ3C 3VH6A 3MGSC 2Y2QA 3MGQC 5BT1C 3LJAD 3AYWA 1P3BC 4XZQC 5AY8A 3AZHC 4HGAB 3RELC 3KUYD 2HIOA 3UTAA 3KWQA 5CPJC 4UUZA 3UTBC 4QLCC 5DNNC 2Y2HA 3C1BB 2AROD 3AV2B 3X1UB 3LZ1D 3LZ0D 3AZMC 3MNNA 3UT9C 2NZDD 2NQBD 3W97D 1P3MA 1P3IA 1TZYA 5E5AD 5B1LC 4J8UD 4LD9C 3LJAB 1P3AA 4R8PC 4DRBA 3O62B 1F1EA 4JJNB 3AZIC 2Y2IA 4Z5TC 1N1JB 4XUJB 3AL0C 3REKA 1P34B 5CP6C 1A7WA 5AV8C 5B0ZA 3F6TA 2CV5D 3R45B 5B2JA 3REIA 1BH8B 5B32G 2Y2LA 3AZFD 3NQJA 3LZ0B 1WWSA 5F99B 3KXBA 3B6GA 3A1KA 3C1BC 5GXQD 2ZY2A 5JRGA 4J8UB 4NE3A 5DNMD 3W99D 1KX3A 1M18B 5FUGA 3C1CD 3WKJD 5AV9A 1P3FC 2F8NK 1F66A 5GT3D 3VH5T 4YS3C 2F8NH 2RVQC 2Y2GA 3WAAA 1TAFA 1P3GD 1M19D 3B0CW 3O62C 3AZEC 3X1SD 4XUJC 1P3OA 3AZFB 4WU9B 1PZRA 1HQ3B 4YM6A 3VH5A 5B40A 1H3OA 3MGPD 5AV5D 5CPIB 1KX5A 4H9PA 5DNMB 3X1TA 1ID3D 3A6ND 5BNXB 5AVCD 3X1VA 1U35A 4KGCB 3MGQD 1P3BD 1Q9CA 5F99C 4XZQD 3AZHD 3AYWB 4G92C 5AY8B 4WNNA 2UWXA 3REHC 3RELD 1M18C 3AZKA 2YFVA 5CHLB 1P3GB 1M1AC 2F8NA 3UTBD 2HIOB 5B2IC 3UTAB 3KWQB 4QLCD 5DNND 1KX4C 5AV6C 3MGRA 3REJC 3AZLD 2ZY3A 3UT9D 3MNNB 3B0DB 4WU8C 2JSSA 4AWLB 3AZND 1P3MB 3A6NB 2JE5A 5AVCB 5B31D 4LD9D 3MGSB 1EQZA 2Y2KA 2YFWA 5AVBC 4R8PD 3W96C 3AZHB 5GT0A 2IO5C 4Z5TD 4H9OA 4ZUXD 3RELB 5CP6D 5CPJB 5AV8D 4X23C 3UTBB 4Z66C 2LY8A 5DNNB 3P5JB 5CPKA 3AYWC 3TU4A 5AY8C 3WA9A 3A1IA 2Y2PA 3AZMB 3AV1A 3UT9B 4J8VA 3LZ1A 2HIOC 3UTAC 3KWQC 3C1BD 4H9NB 2NZDA 5B1LB 3W97A 5JRGB 4NFTA 5E5AA 3WTPA 5FUGB 4R8PB 3AZIB 3AZGA 4H9QA 4Z5TB 3MNNC 5B1MA 4WZSB 5AV9B 1P3LA 5CP6B 1F66B 1P3MC 3AN2A 2L5AA 1P3IC 5AV8B 1TZYC 2RVQD 4UPKA 5B24A 5JA4B 4JJND 3O62D 2XD5A 3AFAA 3AZED 1P3AC 5B33A 2ZM5A 4XUJD 1S32A 3NQUA 1P3KA 5KDMA 1P34D 3REKC 4E45A 4Z2MH 5G49B 4J8XA 1JFIA 4ZBJB 2Y2MA 3W98A 5B0ZC 2BYMB 1AOIA 2J8PA 1H3OB 5GSUA 5B2JC 3REIC 3AZJC 4H9PB 1KX5B 5B31G 3FDDA
chains in the Genus database with same CATH topology
3X1VB 3WKJA 1U35B 5F99D 1P3FB 3KXBC 3B6GC 3REHD 4CAYA 5JRGC 5GT3A 4YS3B 1M18D 5BO0A 1KX3C 1R4VA 2PYOA 2YFVB 3AZEB 2W8SA 5AV9C 4J8WA 3X1SA 3LELA 1F66C 2BYKB 3REJD 3WAAC 4KUDA 3AZJA 4WU8D 3MVDA 1BH9A 4WU9D 1P3OC 1HQ3D 1ID3A 5AVBD 2DF4C 4YM6C 4ZBJC 4G92B 3REHB 5B40C 5CPID 1Z2CB 4H9OB 1KX5C 3X1TC 1M1AB 4KGCD 5B2IB 3X1VC 1U35C 1KX4B 3AYWD 5AV6B 5CPKB 5AY8D 1HTAA 1P3PA 3REJB 2HIOD 3UTAD 3AZKC 3AZLA 3KWQD 4J8VB 4WU8B 2HUEB 3AZNA 5AVBB 3MGRC 3W96B 3WTPB 3EPJA 2IO5B 3MNND 1T3UA 2G5IC 1P3MD 2FJ7C 1P3LB 4ZUXA 4KHAB 1TZYD 4X23B 3MGSD 4Z66B 5BT1D 3AN2B 3B6FA 1ZLAA 1P3AD 1EQZC 1B6WA 3AFAB 5GT0C 5B33B 2BG1A 1S32B 1WWIA 1P3KB 5KDMB 5CPJD 5C3IB 3EPLA 4UUZB 3KSYA 4J8XB 5CPKC 3W98B 4NE5A 5B2JD 3TU4C 2Y2NA 2XD1A 3B0BA 5B32A 5GSUB 3AZMD 3AV2A 3WA9C 3X1UA 2Y2OA 3VH6W 3AV1C 4J8VC 3LZ1C 2FJ7A 3KXBD 5B0YA 5B1LD 1P3IB 2HUEC 5JRGD 1TZYB 2NZDC 4CAYB 1KX3D 3W97C 3AZID 5E5AC 5BO0B 3WTPC 1P3AB 3LJAA 2PYOB 3AZGC 4JJNA 5AV9D 5B1MC 1N1JA 4H9SA 3REKB 4J8WB 1P3LC 1F66D 1BFMA 3KUYA 3B0CT 3AN2C 5B24C 5B0ZB 2ZY4A 3EPKA 3WAAD 3R45A 3AFAC 5B2JB 3REIB 5BNVA 3AZJB 5B33C 4H9RA 4KUDB 2AROA 1S32C 1P3OD 1P3KC 1BH9B 1BH8A 5C3IC 3NQJB 3LZ0A 4YM6D 3KXBB 3B6GB 5B40D 4J8XC 2NQBA 3W98C 4NE6A 1AOIC 1KX5D 1KX3B 4J8UA 5GSUC 3X1VD 1U35D 1P3FD 3H0LC 4WV4B 3WKJC 4YS3D 5GT3C 1P3PB 4DQYB 3WAAB 1TAFB 3AZKD 2F8ND 2PYOC 2CV5A 2VQRA 1P3OB 4J8WC 3LELC 3X1SC 3AZFA 3MGRD 4WU9A 4YM6B 4G91B 1HQ3A 3V9RA 5B40B 5GXQA 4KUDC 5CPIA 3X1TB 5DNMA 3MVDC 3W99A 3C1CA 5BNXA 1ID3C 4KGCA 3B6FB 1ZLAB 2FFFB 5GT0D 2CWEA 4WNNB 4DRAA 1KU5A 1M1AD 5B2ID 3AZKB 2F8NB 3VH5W 1KX4D 1P3GA 1M19A 5AV6D 5CPKD 3TU4D 3MGRB 3WA9D 5B32B 1P3PC 3AV1D 4J8VD 2ZY5A 3AZLC 3MGPA 2FJ7B 2Y2JA 5AV5A 5B0YB 5BS7A 3A6NA 5AVCA 3W96D 3AZNC 4G91C 3WTPD 3MGSA 2YFWB 3MGQA 1W2EA 5B31C 1P3BA 1EQZB 4XZQA 3AZGD 3AZHA 5GT0B 5B1MD 1P3LD 3RELA 4X23D 4Z66D 3AN2D 4ZUXC 5CPJA 3KUYB 5B24D 3UTBA 3B6FC 2F8NG 4QLCA 5DNNA 1ZLAC 3AFAD 3TU4B 3H0RC 5B33D 1S32D 1P3KD 3WA9B 5BNVB 4H9RB 2AROB 3AV1B 4HGAC 3AZMA 3LZ1B 3UT9A 4J8XD 3W98D 4CSRA 4H9NA 1AOID 2NQBB 2NZDB 5B1LA 3W97B 5GSUD 5B31A 4LD9A 5B32C 5E5AB 1B67A 3AV2C 3X1UC 4R8PA 3AZGB 3AZIA 4H9QB 5B1MB 4Z5TA 1P3ID 3WTPE 5B0YC 5CP6A 5AV8A 5B24B 5JA4A 2PYOD 3LJAC 2CV5B 3NQUB 4JJNC 3REKD 4J8WD 3LELD 4H9SC 1P34C 3KUYC 5B0ZD 1JFIB 3V9RB 5G49A 3C1BA 4KUDD 1AOIB 3REID 3AZJD 2BYMA 5GXQB 3MVDD 2AROC 3W99B 3H0MC 3C1CB 3WKJB 3B6GD 3LZ0C 1P3FA 2G5HC 3IP4C 2NQBC 5GT3B 4YS3A 3EPHA 4J8UC 4EO5B 3O62A 3AZEA 1M19B 4XUJA 3X1SB 3LELB 1P34A 2BYKA 1P3PD 2CV5C 3MVDB 3MGPB 5AV5B 1ID3B 3AZFC 4WU9C 4E44A 5F99A 3MGQB 1P3BB 1HQ3C 2RIQA 2DQNC 3KFUG 4XZQB 3REHA 3X1TD 5GXQC 5CPIC 1M18A 5DNMC 3W99C 1M1AA 3C1CC 5B2IA 3B6FD 1ZLAD 1KX4A 4KGCC 4QLCB 5AV6A 1ULYA 2F2AC 3REJA 4EO5C 2JCHA 3AZLB 4M6BA 1P3GC 1M19C 4Z2MG 4WU8A 3VH6T 4CSRB 5B32D 3EG5B 3AZNB 5B31B 5AVBA 3X1UD 3AV2D 4LD9B 3W96A 2FJ7D 5B0YD 3MGPC 5AV5C 4ZUXB 3B0DC 4KHAA 5BS7C 4X23A 4AWLC 1EQZD 4Z66A 3A6NC 5AVCC 4WJ3C 3VH6A 3MGSC 2Y2QA 3MGQC 5BT1C 3LJAD 3AYWA 1P3BC 4XZQC 5AY8A 3AZHC 4HGAB 3RELC 3KUYD 2HIOA 3UTAA 3KWQA 5CPJC 4UUZA 3UTBC 4QLCC 5DNNC 2Y2HA 3C1BB 2AROD 3AV2B 3X1UB 3LZ1D 3LZ0D 3AZMC 3MNNA 3UT9C 2NZDD 2NQBD 3W97D 1P3MA 1P3IA 1TZYA 5E5AD 5B1LC 4J8UD 4LD9C 3LJAB 1P3AA 4R8PC 4DRBA 3O62B 1F1EA 4JJNB 3AZIC 2Y2IA 4Z5TC 1N1JB 4XUJB 3AL0C 3REKA 1P34B 5CP6C 1A7WA 5AV8C 5B0ZA 3F6TA 2CV5D 3R45B 5B2JA 3REIA 1BH8B 5B32G 2Y2LA 3AZFD 3NQJA 3LZ0B 1WWSA 5F99B 3KXBA 3B6GA 3A1KA 3C1BC 5GXQD 2ZY2A 5JRGA 4J8UB 4NE3A 5DNMD 3W99D 1KX3A 1M18B 5FUGA 3C1CD 3WKJD 5AV9A 1P3FC 2F8NK 1F66A 5GT3D 3VH5T 4YS3C 2F8NH 2RVQC 2Y2GA 3WAAA 1TAFA 1P3GD 1M19D 3B0CW 3O62C 3AZEC 3X1SD 4XUJC 1P3OA 3AZFB 4WU9B 1PZRA 1HQ3B 4YM6A 3VH5A 5B40A 1H3OA 3MGPD 5AV5D 5CPIB 1KX5A 4H9PA 5DNMB 3X1TA 1ID3D 3A6ND 5BNXB 5AVCD 3X1VA 1U35A 4KGCB 3MGQD 1P3BD 1Q9CA 5F99C 4XZQD 3AZHD 3AYWB 4G92C 5AY8B 4WNNA 2UWXA 3REHC 3RELD 1M18C 3AZKA 2YFVA 5CHLB 1P3GB 1M1AC 2F8NA 3UTBD 2HIOB 5B2IC 3UTAB 3KWQB 4QLCD 5DNND 1KX4C 5AV6C 3MGRA 3REJC 3AZLD 2ZY3A 3UT9D 3MNNB 3B0DB 4WU8C 2JSSA 4AWLB 3AZND 1P3MB 3A6NB 2JE5A 5AVCB 5B31D 4LD9D 3MGSB 1EQZA 2Y2KA 2YFWA 5AVBC 4R8PD 3W96C 3AZHB 5GT0A 2IO5C 4Z5TD 4H9OA 4ZUXD 3RELB 5CP6D 5CPJB 5AV8D 4X23C 3UTBB 4Z66C 2LY8A 5DNNB 3P5JB 5CPKA 3AYWC 3TU4A 5AY8C 3WA9A 3A1IA 2Y2PA 3AZMB 3AV1A 3UT9B 4J8VA 3LZ1A 2HIOC 3UTAC 3KWQC 3C1BD 4H9NB 2NZDA 5B1LB 3W97A 5JRGB 4NFTA 5E5AA 3WTPA 5FUGB 4R8PB 3AZIB 3AZGA 4H9QA 4Z5TB 3MNNC 5B1MA 4WZSB 5AV9B 1P3LA 5CP6B 1F66B 1P3MC 3AN2A 2L5AA 1P3IC 5AV8B 1TZYC 2RVQD 4UPKA 5B24A 5JA4B 4JJND 3O62D 2XD5A 3AFAA 3AZED 1P3AC 5B33A 2ZM5A 4XUJD 1S32A 3NQUA 1P3KA 5KDMA 1P34D 3REKC 4E45A 4Z2MH 5G49B 4J8XA 1JFIA 4ZBJB 2Y2MA 3W98A 5B0ZC 2BYMB 1AOIA 2J8PA 1H3OB 5GSUA 5B2JC 3REIC 3AZJC 4H9PB 1KX5B 5B31G 3FDDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X1V B;  3WKJ A;  1U35 B;  5F99 D;  1P3F B;  3KXB C;  3B6G C;  3REH D;  4CAY A;  5JRG C;  5GT3 A;  4YS3 B;  1M18 D;  5BO0 A;  1KX3 C;  1R4V A;  2PYO A;  2YFV B;  3AZE B;  5AV9 C;  4J8W A;  3X1S A;  3LEL A;  1F66 C;  2BYK B;  3REJ D;  3WAA C;  4KUD A;  3AZJ A;  4WU8 D;  3MVD A;  1BH9 A;  4WU9 D;  1P3O C;  1HQ3 D;  1ID3 A;  5AVB D;  4YM6 C;  4ZBJ C;  4G92 B;  3REH B;  5B40 C;  5CPI D;  4H9O B;  1KX5 C;  3X1T C;  1M1A B;  4KGC D;  5B2I B;  3X1V C;  1U35 C;  1KX4 B;  3AYW D;  5AV6 B;  5CPK B;  5AY8 D;  1HTA A;  1P3P A;  3REJ B;  2HIO D;  3UTA D;  3AZK C;  3AZL A;  3KWQ D;  4J8V B;  4WU8 B;  2HUE B;  3AZN A;  5AVB B;  3MGR C;  3W96 B;  3WTP B;  2IO5 B;  3MNN D;  2FJ7 C;  1P3M D;  1P3L B;  4ZUX A;  4KHA B;  1TZY D;  4X23 B;  3MGS D;  4Z66 B;  5BT1 D;  3AN2 B;  3B6F A;  1ZLA A;  1P3A D;  1EQZ C;  1B6W A;  3AFA B;  5GT0 C;  5B33 B;  1S32 B;  1WWI A;  1P3K B;  5KDM B;  5CPJ D;  5C3I B;  4UUZ B;  3KSY A;  4J8X B;  5CPK C;  3W98 B;  4NE5 A;  5B2J D;  3TU4 C;  5B32 A;  3B0B A;  5GSU B;  3AZM D;  3AV2 A;  3WA9 C;  3X1U A;  3VH6 W;  3AV1 C;  4J8V C;  3LZ1 C;  2FJ7 A;  3KXB D;  5B0Y A;  5B1L D;  1P3I B;  2HUE C;  5JRG D;  1TZY B;  2NZD C;  4CAY B;  1KX3 D;  3W97 C;  3AZI D;  5E5A C;  5BO0 B;  3WTP C;  1P3A B;  3LJA A;  2PYO B;  3AZG C;  4JJN A;  5AV9 D;  5B1M C;  1N1J A;  4H9S A;  3REK B;  4J8W B;  1P3L C;  1F66 D;  1BFM A;  3KUY A;  3B0C T;  3AN2 C;  5B24 C;  5B0Z B;  3WAA D;  3R45 A;  3AFA C;  5B2J B;  3REI B;  5BNV A;  3AZJ B;  5B33 C;  4H9R A;  4KUD B;  2ARO A;  1S32 C;  1P3O D;  1P3K C;  1BH9 B;  1BH8 A;  5C3I C;  3NQJ B;  3LZ0 A;  4YM6 D;  3KXB B;  3B6G B;  5B40 D;  4J8X C;  2NQB A;  3W98 C;  4NE6 A;  1AOI C;  1KX5 D;  1KX3 B;  4J8U A;  5GSU C;  3X1V D;  1U35 D;  1P3F D;  3WKJ C;  4WV4 B;  4YS3 D;  5GT3 C;  1P3P B;  3WAA B;  1TAF B;  3AZK D;  2F8N D;  2PYO C;  2CV5 A;  1P3O B;  4J8W C;  3LEL C;  3X1S C;  3AZF A;  3MGR D;  4WU9 A;  4YM6 B;  4G91 B;  1HQ3 A;  3V9R A;  5B40 B;  5GXQ A;  4KUD C;  5CPI A;  3X1T B;  5DNM A;  3MVD C;  3W99 A;  3C1C A;  5BNX A;  1ID3 C;  4KGC A;  3B6F B;  1ZLA B;  5GT0 D;  2CWE A;  4WNN B;  4DRA A;  1KU5 A;  1M1A D;  5B2I D;  3AZK B;  2F8N B;  3VH5 W;  1KX4 D;  1P3G A;  1M19 A;  5AV6 D;  5CPK D;  3TU4 D;  3MGR B;  3WA9 D;  5B32 B;  1P3P C;  3AV1 D;  4J8V D;  3AZL C;  3MGP A;  2FJ7 B;  5AV5 A;  5B0Y B;  5BS7 A;  3A6N A;  5AVC A;  3W96 D;  3AZN C;  4G91 C;  3WTP D;  3MGS A;  2YFW B;  3MGQ A;  1P3B A;  5B31 C;  1EQZ B;  4XZQ A;  3AZG D;  3AZH A;  5GT0 B;  5B1M D;  1P3L D;  3REL A;  4X23 D;  4Z66 D;  3AN2 D;  4ZUX C;  5CPJ A;  3KUY B;  5B24 D;  3UTB A;  3B6F C;  2F8N G;  4QLC A;  5DNN A;  1ZLA C;  3AFA D;  3TU4 B;  5B33 D;  1S32 D;  1P3K D;  3WA9 B;  5BNV B;  4H9R B;  2ARO B;  3AV1 B;  4HGA C;  3AZM A;  3LZ1 B;  3UT9 A;  4J8X D;  3W98 D;  4CSR A;  4H9N A;  1AOI D;  2NQB B;  2NZD B;  5B1L A;  3W97 B;  5GSU D;  5B31 A;  4LD9 A;  5B32 C;  5E5A B;  1B67 A;  3AV2 C;  3X1U C;  4R8P A;  3AZG B;  3AZI A;  4H9Q B;  5B1M B;  4Z5T A;  1P3I D;  3WTP E;  5B0Y C;  5CP6 A;  5AV8 A;  5B24 B;  5JA4 A;  2PYO D;  3LJA C;  2CV5 B;  3NQU B;  4JJN C;  3REK D;  4J8W D;  3LEL D;  4H9S C;  1P34 C;  3KUY C;  5B0Z D;  1JFI B;  3V9R B;  5G49 A;  3C1B A;  4KUD D;  1AOI B;  3REI D;  3AZJ D;  2BYM A;  5GXQ B;  3MVD D;  2ARO C;  3W99 B;  3C1C B;  3WKJ B;  3B6G D;  3LZ0 C;  1P3F A;  2NQB C;  5GT3 B;  4YS3 A;  4J8U C;  4EO5 B;  3O62 A;  3AZE A;  1M19 B;  4XUJ A;  3X1S B;  3LEL B;  1P34 A;  2BYK A;  1P3P D;  2CV5 C;  3MVD B;  3MGP B;  5AV5 B;  1ID3 B;  3AZF C;  4WU9 C;  4E44 A;  5F99 A;  3MGQ B;  1P3B B;  1HQ3 C;  4XZQ B;  3REH A;  3X1T D;  5GXQ C;  5CPI C;  1M18 A;  5DNM C;  3W99 C;  1M1A A;  3C1C C;  5B2I A;  3B6F D;  1ZLA D;  1KX4 A;  4KGC C;  4QLC B;  5AV6 A;  1ULY A;  3REJ A;  4EO5 C;  3AZL B;  4M6B A;  1P3G C;  1M19 C;  4Z2M G;  4WU8 A;  3VH6 T;  4CSR B;  5B32 D;  3AZN B;  5B31 B;  5AVB A;  3X1U D;  3AV2 D;  4LD9 B;  3W96 A;  2FJ7 D;  5B0Y D;  3MGP C;  5AV5 C;  4ZUX B;  3B0D C;  4KHA A;  5BS7 C;  4X23 A;  4AWL C;  1EQZ D;  4Z66 A;  3A6N C;  5AVC C;  3VH6 A;  3MGS C;  3MGQ C;  1P3B C;  5BT1 C;  3LJA D;  3AYW A;  4XZQ C;  5AY8 A;  3AZH C;  4HGA B;  3REL C;  3KUY D;  2HIO A;  3UTA A;  3KWQ A;  5CPJ C;  4UUZ A;  3UTB C;  4QLC C;  5DNN C;  3C1B B;  2ARO D;  3AV2 B;  3X1U B;  3LZ1 D;  3LZ0 D;  3AZM C;  3MNN A;  3UT9 C;  2NZD D;  2NQB D;  3W97 D;  1P3M A;  1P3I A;  1TZY A;  5E5A D;  5B1L C;  4J8U D;  4LD9 C;  3LJA B;  1P3A A;  4R8P C;  4DRB A;  3O62 B;  1F1E A;  4JJN B;  3AZI C;  4Z5T C;  1N1J B;  4XUJ B;  3REK A;  1P34 B;  5CP6 C;  1A7W A;  5AV8 C;  5B0Z A;  2CV5 D;  3R45 B;  5B2J A;  3REI A;  1BH8 B;  5B32 G;  3AZF D;  3NQJ A;  3LZ0 B;  1WWS A;  5F99 B;  3KXB A;  3B6G A;  3C1B C;  5GXQ D;  5JRG A;  4J8U B;  4NE3 A;  5DNM D;  3W99 D;  1KX3 A;  1M18 B;  5FUG A;  3C1C D;  3WKJ D;  5AV9 A;  1P3F C;  2F8N K;  1F66 A;  5GT3 D;  3VH5 T;  4YS3 C;  2F8N H;  2RVQ C;  3WAA A;  1TAF A;  1P3G D;  1M19 D;  3B0C W;  3O62 C;  3AZE C;  3X1S D;  4XUJ C;  1P3O A;  3AZF B;  4WU9 B;  1HQ3 B;  4YM6 A;  3VH5 A;  5B40 A;  1H3O A;  3MGP D;  5AV5 D;  5CPI B;  1KX5 A;  4H9P A;  5DNM B;  3X1T A;  1ID3 D;  3A6N D;  5BNX B;  5AVC D;  3X1V A;  1U35 A;  4KGC B;  3MGQ D;  1P3B D;  1Q9C A;  5F99 C;  4XZQ D;  3AZH D;  3AYW B;  4G92 C;  5AY8 B;  4WNN A;  3REH C;  3REL D;  1M18 C;  3AZK A;  2YFV A;  5CHL B;  1P3G B;  1M1A C;  2F8N A;  3UTB D;  2HIO B;  5B2I C;  3UTA B;  3KWQ B;  4QLC D;  5DNN D;  1KX4 C;  5AV6 C;  3MGR A;  3REJ C;  3AZL D;  3UT9 D;  3MNN B;  3B0D B;  4WU8 C;  2JSS A;  4AWL B;  3AZN D;  1P3M B;  3A6N B;  5AVC B;  5B31 D;  4LD9 D;  3MGS B;  1EQZ A;  5AVB C;  2YFW A;  4R8P D;  3W96 C;  3AZH B;  5GT0 A;  2IO5 C;  4Z5T D;  4H9O A;  4ZUX D;  3REL B;  5CP6 D;  5CPJ B;  5AV8 D;  4X23 C;  3UTB B;  4Z66 C;  2LY8 A;  5DNN B;  5CPK A;  3AYW C;  3TU4 A;  5AY8 C;  3WA9 A;  3AZM B;  3AV1 A;  3UT9 B;  4J8V A;  3LZ1 A;  2HIO C;  3UTA C;  3KWQ C;  3C1B D;  4H9N B;  2NZD A;  5B1L B;  3W97 A;  5JRG B;  4NFT A;  5E5A A;  3WTP A;  5FUG B;  4R8P B;  3AZI B;  3AZG A;  4H9Q A;  4Z5T B;  3MNN C;  5B1M A;  4WZS B;  5AV9 B;  1P3L A;  5CP6 B;  1F66 B;  1P3M C;  3AN2 A;  2L5A A;  1P3I C;  5AV8 B;  1TZY C;  2RVQ D;  5B24 A;  5JA4 B;  4JJN D;  3O62 D;  3AFA A;  3AZE D;  1P3A C;  5B33 A;  4XUJ D;  1S32 A;  3NQU A;  1P3K A;  5KDM A;  1P34 D;  3REK C;  4E45 A;  4Z2M H;  5G49 B;  4J8X A;  1JFI A;  4ZBJ B;  3W98 A;  5B0Z C;  2BYM B;  1AOI A;  1H3O B;  5GSU A;  5B2J C;  3REI C;  3AZJ C;  4H9P B;  1KX5 B;  5B31 G; 
#chains in the Genus database with same CATH topology
 3X1V B;  3WKJ A;  1U35 B;  5F99 D;  1P3F B;  3KXB C;  3B6G C;  3REH D;  4CAY A;  5JRG C;  5GT3 A;  4YS3 B;  1M18 D;  5BO0 A;  1KX3 C;  1R4V A;  2PYO A;  2YFV B;  3AZE B;  2W8S A;  5AV9 C;  4J8W A;  3X1S A;  3LEL A;  1F66 C;  2BYK B;  3REJ D;  3WAA C;  4KUD A;  3AZJ A;  4WU8 D;  3MVD A;  1BH9 A;  4WU9 D;  1P3O C;  1HQ3 D;  1ID3 A;  5AVB D;  2DF4 C;  4YM6 C;  4ZBJ C;  4G92 B;  3REH B;  5B40 C;  5CPI D;  1Z2C B;  4H9O B;  1KX5 C;  3X1T C;  1M1A B;  4KGC D;  5B2I B;  3X1V C;  1U35 C;  1KX4 B;  3AYW D;  5AV6 B;  5CPK B;  5AY8 D;  1HTA A;  1P3P A;  3REJ B;  2HIO D;  3UTA D;  3AZK C;  3AZL A;  3KWQ D;  4J8V B;  4WU8 B;  2HUE B;  3AZN A;  5AVB B;  3MGR C;  3W96 B;  3WTP B;  3EPJ A;  2IO5 B;  3MNN D;  1T3U A;  2G5I C;  1P3M D;  2FJ7 C;  1P3L B;  4ZUX A;  4KHA B;  1TZY D;  4X23 B;  3MGS D;  4Z66 B;  5BT1 D;  3AN2 B;  3B6F A;  1ZLA A;  1P3A D;  1EQZ C;  1B6W A;  3AFA B;  5GT0 C;  5B33 B;  2BG1 A;  1S32 B;  1WWI A;  1P3K B;  5KDM B;  5CPJ D;  5C3I B;  3EPL A;  4UUZ B;  3KSY A;  4J8X B;  5CPK C;  3W98 B;  4NE5 A;  5B2J D;  3TU4 C;  2Y2N A;  2XD1 A;  3B0B A;  5B32 A;  5GSU B;  3AZM D;  3AV2 A;  3WA9 C;  3X1U A;  2Y2O A;  3VH6 W;  3AV1 C;  4J8V C;  3LZ1 C;  2FJ7 A;  3KXB D;  5B0Y A;  5B1L D;  1P3I B;  2HUE C;  5JRG D;  1TZY B;  2NZD C;  4CAY B;  1KX3 D;  3W97 C;  3AZI D;  5E5A C;  5BO0 B;  3WTP C;  1P3A B;  3LJA A;  2PYO B;  3AZG C;  4JJN A;  5AV9 D;  5B1M C;  1N1J A;  4H9S A;  3REK B;  4J8W B;  1P3L C;  1F66 D;  1BFM A;  3KUY A;  3B0C T;  3AN2 C;  5B24 C;  5B0Z B;  2ZY4 A;  3EPK A;  3WAA D;  3R45 A;  3AFA C;  5B2J B;  3REI B;  5BNV A;  3AZJ B;  5B33 C;  4H9R A;  4KUD B;  2ARO A;  1S32 C;  1P3O D;  1P3K C;  1BH9 B;  1BH8 A;  5C3I C;  3NQJ B;  3LZ0 A;  4YM6 D;  3KXB B;  3B6G B;  5B40 D;  4J8X C;  2NQB A;  3W98 C;  4NE6 A;  1AOI C;  1KX5 D;  1KX3 B;  4J8U A;  5GSU C;  3X1V D;  1U35 D;  1P3F D;  3H0L C;  4WV4 B;  3WKJ C;  4YS3 D;  5GT3 C;  1P3P B;  4DQY B;  3WAA B;  1TAF B;  3AZK D;  2F8N D;  2PYO C;  2CV5 A;  2VQR A;  1P3O B;  4J8W C;  3LEL C;  3X1S C;  3AZF A;  3MGR D;  4WU9 A;  4YM6 B;  4G91 B;  1HQ3 A;  3V9R A;  5B40 B;  5GXQ A;  4KUD C;  5CPI A;  3X1T B;  5DNM A;  3MVD C;  3W99 A;  3C1C A;  5BNX A;  1ID3 C;  4KGC A;  3B6F B;  1ZLA B;  2FFF B;  5GT0 D;  2CWE A;  4WNN B;  4DRA A;  1KU5 A;  1M1A D;  5B2I D;  3AZK B;  2F8N B;  3VH5 W;  1KX4 D;  1P3G A;  1M19 A;  5AV6 D;  5CPK D;  3TU4 D;  3MGR B;  3WA9 D;  5B32 B;  1P3P C;  3AV1 D;  4J8V D;  2ZY5 A;  3AZL C;  3MGP A;  2FJ7 B;  2Y2J A;  5AV5 A;  5B0Y B;  5BS7 A;  3A6N A;  5AVC A;  3W96 D;  3AZN C;  4G91 C;  3WTP D;  3MGS A;  2YFW B;  3MGQ A;  1W2E A;  5B31 C;  1P3B A;  1EQZ B;  4XZQ A;  3AZG D;  3AZH A;  5GT0 B;  5B1M D;  1P3L D;  3REL A;  4X23 D;  4Z66 D;  3AN2 D;  4ZUX C;  5CPJ A;  3KUY B;  5B24 D;  3UTB A;  3B6F C;  2F8N G;  4QLC A;  5DNN A;  1ZLA C;  3AFA D;  3TU4 B;  3H0R C;  5B33 D;  1S32 D;  1P3K D;  3WA9 B;  5BNV B;  4H9R B;  2ARO B;  3AV1 B;  4HGA C;  3AZM A;  3LZ1 B;  3UT9 A;  4J8X D;  3W98 D;  4CSR A;  4H9N A;  1AOI D;  2NQB B;  2NZD B;  5B1L A;  3W97 B;  5GSU D;  5B31 A;  4LD9 A;  5B32 C;  5E5A B;  1B67 A;  3AV2 C;  3X1U C;  4R8P A;  3AZG B;  3AZI A;  4H9Q B;  5B1M B;  4Z5T A;  1P3I D;  3WTP E;  5B0Y C;  5CP6 A;  5AV8 A;  5B24 B;  5JA4 A;  2PYO D;  3LJA C;  2CV5 B;  3NQU B;  4JJN C;  3REK D;  4J8W D;  3LEL D;  4H9S C;  1P34 C;  3KUY C;  5B0Z D;  1JFI B;  3V9R B;  5G49 A;  3C1B A;  4KUD D;  1AOI B;  3REI D;  3AZJ D;  2BYM A;  5GXQ B;  3MVD D;  2ARO C;  3W99 B;  3H0M C;  3C1C B;  3WKJ B;  3B6G D;  3LZ0 C;  1P3F A;  2G5H C;  3IP4 C;  2NQB C;  5GT3 B;  4YS3 A;  3EPH A;  4J8U C;  4EO5 B;  3O62 A;  3AZE A;  1M19 B;  4XUJ A;  3X1S B;  3LEL B;  1P34 A;  2BYK A;  1P3P D;  2CV5 C;  3MVD B;  3MGP B;  5AV5 B;  1ID3 B;  3AZF C;  4WU9 C;  4E44 A;  5F99 A;  3MGQ B;  1P3B B;  1HQ3 C;  2RIQ A;  2DQN C;  3KFU G;  4XZQ B;  3REH A;  3X1T D;  5GXQ C;  5CPI C;  1M18 A;  5DNM C;  3W99 C;  1M1A A;  3C1C C;  5B2I A;  3B6F D;  1ZLA D;  1KX4 A;  4KGC C;  4QLC B;  5AV6 A;  1ULY A;  2F2A C;  3REJ A;  4EO5 C;  2JCH A;  3AZL B;  4M6B A;  1P3G C;  1M19 C;  4Z2M G;  4WU8 A;  3VH6 T;  4CSR B;  5B32 D;  3EG5 B;  3AZN B;  5B31 B;  5AVB A;  3X1U D;  3AV2 D;  4LD9 B;  3W96 A;  2FJ7 D;  5B0Y D;  3MGP C;  5AV5 C;  4ZUX B;  3B0D C;  4KHA A;  5BS7 C;  4X23 A;  4AWL C;  1EQZ D;  4Z66 A;  3A6N C;  5AVC C;  4WJ3 C;  3VH6 A;  3MGS C;  2Y2Q A;  3MGQ C;  5BT1 C;  3LJA D;  3AYW A;  1P3B C;  4XZQ C;  5AY8 A;  3AZH C;  4HGA B;  3REL C;  3KUY D;  2HIO A;  3UTA A;  3KWQ A;  5CPJ C;  4UUZ A;  3UTB C;  4QLC C;  5DNN C;  2Y2H A;  3C1B B;  2ARO D;  3AV2 B;  3X1U B;  3LZ1 D;  3LZ0 D;  3AZM C;  3MNN A;  3UT9 C;  2NZD D;  2NQB D;  3W97 D;  1P3M A;  1P3I A;  1TZY A;  5E5A D;  5B1L C;  4J8U D;  4LD9 C;  3LJA B;  1P3A A;  4R8P C;  4DRB A;  3O62 B;  1F1E A;  4JJN B;  3AZI C;  2Y2I A;  4Z5T C;  1N1J B;  4XUJ B;  3AL0 C;  3REK A;  1P34 B;  5CP6 C;  1A7W A;  5AV8 C;  5B0Z A;  3F6T A;  2CV5 D;  3R45 B;  5B2J A;  3REI A;  1BH8 B;  5B32 G;  2Y2L A;  3AZF D;  3NQJ A;  3LZ0 B;  1WWS A;  5F99 B;  3KXB A;  3B6G A;  3A1K A;  3C1B C;  5GXQ D;  2ZY2 A;  5JRG A;  4J8U B;  4NE3 A;  5DNM D;  3W99 D;  1KX3 A;  1M18 B;  5FUG A;  3C1C D;  3WKJ D;  5AV9 A;  1P3F C;  2F8N K;  1F66 A;  5GT3 D;  3VH5 T;  4YS3 C;  2F8N H;  2RVQ C;  2Y2G A;  3WAA A;  1TAF A;  1P3G D;  1M19 D;  3B0C W;  3O62 C;  3AZE C;  3X1S D;  4XUJ C;  1P3O A;  3AZF B;  4WU9 B;  1PZR A;  1HQ3 B;  4YM6 A;  3VH5 A;  5B40 A;  1H3O A;  3MGP D;  5AV5 D;  5CPI B;  1KX5 A;  4H9P A;  5DNM B;  3X1T A;  1ID3 D;  3A6N D;  5BNX B;  5AVC D;  3X1V A;  1U35 A;  4KGC B;  3MGQ D;  1P3B D;  1Q9C A;  5F99 C;  4XZQ D;  3AZH D;  3AYW B;  4G92 C;  5AY8 B;  4WNN A;  2UWX A;  3REH C;  3REL D;  1M18 C;  3AZK A;  2YFV A;  5CHL B;  1P3G B;  1M1A C;  2F8N A;  3UTB D;  2HIO B;  5B2I C;  3UTA B;  3KWQ B;  4QLC D;  5DNN D;  1KX4 C;  5AV6 C;  3MGR A;  3REJ C;  3AZL D;  2ZY3 A;  3UT9 D;  3MNN B;  3B0D B;  4WU8 C;  2JSS A;  4AWL B;  3AZN D;  1P3M B;  3A6N B;  2JE5 A;  5AVC B;  5B31 D;  4LD9 D;  3MGS B;  1EQZ A;  2Y2K A;  2YFW A;  5AVB C;  4R8P D;  3W96 C;  3AZH B;  5GT0 A;  2IO5 C;  4Z5T D;  4H9O A;  4ZUX D;  3REL B;  5CP6 D;  5CPJ B;  5AV8 D;  4X23 C;  3UTB B;  4Z66 C;  2LY8 A;  5DNN B;  3P5J B;  5CPK A;  3AYW C;  3TU4 A;  5AY8 C;  3WA9 A;  3A1I A;  2Y2P A;  3AZM B;  3AV1 A;  3UT9 B;  4J8V A;  3LZ1 A;  2HIO C;  3UTA C;  3KWQ C;  3C1B D;  4H9N B;  2NZD A;  5B1L B;  3W97 A;  5JRG B;  4NFT A;  5E5A A;  3WTP A;  5FUG B;  4R8P B;  3AZI B;  3AZG A;  4H9Q A;  4Z5T B;  3MNN C;  5B1M A;  4WZS B;  5AV9 B;  1P3L A;  5CP6 B;  1F66 B;  1P3M C;  3AN2 A;  2L5A A;  1P3I C;  5AV8 B;  1TZY C;  2RVQ D;  4UPK A;  5B24 A;  5JA4 B;  4JJN D;  3O62 D;  2XD5 A;  3AFA A;  3AZE D;  1P3A C;  5B33 A;  2ZM5 A;  4XUJ D;  1S32 A;  3NQU A;  1P3K A;  5KDM A;  1P34 D;  3REK C;  4E45 A;  4Z2M H;  5G49 B;  4J8X A;  1JFI A;  4ZBJ B;  2Y2M A;  3W98 A;  5B0Z C;  2BYM B;  1AOI A;  2J8P A;  1H3O B;  5GSU A;  5B2J C;  3REI C;  3AZJ C;  4H9P B;  1KX5 B;  5B31 G;  3FDD A; 
#chains in the Genus database with same CATH homology
 3X1V B;  3WKJ A;  1U35 B;  5F99 D;  1P3F B;  3KXB C;  3B6G C;  3REH D;  4CAY A;  5JRG C;  5GT3 A;  4YS3 B;  1M18 D;  5BO0 A;  1KX3 C;  1R4V A;  2PYO A;  2YFV B;  3AZE B;  2W8S A;  5AV9 C;  4J8W A;  3X1S A;  3LEL A;  1F66 C;  2BYK B;  3REJ D;  3WAA C;  4KUD A;  3AZJ A;  4WU8 D;  3MVD A;  1BH9 A;  4WU9 D;  1P3O C;  1HQ3 D;  1ID3 A;  5AVB D;  2DF4 C;  4YM6 C;  4ZBJ C;  4G92 B;  3REH B;  5B40 C;  5CPI D;  1Z2C B;  4H9O B;  1KX5 C;  3X1T C;  1M1A B;  4KGC D;  5B2I B;  3X1V C;  1U35 C;  1KX4 B;  3AYW D;  5AV6 B;  5CPK B;  5AY8 D;  1HTA A;  1P3P A;  3REJ B;  2HIO D;  3UTA D;  3AZK C;  3AZL A;  3KWQ D;  4J8V B;  4WU8 B;  2HUE B;  3AZN A;  5AVB B;  3MGR C;  3W96 B;  3WTP B;  3EPJ A;  2IO5 B;  3MNN D;  1T3U A;  2G5I C;  1P3M D;  2FJ7 C;  1P3L B;  4ZUX A;  4KHA B;  1TZY D;  4X23 B;  3MGS D;  4Z66 B;  5BT1 D;  3AN2 B;  3B6F A;  1ZLA A;  1P3A D;  1EQZ C;  1B6W A;  3AFA B;  5GT0 C;  5B33 B;  2BG1 A;  1S32 B;  1WWI A;  1P3K B;  5KDM B;  5CPJ D;  5C3I B;  3EPL A;  4UUZ B;  3KSY A;  4J8X B;  5CPK C;  3W98 B;  4NE5 A;  5B2J D;  3TU4 C;  2Y2N A;  2XD1 A;  3B0B A;  5B32 A;  5GSU B;  3AZM D;  3AV2 A;  3WA9 C;  3X1U A;  2Y2O A;  3VH6 W;  3AV1 C;  4J8V C;  3LZ1 C;  2FJ7 A;  3KXB D;  5B0Y A;  5B1L D;  1P3I B;  2HUE C;  5JRG D;  1TZY B;  2NZD C;  4CAY B;  1KX3 D;  3W97 C;  3AZI D;  5E5A C;  5BO0 B;  3WTP C;  1P3A B;  3LJA A;  2PYO B;  3AZG C;  4JJN A;  5AV9 D;  5B1M C;  1N1J A;  4H9S A;  3REK B;  4J8W B;  1P3L C;  1F66 D;  1BFM A;  3KUY A;  3B0C T;  3AN2 C;  5B24 C;  5B0Z B;  2ZY4 A;  3EPK A;  3WAA D;  3R45 A;  3AFA C;  5B2J B;  3REI B;  5BNV A;  3AZJ B;  5B33 C;  4H9R A;  4KUD B;  2ARO A;  1S32 C;  1P3O D;  1P3K C;  1BH9 B;  1BH8 A;  5C3I C;  3NQJ B;  3LZ0 A;  4YM6 D;  3KXB B;  3B6G B;  5B40 D;  4J8X C;  2NQB A;  3W98 C;  4NE6 A;  1AOI C;  1KX5 D;  1KX3 B;  4J8U A;  5GSU C;  3X1V D;  1U35 D;  1P3F D;  3H0L C;  4WV4 B;  3WKJ C;  4YS3 D;  5GT3 C;  1P3P B;  4DQY B;  3WAA B;  1TAF B;  3AZK D;  2F8N D;  2PYO C;  2CV5 A;  2VQR A;  1P3O B;  4J8W C;  3LEL C;  3X1S C;  3AZF A;  3MGR D;  4WU9 A;  4YM6 B;  4G91 B;  1HQ3 A;  3V9R A;  5B40 B;  5GXQ A;  4KUD C;  5CPI A;  3X1T B;  5DNM A;  3MVD C;  3W99 A;  3C1C A;  5BNX A;  1ID3 C;  4KGC A;  3B6F B;  1ZLA B;  2FFF B;  5GT0 D;  2CWE A;  4WNN B;  4DRA A;  1KU5 A;  1M1A D;  5B2I D;  3AZK B;  2F8N B;  3VH5 W;  1KX4 D;  1P3G A;  1M19 A;  5AV6 D;  5CPK D;  3TU4 D;  3MGR B;  3WA9 D;  5B32 B;  1P3P C;  3AV1 D;  4J8V D;  2ZY5 A;  3AZL C;  3MGP A;  2FJ7 B;  2Y2J A;  5AV5 A;  5B0Y B;  5BS7 A;  3A6N A;  5AVC A;  3W96 D;  3AZN C;  4G91 C;  3WTP D;  3MGS A;  2YFW B;  3MGQ A;  1W2E A;  5B31 C;  1P3B A;  1EQZ B;  4XZQ A;  3AZG D;  3AZH A;  5GT0 B;  5B1M D;  1P3L D;  3REL A;  4X23 D;  4Z66 D;  3AN2 D;  4ZUX C;  5CPJ A;  3KUY B;  5B24 D;  3UTB A;  3B6F C;  2F8N G;  4QLC A;  5DNN A;  1ZLA C;  3AFA D;  3TU4 B;  3H0R C;  5B33 D;  1S32 D;  1P3K D;  3WA9 B;  5BNV B;  4H9R B;  2ARO B;  3AV1 B;  4HGA C;  3AZM A;  3LZ1 B;  3UT9 A;  4J8X D;  3W98 D;  4CSR A;  4H9N A;  1AOI D;  2NQB B;  2NZD B;  5B1L A;  3W97 B;  5GSU D;  5B31 A;  4LD9 A;  5B32 C;  5E5A B;  1B67 A;  3AV2 C;  3X1U C;  4R8P A;  3AZG B;  3AZI A;  4H9Q B;  5B1M B;  4Z5T A;  1P3I D;  3WTP E;  5B0Y C;  5CP6 A;  5AV8 A;  5B24 B;  5JA4 A;  2PYO D;  3LJA C;  2CV5 B;  3NQU B;  4JJN C;  3REK D;  4J8W D;  3LEL D;  4H9S C;  1P34 C;  3KUY C;  5B0Z D;  1JFI B;  3V9R B;  5G49 A;  3C1B A;  4KUD D;  1AOI B;  3REI D;  3AZJ D;  2BYM A;  5GXQ B;  3MVD D;  2ARO C;  3W99 B;  3H0M C;  3C1C B;  3WKJ B;  3B6G D;  3LZ0 C;  1P3F A;  2G5H C;  3IP4 C;  2NQB C;  5GT3 B;  4YS3 A;  3EPH A;  4J8U C;  4EO5 B;  3O62 A;  3AZE A;  1M19 B;  4XUJ A;  3X1S B;  3LEL B;  1P34 A;  2BYK A;  1P3P D;  2CV5 C;  3MVD B;  3MGP B;  5AV5 B;  1ID3 B;  3AZF C;  4WU9 C;  4E44 A;  5F99 A;  3MGQ B;  1P3B B;  1HQ3 C;  2RIQ A;  2DQN C;  3KFU G;  4XZQ B;  3REH A;  3X1T D;  5GXQ C;  5CPI C;  1M18 A;  5DNM C;  3W99 C;  1M1A A;  3C1C C;  5B2I A;  3B6F D;  1ZLA D;  1KX4 A;  4KGC C;  4QLC B;  5AV6 A;  1ULY A;  2F2A C;  3REJ A;  4EO5 C;  2JCH A;  3AZL B;  4M6B A;  1P3G C;  1M19 C;  4Z2M G;  4WU8 A;  3VH6 T;  4CSR B;  5B32 D;  3EG5 B;  3AZN B;  5B31 B;  5AVB A;  3X1U D;  3AV2 D;  4LD9 B;  3W96 A;  2FJ7 D;  5B0Y D;  3MGP C;  5AV5 C;  4ZUX B;  3B0D C;  4KHA A;  5BS7 C;  4X23 A;  4AWL C;  1EQZ D;  4Z66 A;  3A6N C;  5AVC C;  4WJ3 C;  3VH6 A;  3MGS C;  2Y2Q A;  3MGQ C;  5BT1 C;  3LJA D;  3AYW A;  1P3B C;  4XZQ C;  5AY8 A;  3AZH C;  4HGA B;  3REL C;  3KUY D;  2HIO A;  3UTA A;  3KWQ A;  5CPJ C;  4UUZ A;  3UTB C;  4QLC C;  5DNN C;  2Y2H A;  3C1B B;  2ARO D;  3AV2 B;  3X1U B;  3LZ1 D;  3LZ0 D;  3AZM C;  3MNN A;  3UT9 C;  2NZD D;  2NQB D;  3W97 D;  1P3M A;  1P3I A;  1TZY A;  5E5A D;  5B1L C;  4J8U D;  4LD9 C;  3LJA B;  1P3A A;  4R8P C;  4DRB A;  3O62 B;  1F1E A;  4JJN B;  3AZI C;  2Y2I A;  4Z5T C;  1N1J B;  4XUJ B;  3AL0 C;  3REK A;  1P34 B;  5CP6 C;  1A7W A;  5AV8 C;  5B0Z A;  3F6T A;  2CV5 D;  3R45 B;  5B2J A;  3REI A;  1BH8 B;  5B32 G;  2Y2L A;  3AZF D;  3NQJ A;  3LZ0 B;  1WWS A;  5F99 B;  3KXB A;  3B6G A;  3A1K A;  3C1B C;  5GXQ D;  2ZY2 A;  5JRG A;  4J8U B;  4NE3 A;  5DNM D;  3W99 D;  1KX3 A;  1M18 B;  5FUG A;  3C1C D;  3WKJ D;  5AV9 A;  1P3F C;  2F8N K;  1F66 A;  5GT3 D;  3VH5 T;  4YS3 C;  2F8N H;  2RVQ C;  2Y2G A;  3WAA A;  1TAF A;  1P3G D;  1M19 D;  3B0C W;  3O62 C;  3AZE C;  3X1S D;  4XUJ C;  1P3O A;  3AZF B;  4WU9 B;  1PZR A;  1HQ3 B;  4YM6 A;  3VH5 A;  5B40 A;  1H3O A;  3MGP D;  5AV5 D;  5CPI B;  1KX5 A;  4H9P A;  5DNM B;  3X1T A;  1ID3 D;  3A6N D;  5BNX B;  5AVC D;  3X1V A;  1U35 A;  4KGC B;  3MGQ D;  1P3B D;  1Q9C A;  5F99 C;  4XZQ D;  3AZH D;  3AYW B;  4G92 C;  5AY8 B;  4WNN A;  2UWX A;  3REH C;  3REL D;  1M18 C;  3AZK A;  2YFV A;  5CHL B;  1P3G B;  1M1A C;  2F8N A;  3UTB D;  2HIO B;  5B2I C;  3UTA B;  3KWQ B;  4QLC D;  5DNN D;  1KX4 C;  5AV6 C;  3MGR A;  3REJ C;  3AZL D;  2ZY3 A;  3UT9 D;  3MNN B;  3B0D B;  4WU8 C;  2JSS A;  4AWL B;  3AZN D;  1P3M B;  3A6N B;  2JE5 A;  5AVC B;  5B31 D;  4LD9 D;  3MGS B;  1EQZ A;  2Y2K A;  2YFW A;  5AVB C;  4R8P D;  3W96 C;  3AZH B;  5GT0 A;  2IO5 C;  4Z5T D;  4H9O A;  4ZUX D;  3REL B;  5CP6 D;  5CPJ B;  5AV8 D;  4X23 C;  3UTB B;  4Z66 C;  2LY8 A;  5DNN B;  3P5J B;  5CPK A;  3AYW C;  3TU4 A;  5AY8 C;  3WA9 A;  3A1I A;  2Y2P A;  3AZM B;  3AV1 A;  3UT9 B;  4J8V A;  3LZ1 A;  2HIO C;  3UTA C;  3KWQ C;  3C1B D;  4H9N B;  2NZD A;  5B1L B;  3W97 A;  5JRG B;  4NFT A;  5E5A A;  3WTP A;  5FUG B;  4R8P B;  3AZI B;  3AZG A;  4H9Q A;  4Z5T B;  3MNN C;  5B1M A;  4WZS B;  5AV9 B;  1P3L A;  5CP6 B;  1F66 B;  1P3M C;  3AN2 A;  2L5A A;  1P3I C;  5AV8 B;  1TZY C;  2RVQ D;  4UPK A;  5B24 A;  5JA4 B;  4JJN D;  3O62 D;  2XD5 A;  3AFA A;  3AZE D;  1P3A C;  5B33 A;  2ZM5 A;  4XUJ D;  1S32 A;  3NQU A;  1P3K A;  5KDM A;  1P34 D;  3REK C;  4E45 A;  4Z2M H;  5G49 B;  4J8X A;  1JFI A;  4ZBJ B;  2Y2M A;  3W98 A;  5B0Z C;  2BYM B;  1AOI A;  2J8P A;  1H3O B;  5GSU A;  5B2J C;  3REI C;  3AZJ C;  4H9P B;  1KX5 B;  5B31 G;  3FDD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...