5CPIA

Nucleosome containing unmethylated sat2r dna
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Influence of DNA methylation on positioning and DNA flexibility of nucleosomes with pericentric satellite DNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
molecule keywords Histone H3.1
total genus 32
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5cpiA00
3KUYB 5GXQA 3AV2D 5AV6C 3A6NA 5JRGD 3KUYC 3W98B 5JRGC 3WKJB 4X23A 4YM6A 2JSSA 4H9NB 1P34A 5B2JD 1TAFA 3WKJC 5GT3C 1F66A 3MGPB 3W96B 4R8PC 3WTPD 2AROB 4XZQB 5DNMA 4WZSB 1U35C 4ZBJB 5GT3B 4Z66C 3AV1D 1M1AC 2RVQC 3AZEA 1P3KA 3RELD 1P3BB 4E45A 5AVBC 3LJAC 3VH6W 3REIB 4LD9D 5F99D 5BO0B 2CV5A 3REIC 5B24D 5E5AB 3B6FC 4YS3A 5AV9A 5AVCC 5GSUC 5BS7C 3AZJD 1ZLAB 4H9RB 5AV9C 3WTPB 2F8ND 3REHB 5CP6B 3AZIC 3B6FA 3AZLB 5B0YB 3NQUB 1M18C 3WA9B 3AZKA 2CWEA 4H9PB 3LJAA 4Z5TB 1P3OD 5F99B 3X1UA 3UTAD 3REKA 1EQZD 5B40B 3AZMC 4J8VA 3REJD 3W98C 3MNNC 5DNMC 1HQ3B 1TZYA 1B67A 1P3AD 5AVCD 3LELD 3AN2D 3MNNA 1HQ3C 3W98A 1F66C 3AZMA 3WKJA 3X1UC 4G91C 3C1BA 4YM6C 2AROD 3RELC 3MGSB 1N1JA 1P3OB 1M18A 3AV1C 3R45B 5AV6A 3UTAB 1EQZB 5DNND 1U35D 4Z66D 4LD9B 4ZUXB 3B6GA 5BS7A 5GSUA 4R8PD 5CPKB 3C1CC 3UTBA 3X1VD 1KX3C 3REIA 2BYMB 4J8UA 4J8WA 2NZDB 1BH9B 5GT0C 5GT0D 5B32A 1P3KC 1M1AA 2HUEB 4Z5TD 3LZ1C 3WA9C 3NQUA 3WA9A 5G49B 3VH5T 5GT3A 3AZND 3W96D 5DNNC 1P3AB 4EO5C 3A6ND 5JRGA 5B32C 1ID3D 3X1TA 4X23D 1S32D 1P34D 5B2JA 4H9QB 1F66D 3MNNB 3UTBC 5AY8D 1ZLAA 1BFMA 1B6WA 4WNNB 4Z66B 3WTPA 5E5AD 1P3LA 3UT9B 5B0YA 4KUDD 3AZED 4NE5A 3AZFD 4H9PA 3MGPD 4LD9A 5F99A 3REHD 3C1BC 3W97B 5GSUB 4XZQD 4WV4B 4YS3D 1HQ3A 1TZYB 3AZJA 5AV8B 5B1LA 5CP6C 3AZIB 1KX4B 1TZYC 2NZDA 2F8NA 5B24C 4J8VC 5AVCB 3AZHC 3AZNB 1N1JB 3W99C 1P3OA 1KX4C 3X1UD 3UTAA 1EQZA 3AZKC 4J8VD 3REJA 2FJ7B 1KX5D 5FUGA 1TZYD 1P3AA 3LELA 5B33C 3AN2A 5KDMA 3MNND 3AFAC 3UTBB 3W98D 4WU8C 4YS3C 3AZMD 3WKJD 2CV5C 4WU8B 5AVBA 4KUDB 5B0ZA 1M1AB 3LZ0B 1M18D 5AV6D 1M19C 3AZEC 3AZGA 2NQBC 4KGCD 4Z66A 4KHAA 4R8PA 1P3BC 3UT9C 3X1VA 3REID 4J8UD 4J8WD 1P3MC 3AYWD 4H9OB 4ZUXC 2L5AA 3KUYA 2RVQD 3A6NC 3KXBB 3LZ1B 5B1LB 4H9QA 4KGCB 2F8NB 2HIOA 3B0DC 1BH8B 4XUJB 3KWQC 2PYOB 4J8XB 4JJNC 3WA9D 3V9RA 2PYOC 1KX5B 5GT3D 4Z5TC 3AZNA 3W96A 1ULYA 2F8NH 3NQJB 1ID3A 1H3OB 5CPIA 5AV5B 3X1TD 5DNMB 1P3GB 1R4VA 1S32A 3AV2C 5FUGB 5B40C 5AY8A 3AZJB 1ZLAD 5BO0A 2CV5B 5B1MC 5E5AA 1P3LD 4YS3B 5B0YD 4KUDA 4WU9A 3WAAD 1M19B 3AZFA 1P3PB 3X1SD 3MGPA 3O62C 4JJND 3REHA 3B6FB 2AROC 3AYWB 3O62B 3REJB 4XZQA 1P3PC 3B0BA 1HQ3D 3X1VB 1P3KB 3X1UB 5B1LD 5B2IC 1AOID 2NZDD 3AYWC 3AV1B 3WAAB 4Z2MH 1P3FC 3LZ0A 5AV8D 4J8XC 3AZGB 3MVDB 5B24B 4KGCC 2NQBD 1KX5A 3AZLA 2BYKA 3VH6T 1AOIB 1ID3B 3MGQC 3TU4C 5CPIB 5CHLB 5B33B 3AFAD 5AVBD 5B0ZD 5B2ID 1AOIC 2IO5B 3KXBA 4G92B 3AZGD 3X1SB 4QLCA 4KGCA 1P3IC 1P3ID 2HIOB 4XUJA 3AZMB 2NQBB 4J8XA 3C1BB 4WU9B 4NE3A 3W99D 1P3FA 3MGSA 3X1SC 3AYWA 4UUZB 1S32B 3KUYD 4XZQC 1U35B 2HIOD 4J8WB 5B40D 5AV8C 2YFWA 1BH9A 5BNXB 4Z2MG 5B32B 2HUEC 5CPKC 5E5AC 5BT1D 2FJ7C 5CPID 5GT0B 1WWIA 3B0CT 5B31C 1P3PD 2F8NK 5JRGB 5B31D 3W97A 3O62D 1P3IB 2YFVB 1ID3C 5CPJC 4ZUXD 5B1MB 4H9SA 5B2JB 4H9SC 4WU9D 3WAAA 5CPKD 3X1SA 5CPJA 3MGSC 3W97C 4JJNA 1KU5A 3MVDA 3MGRC 3VH5W 1F66B 1M19D 3KXBC 1AOIA 2FJ7A 3MGRB 1P3MB 3AZEB 3X1VC 3C1CD 1KX3D 1WWSA 5KDMB 1P3BA 3TU4A 4CAYB 3LZ0D 5GXQB 5B33D 5AV8A 3A6NB 3KWQD 2YFWB 3AZLC 3AZGC 2NQBA 3AZLD 1TAFB 4NE6A 1P3FB 1KX4D 3B0CW 3AZHD 5B31B 4KHAB 3AFAA 3UT9D 1A7WA 3MGQD 5B2IA 3KXBD 4QLCD 1JFIA 1P3IA 4XUJD 4QLCC 4J8XD 1P3FD 3REHC 3W99A 4E44A 3MGSD 5CPJB 5B0ZB 5JA4A 3AV2B 3AZID 4WU8D 5CP6A 5B1LC 3AZJC 4R8PB 3C1CB 3R45A 5AV6B 1KX3B 1H3OA 1HTAA 5BNVA 3MGRA 5B40A 4LD9C 3MVDC 1S32C 2YFVA 5AY8B 5B0YC 3RELB 3WAAC 1P3LC 3AZHB 4JJNB 2PYOA 4HGAB 5B1MD 1ZLAC 3VH5A 3AZFB 5C3IB 3LZ1D 1P3PA 4CSRB 3MGQB 4G92C 5B31A 3X1TC 3O62A 3W97D 5G49A 3AFAB 1Q9CA 4ZUXA 3AZFC 3B6GB 1P3MA 4WU9C 5CPKA 5DNNB 5CPJD 1JFIB 5AV5D 2BYMA 4J8UB 3X1TB 1P3GD 3MVDD 5JA4B 5GXQD 1M19A 3AV2A 4WNNA 5BT1C 2FJ7D 4J8WC 4YM6D 2IO5C 2BYKB 3W96C 3C1CA 1KX3A 1F1EA 1P3BD 3TU4D 5B2IB 5B33A 4ZBJC 3KWQA 4G91B 5DNMD 4XUJC 3REJC 3AV1A 3WTPE 1P3KD 3W99B 3UTAC 1EQZC 3RELA 1KX4A 3AZHA 4X23B 1P34B 4H9NA 4EO5B 2CV5D 5B24A 1P3LB 3UT9A 5B31G 5AV9D 3MGQA 4AWLC 1KX5C 5BNVB 3B6FD 3REKC 4DRAA 5B0ZC 3AZKD 3LELB 5F99C 3AN2B 3LZ0C 2F8NG 3LJAD 2LY8A 4AWLB 3VH6A 3REKD 3AZIA 4QLCB 4WU8A 5BNXA 5CP6D 4YM6B 3LELC 3AN2C 1P3AC 4M6BA 5AVCA 4CSRA 3MGRD 5B2JC 3C1BD 1P3OC 2AROA 4UUZA 3LJAB 3MGPC 4NFTA 5DNNA 3KWQB 4KUDC 1U35A 2NZDC 2PYOD 3B6GD 5B1MA 5GSUD 3LZ1A 5AY8C 5AV9B 4DRBA 5AVBB 3UTBD 1BH8A 5C3IC 4H9RA 4X23C 1P34C 3B0DB 4HGAC 3V9RB 5CPIC 5GT0A 5GXQC 5B32D 1P3MD 1M18B 3AZKB 1M1AD 4J8UC 3NQJA 4Z5TA 3WTPC 3AZNC 5AV5A 1P3GA 5B32G 3REKB 4J8VB 5AV5C 1P3GC 4H9OA 3B6GC 2HIOC 3TU4B 3KSYA 4CAYA
chains in the Genus database with same CATH superfamily
3KUYB 5GXQA 3AV2D 5AV6C 3A6NA 5JRGD 3KUYC 3W98B 5JRGC 3WKJB 4X23A 4YM6A 2JSSA 2RIQA 4H9NB 1P34A 5B2JD 1TAFA 3WKJC 5GT3C 1F66A 3MGPB 3W96B 2W8SA 4R8PC 2DF4C 3WTPD 2AROB 4XZQB 5DNMA 4WZSB 1U35C 4ZBJB 5GT3B 4Z66C 3AV1D 1M1AC 2RVQC 3AZEA 1P3KA 3RELD 1P3BB 4E45A 5AVBC 3LJAC 3VH6W 3REIB 4LD9D 5F99D 5BO0B 2CV5A 3REIC 5B24D 5E5AB 3B6FC 4YS3A 5AV9A 2G5HC 5AVCC 5GSUC 5BS7C 3AZJD 1ZLAB 4H9RB 3FDDA 2UWXA 5AV9C 3WTPB 2F8ND 3REHB 5CP6B 3AZIC 3B6FA 3AZLB 5B0YB 3NQUB 1M18C 3WA9B 3AZKA 2CWEA 4H9PB 3LJAA 4Z5TB 1P3OD 5F99B 3X1UA 3UTAD 3REKA 4UPKA 1EQZD 5B40B 3AZMC 2XD1A 4J8VA 3REJD 3W98C 3MNNC 5DNMC 1HQ3B 1TZYA 1B67A 1P3AD 5AVCD 3LELD 3AN2D 3MNNA 1HQ3C 3W98A 1F66C 3AZMA 3WKJA 3X1UC 4G91C 3C1BA 4YM6C 2AROD 3RELC 3MGSB 1N1JA 3H0LC 1P3OB 1M18A 3AV1C 3R45B 5AV6A 3UTAB 1EQZB 5DNND 1U35D 4Z66D 2DQNC 4LD9B 3H0RC 4ZUXB 3B6GA 5BS7A 5GSUA 4R8PD 5CPKB 3C1CC 3UTBA 3X1VD 1KX3C 3REIA 2BYMB 4J8UA 4J8WA 2NZDB 1BH9B 5GT0C 5GT0D 2Y2KA 5B32A 1P3KC 1M1AA 2HUEB 4Z5TD 3LZ1C 3WA9C 3NQUA 3WA9A 5G49B 3VH5T 5GT3A 3A1KA 3AZND 3W96D 5DNNC 1P3AB 4EO5C 3A6ND 5JRGA 5B32C 1ID3D 3EPKA 3X1TA 4X23D 1S32D 1P34D 5B2JA 4H9QB 1F66D 3MNNB 3UTBC 5AY8D 1ZLAA 1BFMA 1B6WA 4WNNB 4Z66B 3WTPA 5E5AD 1P3LA 3UT9B 3EPLA 5B0YA 4KUDD 3AZED 4NE5A 3AZFD 4H9PA 3MGPD 4LD9A 5F99A 3REHD 2ZY3A 3C1BC 3W97B 5GSUB 4XZQD 4WV4B 4YS3D 1HQ3A 1TZYB 3AZJA 5AV8B 5B1LA 5CP6C 3AZIB 1KX4B 1TZYC 2NZDA 2F8NA 5B24C 4J8VC 5AVCB 1W2EA 1T3UA 3AZHC 3AZNB 1N1JB 3IP4C 3W99C 1P3OA 1KX4C 3X1UD 3UTAA 1EQZA 2JCHA 3AZKC 4J8VD 3REJA 2FJ7B 1KX5D 5FUGA 1TZYD 1P3AA 3LELA 5B33C 3AN2A 5KDMA 3MNND 3AFAC 3UTBB 2ZY2A 3W98D 3EG5B 4YS3C 4WU8C 3AZMD 3WKJD 2CV5C 4WU8B 5AVBA 4KUDB 5B0ZA 1M1AB 3LZ0B 1M18D 5AV6D 1M19C 3AZEC 3AZGA 2NQBC 4KGCD 4Z66A 2G5IC 4KHAA 4R8PA 1P3BC 3UT9C 3X1VA 3REID 4J8UD 4J8WD 1P3MC 3AYWD 4H9OB 4ZUXC 2L5AA 3KUYA 2RVQD 3A6NC 3KXBB 3LZ1B 5B1LB 2ZY4A 4H9QA 2VQRA 4KGCB 2F8NB 2HIOA 3B0DC 1BH8B 4XUJB 3KWQC 2PYOB 4J8XB 2Y2NA 4JJNC 3WA9D 3V9RA 2PYOC 1KX5B 5GT3D 4Z5TC 3AZNA 3W96A 2Y2OA 1ULYA 2Y2GA 3NQJB 1ID3A 2F8NH 1H3OB 5CPIA 5AV5B 3X1TD 5DNMB 1P3GB 1R4VA 1S32A 3AV2C 5FUGB 5B40C 2Y2JA 5AY8A 3AZJB 1ZLAD 5BO0A 2CV5B 5B1MC 5E5AA 1P3LD 4YS3B 5B0YD 2ZM5A 4WU9A 4KUDA 3WAAD 1M19B 3AZFA 1P3PB 3X1SD 3MGPA 3O62C 4JJND 3REHA 3B6FB 2AROC 3AYWB 3O62B 3REJB 4XZQA 3A1IA 1P3PC 3B0BA 1HQ3D 3X1VB 1P3KB 3X1UB 5B1LD 5B2IC 1AOID 2NZDD 3AYWC 3AV1B 3WAAB 4Z2MH 1P3FC 3LZ0A 5AV8D 4J8XC 3AZGB 3MVDB 5B24B 4KGCC 2NQBD 1KX5A 3AZLA 2BYKA 3VH6T 1AOIB 1ID3B 3MGQC 3TU4C 5CPIB 5CHLB 5B33B 3AFAD 5AVBD 5B0ZD 5B2ID 1AOIC 1Z2CB 2IO5B 3KXBA 4G92B 3AZGD 3X1SB 4QLCA 4KGCA 1P3IC 1P3ID 2HIOB 4XUJA 3AZMB 2NQBB 4J8XA 3C1BB 4WU9B 2J8PA 4NE3A 3W99D 1P3FA 4DQYB 3MGSA 3X1SC 3AYWA 4UUZB 1S32B 3KUYD 4XZQC 1U35B 2HIOD 4J8WB 5B40D 5AV8C 2YFWA 1BH9A 5BNXB 4Z2MG 2XD5A 5B32B 2HUEC 5CPKC 2F2AC 5E5AC 5BT1D 2FJ7C 5CPID 5GT0B 1WWIA 3B0CT 5B31C 1P3PD 2F8NK 5JRGB 5B31D 3W97A 3O62D 1P3IB 2YFVB 1ID3C 5CPJC 4ZUXD 5B1MB 4H9SA 5B2JB 4H9SC 4WU9D 3WAAA 5CPKD 3X1SA 5CPJA 3MGSC 3W97C 4JJNA 4WJ3C 1KU5A 3MVDA 3MGRC 3VH5W 1F66B 1M19D 2JE5A 3KXBC 1AOIA 2FJ7A 3MGRB 1P3MB 3AZEB 3X1VC 3C1CD 1KX3D 1WWSA 5KDMB 1P3BA 3TU4A 4CAYB 3LZ0D 5GXQB 5B33D 5AV8A 3A6NB 3KWQD 2YFWB 3AZLC 3AZGC 2NQBA 3EPHA 3AZLD 1TAFB 4NE6A 1P3FB 2Y2LA 1KX4D 3B0CW 3AZHD 5B31B 4KHAB 3AFAA 3UT9D 1A7WA 3MGQD 5B2IA 3KXBD 4QLCD 1JFIA 1P3IA 4XUJD 4QLCC 2BG1A 3H0MC 4J8XD 3AL0C 1P3FD 3REHC 3W99A 4E44A 3MGSD 5CPJB 5B0ZB 5JA4A 3AV2B 3AZID 4WU8D 5CP6A 5B1LC 3AZJC 2Y2PA 4R8PB 3C1CB 3R45A 5AV6B 1KX3B 3P5JB 1H3OA 1HTAA 5BNVA 3MGRA 5B40A 4LD9C 3MVDC 1S32C 2YFVA 3F6TA 5AY8B 5B0YC 3RELB 3WAAC 1P3LC 3AZHB 4JJNB 2PYOA 4HGAB 5B1MD 1ZLAC 3VH5A 2ZY5A 5C3IB 3LZ1D 3AZFB 1P3PA 4CSRB 3MGQB 4G92C 5B31A 3X1TC 3O62A 3W97D 5G49A 3AFAB 1Q9CA 4ZUXA 3AZFC 3B6GB 1P3MA 4WU9C 5CPKA 5DNNB 5CPJD 1JFIB 2Y2QA 5AV5D 2BYMA 4J8UB 3X1TB 1P3GD 3MVDD 2Y2HA 2FFFB 5JA4B 5GXQD 1M19A 3AV2A 4WNNA 5BT1C 2FJ7D 4J8WC 4YM6D 2IO5C 2BYKB 3W96C 3C1CA 1KX3A 1F1EA 1P3BD 3TU4D 5B2IB 5B33A 4ZBJC 3KWQA 4G91B 5DNMD 4XUJC 3REJC 3AV1A 3WTPE 1P3KD 3W99B 3UTAC 1EQZC 3RELA 1KX4A 3AZHA 4X23B 1P34B 4H9NA 4EO5B 2CV5D 5B24A 1P3LB 3UT9A 5B31G 5AV9D 3MGQA 2Y2MA 4AWLC 1KX5C 5BNVB 3B6FD 1PZRA 3REKC 4DRAA 5B0ZC 3AZKD 3LELB 5F99C 3AN2B 3LZ0C 2F8NG 3LJAD 2LY8A 3EPJA 4AWLB 2Y2IA 3VH6A 3REKD 3AZIA 4QLCB 4WU8A 5BNXA 5CP6D 4YM6B 3LELC 3AN2C 1P3AC 4M6BA 5AVCA 4CSRA 3MGRD 5B2JC 3C1BD 1P3OC 2AROA 4UUZA 3LJAB 3MGPC 4NFTA 5DNNA 3KWQB 4KUDC 1U35A 2NZDC 2PYOD 3B6GD 5B1MA 5GSUD 3LZ1A 5AY8C 5AV9B 4DRBA 5AVBB 3UTBD 1BH8A 5C3IC 4H9RA 4X23C 1P34C 3B0DB 4HGAC 3KFUG 3V9RB 5CPIC 5GT0A 5GXQC 5B32D 1P3MD 1M18B 3AZKB 1M1AD 4J8UC 3NQJA 4Z5TA 3WTPC 3AZNC 5AV5A 1P3GA 5B32G 3REKB 4J8VB 5AV5C 1P3GC 4H9OA 3B6GC 2HIOC 3TU4B 3KSYA 4CAYA
chains in the Genus database with same CATH topology
3KUYB 5GXQA 3AV2D 5AV6C 3A6NA 5JRGD 3KUYC 3W98B 5JRGC 3WKJB 4X23A 4YM6A 2JSSA 2RIQA 4H9NB 1P34A 5B2JD 1TAFA 3WKJC 5GT3C 1F66A 3MGPB 3W96B 2W8SA 4R8PC 2DF4C 3WTPD 2AROB 4XZQB 5DNMA 4WZSB 1U35C 4ZBJB 5GT3B 4Z66C 3AV1D 1M1AC 2RVQC 3AZEA 1P3KA 3RELD 1P3BB 4E45A 5AVBC 3LJAC 3VH6W 3REIB 4LD9D 5F99D 5BO0B 2CV5A 3REIC 5B24D 5E5AB 3B6FC 4YS3A 5AV9A 2G5HC 5AVCC 5GSUC 5BS7C 3AZJD 1ZLAB 4H9RB 3FDDA 2UWXA 5AV9C 3WTPB 2F8ND 3REHB 5CP6B 3AZIC 3B6FA 3AZLB 5B0YB 3NQUB 1M18C 3WA9B 3AZKA 2CWEA 4H9PB 3LJAA 4Z5TB 1P3OD 5F99B 3X1UA 3UTAD 3REKA 4UPKA 1EQZD 5B40B 3AZMC 2XD1A 4J8VA 3REJD 3W98C 3MNNC 5DNMC 1HQ3B 1TZYA 1B67A 1P3AD 5AVCD 3LELD 3AN2D 3MNNA 1HQ3C 3W98A 1F66C 3AZMA 3WKJA 3X1UC 4G91C 3C1BA 4YM6C 2AROD 3RELC 3MGSB 1N1JA 3H0LC 1P3OB 1M18A 3AV1C 3R45B 5AV6A 3UTAB 1EQZB 5DNND 1U35D 4Z66D 2DQNC 4LD9B 3H0RC 4ZUXB 3B6GA 5BS7A 5GSUA 4R8PD 5CPKB 3C1CC 3UTBA 3X1VD 1KX3C 3REIA 2BYMB 4J8UA 4J8WA 2NZDB 1BH9B 5GT0C 5GT0D 2Y2KA 5B32A 1P3KC 1M1AA 2HUEB 4Z5TD 3LZ1C 3WA9C 3NQUA 3WA9A 5G49B 3VH5T 5GT3A 3A1KA 3AZND 3W96D 5DNNC 1P3AB 4EO5C 3A6ND 5JRGA 5B32C 1ID3D 3EPKA 3X1TA 4X23D 1S32D 1P34D 5B2JA 4H9QB 1F66D 3MNNB 3UTBC 5AY8D 1ZLAA 1BFMA 1B6WA 4WNNB 4Z66B 3WTPA 5E5AD 1P3LA 3UT9B 3EPLA 5B0YA 4KUDD 3AZED 4NE5A 3AZFD 4H9PA 3MGPD 4LD9A 5F99A 3REHD 2ZY3A 3C1BC 3W97B 5GSUB 4XZQD 4WV4B 4YS3D 1HQ3A 1TZYB 3AZJA 5AV8B 5B1LA 5CP6C 3AZIB 1KX4B 1TZYC 2NZDA 2F8NA 5B24C 4J8VC 5AVCB 1W2EA 1T3UA 3AZHC 3AZNB 1N1JB 3IP4C 3W99C 1P3OA 1KX4C 3X1UD 3UTAA 1EQZA 2JCHA 3AZKC 4J8VD 3REJA 2FJ7B 1KX5D 5FUGA 1TZYD 1P3AA 3LELA 5B33C 3AN2A 5KDMA 3MNND 3AFAC 3UTBB 2ZY2A 3W98D 3EG5B 4YS3C 4WU8C 3AZMD 3WKJD 2CV5C 4WU8B 5AVBA 4KUDB 5B0ZA 1M1AB 3LZ0B 1M18D 5AV6D 1M19C 3AZEC 3AZGA 2NQBC 4KGCD 4Z66A 2G5IC 4KHAA 4R8PA 1P3BC 3UT9C 3X1VA 3REID 4J8UD 4J8WD 1P3MC 3AYWD 4H9OB 4ZUXC 2L5AA 3KUYA 2RVQD 3A6NC 3KXBB 3LZ1B 5B1LB 2ZY4A 4H9QA 2VQRA 4KGCB 2F8NB 2HIOA 3B0DC 1BH8B 4XUJB 3KWQC 2PYOB 4J8XB 2Y2NA 4JJNC 3WA9D 3V9RA 2PYOC 1KX5B 5GT3D 4Z5TC 3AZNA 3W96A 2Y2OA 1ULYA 2Y2GA 3NQJB 1ID3A 2F8NH 1H3OB 5CPIA 5AV5B 3X1TD 5DNMB 1P3GB 1R4VA 1S32A 3AV2C 5FUGB 5B40C 2Y2JA 5AY8A 3AZJB 1ZLAD 5BO0A 2CV5B 5B1MC 5E5AA 1P3LD 4YS3B 5B0YD 2ZM5A 4WU9A 4KUDA 3WAAD 1M19B 3AZFA 1P3PB 3X1SD 3MGPA 3O62C 4JJND 3REHA 3B6FB 2AROC 3AYWB 3O62B 3REJB 4XZQA 3A1IA 1P3PC 3B0BA 1HQ3D 3X1VB 1P3KB 3X1UB 5B1LD 5B2IC 1AOID 2NZDD 3AYWC 3AV1B 3WAAB 4Z2MH 1P3FC 3LZ0A 5AV8D 4J8XC 3AZGB 3MVDB 5B24B 4KGCC 2NQBD 1KX5A 3AZLA 2BYKA 3VH6T 1AOIB 1ID3B 3MGQC 3TU4C 5CPIB 5CHLB 5B33B 3AFAD 5AVBD 5B0ZD 5B2ID 1AOIC 1Z2CB 2IO5B 3KXBA 4G92B 3AZGD 3X1SB 4QLCA 4KGCA 1P3IC 1P3ID 2HIOB 4XUJA 3AZMB 2NQBB 4J8XA 3C1BB 4WU9B 2J8PA 4NE3A 3W99D 1P3FA 4DQYB 3MGSA 3X1SC 3AYWA 4UUZB 1S32B 3KUYD 4XZQC 1U35B 2HIOD 4J8WB 5B40D 5AV8C 2YFWA 1BH9A 5BNXB 4Z2MG 2XD5A 5B32B 2HUEC 5CPKC 2F2AC 5E5AC 5BT1D 2FJ7C 5CPID 5GT0B 1WWIA 3B0CT 5B31C 1P3PD 2F8NK 5JRGB 5B31D 3W97A 3O62D 1P3IB 2YFVB 1ID3C 5CPJC 4ZUXD 5B1MB 4H9SA 5B2JB 4H9SC 4WU9D 3WAAA 5CPKD 3X1SA 5CPJA 3MGSC 3W97C 4JJNA 4WJ3C 1KU5A 3MVDA 3MGRC 3VH5W 1F66B 1M19D 2JE5A 3KXBC 1AOIA 2FJ7A 3MGRB 1P3MB 3AZEB 3X1VC 3C1CD 1KX3D 1WWSA 5KDMB 1P3BA 3TU4A 4CAYB 3LZ0D 5GXQB 5B33D 5AV8A 3A6NB 3KWQD 2YFWB 3AZLC 3AZGC 2NQBA 3EPHA 3AZLD 1TAFB 4NE6A 1P3FB 2Y2LA 1KX4D 3B0CW 3AZHD 5B31B 4KHAB 3AFAA 3UT9D 1A7WA 3MGQD 5B2IA 3KXBD 4QLCD 1JFIA 1P3IA 4XUJD 4QLCC 2BG1A 3H0MC 4J8XD 3AL0C 1P3FD 3REHC 3W99A 4E44A 3MGSD 5CPJB 5B0ZB 5JA4A 3AV2B 3AZID 4WU8D 5CP6A 5B1LC 3AZJC 2Y2PA 4R8PB 3C1CB 3R45A 5AV6B 1KX3B 3P5JB 1H3OA 1HTAA 5BNVA 3MGRA 5B40A 4LD9C 3MVDC 1S32C 2YFVA 3F6TA 5AY8B 5B0YC 3RELB 3WAAC 1P3LC 3AZHB 4JJNB 2PYOA 4HGAB 5B1MD 1ZLAC 3VH5A 2ZY5A 5C3IB 3LZ1D 3AZFB 1P3PA 4CSRB 3MGQB 4G92C 5B31A 3X1TC 3O62A 3W97D 5G49A 3AFAB 1Q9CA 4ZUXA 3AZFC 3B6GB 1P3MA 4WU9C 5CPKA 5DNNB 5CPJD 1JFIB 2Y2QA 5AV5D 2BYMA 4J8UB 3X1TB 1P3GD 3MVDD 2Y2HA 2FFFB 5JA4B 5GXQD 1M19A 3AV2A 4WNNA 5BT1C 2FJ7D 4J8WC 4YM6D 2IO5C 2BYKB 3W96C 3C1CA 1KX3A 1F1EA 1P3BD 3TU4D 5B2IB 5B33A 4ZBJC 3KWQA 4G91B 5DNMD 4XUJC 3REJC 3AV1A 3WTPE 1P3KD 3W99B 3UTAC 1EQZC 3RELA 1KX4A 3AZHA 4X23B 1P34B 4H9NA 4EO5B 2CV5D 5B24A 1P3LB 3UT9A 5B31G 5AV9D 3MGQA 2Y2MA 4AWLC 1KX5C 5BNVB 3B6FD 1PZRA 3REKC 4DRAA 5B0ZC 3AZKD 3LELB 5F99C 3AN2B 3LZ0C 2F8NG 3LJAD 2LY8A 3EPJA 4AWLB 2Y2IA 3VH6A 3REKD 3AZIA 4QLCB 4WU8A 5BNXA 5CP6D 4YM6B 3LELC 3AN2C 1P3AC 4M6BA 5AVCA 4CSRA 3MGRD 5B2JC 3C1BD 1P3OC 2AROA 4UUZA 3LJAB 3MGPC 4NFTA 5DNNA 3KWQB 4KUDC 1U35A 2NZDC 2PYOD 3B6GD 5B1MA 5GSUD 3LZ1A 5AY8C 5AV9B 4DRBA 5AVBB 3UTBD 1BH8A 5C3IC 4H9RA 4X23C 1P34C 3B0DB 4HGAC 3KFUG 3V9RB 5CPIC 5GT0A 5GXQC 5B32D 1P3MD 1M18B 3AZKB 1M1AD 4J8UC 3NQJA 4Z5TA 3WTPC 3AZNC 5AV5A 1P3GA 5B32G 3REKB 4J8VB 5AV5C 1P3GC 4H9OA 3B6GC 2HIOC 3TU4B 3KSYA 4CAYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KUY B;  5GXQ A;  3AV2 D;  5AV6 C;  3A6N A;  5JRG D;  3KUY C;  3W98 B;  5JRG C;  3WKJ B;  4X23 A;  4YM6 A;  2JSS A;  4H9N B;  1P34 A;  5B2J D;  1TAF A;  3WKJ C;  5GT3 C;  1F66 A;  3MGP B;  3W96 B;  4R8P C;  3WTP D;  2ARO B;  4XZQ B;  5DNM A;  4WZS B;  1U35 C;  4ZBJ B;  5GT3 B;  4Z66 C;  3AV1 D;  1M1A C;  2RVQ C;  3AZE A;  1P3K A;  3REL D;  1P3B B;  4E45 A;  5AVB C;  3LJA C;  3VH6 W;  3REI B;  4LD9 D;  5F99 D;  5BO0 B;  2CV5 A;  3REI C;  5B24 D;  5E5A B;  3B6F C;  4YS3 A;  5AV9 A;  5AVC C;  5GSU C;  5BS7 C;  3AZJ D;  1ZLA B;  4H9R B;  5AV9 C;  3WTP B;  2F8N D;  3REH B;  5CP6 B;  3AZI C;  3B6F A;  3AZL B;  5B0Y B;  3NQU B;  1M18 C;  3WA9 B;  3AZK A;  2CWE A;  4H9P B;  3LJA A;  4Z5T B;  1P3O D;  5F99 B;  3X1U A;  3UTA D;  3REK A;  1EQZ D;  5B40 B;  3AZM C;  4J8V A;  3REJ D;  3W98 C;  3MNN C;  5DNM C;  1HQ3 B;  1TZY A;  1B67 A;  1P3A D;  5AVC D;  3LEL D;  3AN2 D;  3MNN A;  1HQ3 C;  3W98 A;  1F66 C;  3AZM A;  3WKJ A;  3X1U C;  4G91 C;  3C1B A;  4YM6 C;  2ARO D;  3REL C;  3MGS B;  1N1J A;  1P3O B;  1M18 A;  3AV1 C;  3R45 B;  5AV6 A;  3UTA B;  1EQZ B;  5DNN D;  1U35 D;  4Z66 D;  4LD9 B;  4ZUX B;  3B6G A;  5BS7 A;  5GSU A;  4R8P D;  5CPK B;  3C1C C;  3UTB A;  3X1V D;  1KX3 C;  3REI A;  2BYM B;  4J8U A;  4J8W A;  2NZD B;  1BH9 B;  5GT0 C;  5GT0 D;  5B32 A;  1P3K C;  1M1A A;  2HUE B;  4Z5T D;  3LZ1 C;  3WA9 C;  3NQU A;  3WA9 A;  5G49 B;  3VH5 T;  5GT3 A;  3AZN D;  3W96 D;  5DNN C;  1P3A B;  4EO5 C;  3A6N D;  5JRG A;  5B32 C;  1ID3 D;  3X1T A;  4X23 D;  1S32 D;  1P34 D;  5B2J A;  4H9Q B;  1F66 D;  3MNN B;  3UTB C;  5AY8 D;  1ZLA A;  1BFM A;  1B6W A;  4WNN B;  4Z66 B;  3WTP A;  5E5A D;  1P3L A;  3UT9 B;  5B0Y A;  4KUD D;  3AZE D;  4NE5 A;  3AZF D;  4H9P A;  3MGP D;  4LD9 A;  5F99 A;  3REH D;  3C1B C;  3W97 B;  5GSU B;  4XZQ D;  4WV4 B;  4YS3 D;  1HQ3 A;  1TZY B;  3AZJ A;  5AV8 B;  5B1L A;  5CP6 C;  3AZI B;  1KX4 B;  1TZY C;  2NZD A;  2F8N A;  5B24 C;  4J8V C;  5AVC B;  3AZH C;  3AZN B;  1N1J B;  3W99 C;  1P3O A;  1KX4 C;  3X1U D;  3UTA A;  1EQZ A;  3AZK C;  4J8V D;  3REJ A;  2FJ7 B;  1KX5 D;  5FUG A;  1TZY D;  1P3A A;  3LEL A;  5B33 C;  3AN2 A;  5KDM A;  3MNN D;  3AFA C;  3UTB B;  3W98 D;  4WU8 C;  4YS3 C;  3AZM D;  3WKJ D;  2CV5 C;  4WU8 B;  5AVB A;  4KUD B;  5B0Z A;  1M1A B;  3LZ0 B;  1M18 D;  5AV6 D;  1M19 C;  3AZE C;  3AZG A;  2NQB C;  4KGC D;  4Z66 A;  4KHA A;  4R8P A;  1P3B C;  3UT9 C;  3X1V A;  3REI D;  4J8U D;  4J8W D;  1P3M C;  3AYW D;  4H9O B;  4ZUX C;  2L5A A;  3KUY A;  2RVQ D;  3A6N C;  3KXB B;  3LZ1 B;  5B1L B;  4H9Q A;  4KGC B;  2F8N B;  2HIO A;  3B0D C;  1BH8 B;  4XUJ B;  3KWQ C;  2PYO B;  4J8X B;  4JJN C;  3WA9 D;  3V9R A;  2PYO C;  1KX5 B;  5GT3 D;  4Z5T C;  3AZN A;  3W96 A;  1ULY A;  2F8N H;  3NQJ B;  1ID3 A;  1H3O B;  5CPI A;  5AV5 B;  3X1T D;  5DNM B;  1P3G B;  1R4V A;  1S32 A;  3AV2 C;  5FUG B;  5B40 C;  5AY8 A;  3AZJ B;  1ZLA D;  5BO0 A;  2CV5 B;  5B1M C;  5E5A A;  1P3L D;  4YS3 B;  5B0Y D;  4KUD A;  4WU9 A;  3WAA D;  1M19 B;  3AZF A;  1P3P B;  3X1S D;  3MGP A;  3O62 C;  4JJN D;  3REH A;  3B6F B;  2ARO C;  3AYW B;  3O62 B;  3REJ B;  4XZQ A;  1P3P C;  3B0B A;  1HQ3 D;  3X1V B;  1P3K B;  3X1U B;  5B1L D;  5B2I C;  1AOI D;  2NZD D;  3AYW C;  3AV1 B;  3WAA B;  4Z2M H;  1P3F C;  3LZ0 A;  5AV8 D;  4J8X C;  3AZG B;  3MVD B;  5B24 B;  4KGC C;  2NQB D;  1KX5 A;  3AZL A;  2BYK A;  3VH6 T;  1AOI B;  1ID3 B;  3MGQ C;  3TU4 C;  5CPI B;  5CHL B;  5B33 B;  3AFA D;  5AVB D;  5B0Z D;  5B2I D;  1AOI C;  2IO5 B;  3KXB A;  4G92 B;  3AZG D;  3X1S B;  4QLC A;  4KGC A;  1P3I C;  1P3I D;  2HIO B;  4XUJ A;  3AZM B;  2NQB B;  4J8X A;  3C1B B;  4WU9 B;  4NE3 A;  3W99 D;  1P3F A;  3MGS A;  3X1S C;  3AYW A;  4UUZ B;  1S32 B;  3KUY D;  4XZQ C;  1U35 B;  2HIO D;  4J8W B;  5B40 D;  5AV8 C;  2YFW A;  1BH9 A;  5BNX B;  4Z2M G;  5B32 B;  2HUE C;  5CPK C;  5E5A C;  5BT1 D;  2FJ7 C;  5CPI D;  5GT0 B;  1WWI A;  3B0C T;  5B31 C;  1P3P D;  2F8N K;  5JRG B;  5B31 D;  3W97 A;  3O62 D;  1P3I B;  2YFV B;  1ID3 C;  5CPJ C;  4ZUX D;  5B1M B;  4H9S A;  5B2J B;  4H9S C;  4WU9 D;  3WAA A;  5CPK D;  3X1S A;  5CPJ A;  3MGS C;  3W97 C;  4JJN A;  1KU5 A;  3MVD A;  3MGR C;  3VH5 W;  1F66 B;  1M19 D;  3KXB C;  1AOI A;  2FJ7 A;  3MGR B;  1P3M B;  3AZE B;  3X1V C;  3C1C D;  1KX3 D;  1WWS A;  5KDM B;  1P3B A;  3TU4 A;  4CAY B;  3LZ0 D;  5GXQ B;  5B33 D;  5AV8 A;  3A6N B;  3KWQ D;  2YFW B;  3AZL C;  3AZG C;  2NQB A;  3AZL D;  1TAF B;  4NE6 A;  1P3F B;  1KX4 D;  3B0C W;  3AZH D;  5B31 B;  4KHA B;  3AFA A;  3UT9 D;  1A7W A;  3MGQ D;  5B2I A;  3KXB D;  4QLC D;  1JFI A;  1P3I A;  4XUJ D;  4QLC C;  4J8X D;  1P3F D;  3REH C;  3W99 A;  4E44 A;  3MGS D;  5CPJ B;  5B0Z B;  5JA4 A;  3AV2 B;  3AZI D;  4WU8 D;  5CP6 A;  5B1L C;  3AZJ C;  4R8P B;  3C1C B;  3R45 A;  5AV6 B;  1KX3 B;  1H3O A;  1HTA A;  5BNV A;  3MGR A;  5B40 A;  4LD9 C;  3MVD C;  1S32 C;  2YFV A;  5AY8 B;  5B0Y C;  3REL B;  3WAA C;  1P3L C;  3AZH B;  4JJN B;  2PYO A;  4HGA B;  5B1M D;  1ZLA C;  3VH5 A;  3AZF B;  5C3I B;  3LZ1 D;  1P3P A;  4CSR B;  3MGQ B;  4G92 C;  5B31 A;  3X1T C;  3O62 A;  3W97 D;  5G49 A;  3AFA B;  1Q9C A;  4ZUX A;  3AZF C;  3B6G B;  1P3M A;  4WU9 C;  5CPK A;  5DNN B;  5CPJ D;  1JFI B;  5AV5 D;  2BYM A;  4J8U B;  3X1T B;  1P3G D;  3MVD D;  5JA4 B;  5GXQ D;  1M19 A;  3AV2 A;  4WNN A;  5BT1 C;  2FJ7 D;  4J8W C;  4YM6 D;  2IO5 C;  2BYK B;  3W96 C;  3C1C A;  1KX3 A;  1F1E A;  1P3B D;  3TU4 D;  5B2I B;  5B33 A;  4ZBJ C;  3KWQ A;  4G91 B;  5DNM D;  4XUJ C;  3REJ C;  3AV1 A;  3WTP E;  1P3K D;  3W99 B;  3UTA C;  1EQZ C;  3REL A;  1KX4 A;  3AZH A;  4X23 B;  1P34 B;  4H9N A;  4EO5 B;  2CV5 D;  5B24 A;  1P3L B;  3UT9 A;  5B31 G;  5AV9 D;  3MGQ A;  4AWL C;  1KX5 C;  5BNV B;  3B6F D;  3REK C;  4DRA A;  5B0Z C;  3AZK D;  3LEL B;  5F99 C;  3AN2 B;  3LZ0 C;  2F8N G;  3LJA D;  2LY8 A;  4AWL B;  3VH6 A;  3REK D;  3AZI A;  4QLC B;  4WU8 A;  5BNX A;  5CP6 D;  4YM6 B;  3LEL C;  3AN2 C;  1P3A C;  4M6B A;  5AVC A;  4CSR A;  3MGR D;  5B2J C;  3C1B D;  1P3O C;  2ARO A;  4UUZ A;  3LJA B;  3MGP C;  4NFT A;  5DNN A;  3KWQ B;  4KUD C;  1U35 A;  2NZD C;  2PYO D;  3B6G D;  5B1M A;  5GSU D;  3LZ1 A;  5AY8 C;  5AV9 B;  4DRB A;  5AVB B;  3UTB D;  1BH8 A;  5C3I C;  4H9R A;  4X23 C;  1P34 C;  3B0D B;  4HGA C;  3V9R B;  5CPI C;  5GT0 A;  5GXQ C;  5B32 D;  1P3M D;  1M18 B;  3AZK B;  1M1A D;  4J8U C;  3NQJ A;  4Z5T A;  3WTP C;  3AZN C;  5AV5 A;  1P3G A;  5B32 G;  3REK B;  4J8V B;  5AV5 C;  1P3G C;  4H9O A;  3B6G C;  2HIO C;  3TU4 B;  3KSY A;  4CAY A; 
#chains in the Genus database with same CATH topology
 3KUY B;  5GXQ A;  3AV2 D;  5AV6 C;  3A6N A;  5JRG D;  3KUY C;  3W98 B;  5JRG C;  3WKJ B;  4X23 A;  4YM6 A;  2JSS A;  2RIQ A;  4H9N B;  1P34 A;  5B2J D;  1TAF A;  3WKJ C;  5GT3 C;  1F66 A;  3MGP B;  3W96 B;  2W8S A;  4R8P C;  2DF4 C;  3WTP D;  2ARO B;  4XZQ B;  5DNM A;  4WZS B;  1U35 C;  4ZBJ B;  5GT3 B;  4Z66 C;  3AV1 D;  1M1A C;  2RVQ C;  3AZE A;  1P3K A;  3REL D;  1P3B B;  4E45 A;  5AVB C;  3LJA C;  3VH6 W;  3REI B;  4LD9 D;  5F99 D;  5BO0 B;  2CV5 A;  3REI C;  5B24 D;  5E5A B;  3B6F C;  4YS3 A;  5AV9 A;  2G5H C;  5AVC C;  5GSU C;  5BS7 C;  3AZJ D;  1ZLA B;  4H9R B;  3FDD A;  2UWX A;  5AV9 C;  3WTP B;  2F8N D;  3REH B;  5CP6 B;  3AZI C;  3B6F A;  3AZL B;  5B0Y B;  3NQU B;  1M18 C;  3WA9 B;  3AZK A;  2CWE A;  4H9P B;  3LJA A;  4Z5T B;  1P3O D;  5F99 B;  3X1U A;  3UTA D;  3REK A;  4UPK A;  1EQZ D;  5B40 B;  3AZM C;  2XD1 A;  4J8V A;  3REJ D;  3W98 C;  3MNN C;  5DNM C;  1HQ3 B;  1TZY A;  1B67 A;  1P3A D;  5AVC D;  3LEL D;  3AN2 D;  3MNN A;  1HQ3 C;  3W98 A;  1F66 C;  3AZM A;  3WKJ A;  3X1U C;  4G91 C;  3C1B A;  4YM6 C;  2ARO D;  3REL C;  3MGS B;  1N1J A;  3H0L C;  1P3O B;  1M18 A;  3AV1 C;  3R45 B;  5AV6 A;  3UTA B;  1EQZ B;  5DNN D;  1U35 D;  4Z66 D;  2DQN C;  4LD9 B;  3H0R C;  4ZUX B;  3B6G A;  5BS7 A;  5GSU A;  4R8P D;  5CPK B;  3C1C C;  3UTB A;  3X1V D;  1KX3 C;  3REI A;  2BYM B;  4J8U A;  4J8W A;  2NZD B;  1BH9 B;  5GT0 C;  5GT0 D;  2Y2K A;  5B32 A;  1P3K C;  1M1A A;  2HUE B;  4Z5T D;  3LZ1 C;  3WA9 C;  3NQU A;  3WA9 A;  5G49 B;  3VH5 T;  5GT3 A;  3A1K A;  3AZN D;  3W96 D;  5DNN C;  1P3A B;  4EO5 C;  3A6N D;  5JRG A;  5B32 C;  1ID3 D;  3EPK A;  3X1T A;  4X23 D;  1S32 D;  1P34 D;  5B2J A;  4H9Q B;  1F66 D;  3MNN B;  3UTB C;  5AY8 D;  1ZLA A;  1BFM A;  1B6W A;  4WNN B;  4Z66 B;  3WTP A;  5E5A D;  1P3L A;  3UT9 B;  3EPL A;  5B0Y A;  4KUD D;  3AZE D;  4NE5 A;  3AZF D;  4H9P A;  3MGP D;  4LD9 A;  5F99 A;  3REH D;  2ZY3 A;  3C1B C;  3W97 B;  5GSU B;  4XZQ D;  4WV4 B;  4YS3 D;  1HQ3 A;  1TZY B;  3AZJ A;  5AV8 B;  5B1L A;  5CP6 C;  3AZI B;  1KX4 B;  1TZY C;  2NZD A;  2F8N A;  5B24 C;  4J8V C;  5AVC B;  1W2E A;  1T3U A;  3AZH C;  3AZN B;  1N1J B;  3IP4 C;  3W99 C;  1P3O A;  1KX4 C;  3X1U D;  3UTA A;  1EQZ A;  2JCH A;  3AZK C;  4J8V D;  3REJ A;  2FJ7 B;  1KX5 D;  5FUG A;  1TZY D;  1P3A A;  3LEL A;  5B33 C;  3AN2 A;  5KDM A;  3MNN D;  3AFA C;  3UTB B;  2ZY2 A;  3W98 D;  3EG5 B;  4YS3 C;  4WU8 C;  3AZM D;  3WKJ D;  2CV5 C;  4WU8 B;  5AVB A;  4KUD B;  5B0Z A;  1M1A B;  3LZ0 B;  1M18 D;  5AV6 D;  1M19 C;  3AZE C;  3AZG A;  2NQB C;  4KGC D;  4Z66 A;  2G5I C;  4KHA A;  4R8P A;  1P3B C;  3UT9 C;  3X1V A;  3REI D;  4J8U D;  4J8W D;  1P3M C;  3AYW D;  4H9O B;  4ZUX C;  2L5A A;  3KUY A;  2RVQ D;  3A6N C;  3KXB B;  3LZ1 B;  5B1L B;  2ZY4 A;  4H9Q A;  2VQR A;  4KGC B;  2F8N B;  2HIO A;  3B0D C;  1BH8 B;  4XUJ B;  3KWQ C;  2PYO B;  4J8X B;  2Y2N A;  4JJN C;  3WA9 D;  3V9R A;  2PYO C;  1KX5 B;  5GT3 D;  4Z5T C;  3AZN A;  3W96 A;  2Y2O A;  1ULY A;  2Y2G A;  3NQJ B;  1ID3 A;  2F8N H;  1H3O B;  5CPI A;  5AV5 B;  3X1T D;  5DNM B;  1P3G B;  1R4V A;  1S32 A;  3AV2 C;  5FUG B;  5B40 C;  2Y2J A;  5AY8 A;  3AZJ B;  1ZLA D;  5BO0 A;  2CV5 B;  5B1M C;  5E5A A;  1P3L D;  4YS3 B;  5B0Y D;  2ZM5 A;  4WU9 A;  4KUD A;  3WAA D;  1M19 B;  3AZF A;  1P3P B;  3X1S D;  3MGP A;  3O62 C;  4JJN D;  3REH A;  3B6F B;  2ARO C;  3AYW B;  3O62 B;  3REJ B;  4XZQ A;  3A1I A;  1P3P C;  3B0B A;  1HQ3 D;  3X1V B;  1P3K B;  3X1U B;  5B1L D;  5B2I C;  1AOI D;  2NZD D;  3AYW C;  3AV1 B;  3WAA B;  4Z2M H;  1P3F C;  3LZ0 A;  5AV8 D;  4J8X C;  3AZG B;  3MVD B;  5B24 B;  4KGC C;  2NQB D;  1KX5 A;  3AZL A;  2BYK A;  3VH6 T;  1AOI B;  1ID3 B;  3MGQ C;  3TU4 C;  5CPI B;  5CHL B;  5B33 B;  3AFA D;  5AVB D;  5B0Z D;  5B2I D;  1AOI C;  1Z2C B;  2IO5 B;  3KXB A;  4G92 B;  3AZG D;  3X1S B;  4QLC A;  4KGC A;  1P3I C;  1P3I D;  2HIO B;  4XUJ A;  3AZM B;  2NQB B;  4J8X A;  3C1B B;  4WU9 B;  2J8P A;  4NE3 A;  3W99 D;  1P3F A;  4DQY B;  3MGS A;  3X1S C;  3AYW A;  4UUZ B;  1S32 B;  3KUY D;  4XZQ C;  1U35 B;  2HIO D;  4J8W B;  5B40 D;  5AV8 C;  2YFW A;  1BH9 A;  5BNX B;  4Z2M G;  2XD5 A;  5B32 B;  2HUE C;  5CPK C;  2F2A C;  5E5A C;  5BT1 D;  2FJ7 C;  5CPI D;  5GT0 B;  1WWI A;  3B0C T;  5B31 C;  1P3P D;  2F8N K;  5JRG B;  5B31 D;  3W97 A;  3O62 D;  1P3I B;  2YFV B;  1ID3 C;  5CPJ C;  4ZUX D;  5B1M B;  4H9S A;  5B2J B;  4H9S C;  4WU9 D;  3WAA A;  5CPK D;  3X1S A;  5CPJ A;  3MGS C;  3W97 C;  4JJN A;  4WJ3 C;  1KU5 A;  3MVD A;  3MGR C;  3VH5 W;  1F66 B;  1M19 D;  2JE5 A;  3KXB C;  1AOI A;  2FJ7 A;  3MGR B;  1P3M B;  3AZE B;  3X1V C;  3C1C D;  1KX3 D;  1WWS A;  5KDM B;  1P3B A;  3TU4 A;  4CAY B;  3LZ0 D;  5GXQ B;  5B33 D;  5AV8 A;  3A6N B;  3KWQ D;  2YFW B;  3AZL C;  3AZG C;  2NQB A;  3EPH A;  3AZL D;  1TAF B;  4NE6 A;  1P3F B;  2Y2L A;  1KX4 D;  3B0C W;  3AZH D;  5B31 B;  4KHA B;  3AFA A;  3UT9 D;  1A7W A;  3MGQ D;  5B2I A;  3KXB D;  4QLC D;  1JFI A;  1P3I A;  4XUJ D;  4QLC C;  2BG1 A;  3H0M C;  4J8X D;  3AL0 C;  1P3F D;  3REH C;  3W99 A;  4E44 A;  3MGS D;  5CPJ B;  5B0Z B;  5JA4 A;  3AV2 B;  3AZI D;  4WU8 D;  5CP6 A;  5B1L C;  3AZJ C;  2Y2P A;  4R8P B;  3C1C B;  3R45 A;  5AV6 B;  1KX3 B;  3P5J B;  1H3O A;  1HTA A;  5BNV A;  3MGR A;  5B40 A;  4LD9 C;  3MVD C;  1S32 C;  2YFV A;  3F6T A;  5AY8 B;  5B0Y C;  3REL B;  3WAA C;  1P3L C;  3AZH B;  4JJN B;  2PYO A;  4HGA B;  5B1M D;  1ZLA C;  3VH5 A;  2ZY5 A;  5C3I B;  3LZ1 D;  3AZF B;  1P3P A;  4CSR B;  3MGQ B;  4G92 C;  5B31 A;  3X1T C;  3O62 A;  3W97 D;  5G49 A;  3AFA B;  1Q9C A;  4ZUX A;  3AZF C;  3B6G B;  1P3M A;  4WU9 C;  5CPK A;  5DNN B;  5CPJ D;  1JFI B;  2Y2Q A;  5AV5 D;  2BYM A;  4J8U B;  3X1T B;  1P3G D;  3MVD D;  2Y2H A;  2FFF B;  5JA4 B;  5GXQ D;  1M19 A;  3AV2 A;  4WNN A;  5BT1 C;  2FJ7 D;  4J8W C;  4YM6 D;  2IO5 C;  2BYK B;  3W96 C;  3C1C A;  1KX3 A;  1F1E A;  1P3B D;  3TU4 D;  5B2I B;  5B33 A;  4ZBJ C;  3KWQ A;  4G91 B;  5DNM D;  4XUJ C;  3REJ C;  3AV1 A;  3WTP E;  1P3K D;  3W99 B;  3UTA C;  1EQZ C;  3REL A;  1KX4 A;  3AZH A;  4X23 B;  1P34 B;  4H9N A;  4EO5 B;  2CV5 D;  5B24 A;  1P3L B;  3UT9 A;  5B31 G;  5AV9 D;  3MGQ A;  2Y2M A;  4AWL C;  1KX5 C;  5BNV B;  3B6F D;  1PZR A;  3REK C;  4DRA A;  5B0Z C;  3AZK D;  3LEL B;  5F99 C;  3AN2 B;  3LZ0 C;  2F8N G;  3LJA D;  2LY8 A;  3EPJ A;  4AWL B;  2Y2I A;  3VH6 A;  3REK D;  3AZI A;  4QLC B;  4WU8 A;  5BNX A;  5CP6 D;  4YM6 B;  3LEL C;  3AN2 C;  1P3A C;  4M6B A;  5AVC A;  4CSR A;  3MGR D;  5B2J C;  3C1B D;  1P3O C;  2ARO A;  4UUZ A;  3LJA B;  3MGP C;  4NFT A;  5DNN A;  3KWQ B;  4KUD C;  1U35 A;  2NZD C;  2PYO D;  3B6G D;  5B1M A;  5GSU D;  3LZ1 A;  5AY8 C;  5AV9 B;  4DRB A;  5AVB B;  3UTB D;  1BH8 A;  5C3I C;  4H9R A;  4X23 C;  1P34 C;  3B0D B;  4HGA C;  3KFU G;  3V9R B;  5CPI C;  5GT0 A;  5GXQ C;  5B32 D;  1P3M D;  1M18 B;  3AZK B;  1M1A D;  4J8U C;  3NQJ A;  4Z5T A;  3WTP C;  3AZN C;  5AV5 A;  1P3G A;  5B32 G;  3REK B;  4J8V B;  5AV5 C;  1P3G C;  4H9O A;  3B6G C;  2HIO C;  3TU4 B;  3KSY A;  4CAY A; 
#chains in the Genus database with same CATH homology
 3KUY B;  5GXQ A;  3AV2 D;  5AV6 C;  3A6N A;  5JRG D;  3KUY C;  3W98 B;  5JRG C;  3WKJ B;  4X23 A;  4YM6 A;  2JSS A;  2RIQ A;  4H9N B;  1P34 A;  5B2J D;  1TAF A;  3WKJ C;  5GT3 C;  1F66 A;  3MGP B;  3W96 B;  2W8S A;  4R8P C;  2DF4 C;  3WTP D;  2ARO B;  4XZQ B;  5DNM A;  4WZS B;  1U35 C;  4ZBJ B;  5GT3 B;  4Z66 C;  3AV1 D;  1M1A C;  2RVQ C;  3AZE A;  1P3K A;  3REL D;  1P3B B;  4E45 A;  5AVB C;  3LJA C;  3VH6 W;  3REI B;  4LD9 D;  5F99 D;  5BO0 B;  2CV5 A;  3REI C;  5B24 D;  5E5A B;  3B6F C;  4YS3 A;  5AV9 A;  2G5H C;  5AVC C;  5GSU C;  5BS7 C;  3AZJ D;  1ZLA B;  4H9R B;  3FDD A;  2UWX A;  5AV9 C;  3WTP B;  2F8N D;  3REH B;  5CP6 B;  3AZI C;  3B6F A;  3AZL B;  5B0Y B;  3NQU B;  1M18 C;  3WA9 B;  3AZK A;  2CWE A;  4H9P B;  3LJA A;  4Z5T B;  1P3O D;  5F99 B;  3X1U A;  3UTA D;  3REK A;  4UPK A;  1EQZ D;  5B40 B;  3AZM C;  2XD1 A;  4J8V A;  3REJ D;  3W98 C;  3MNN C;  5DNM C;  1HQ3 B;  1TZY A;  1B67 A;  1P3A D;  5AVC D;  3LEL D;  3AN2 D;  3MNN A;  1HQ3 C;  3W98 A;  1F66 C;  3AZM A;  3WKJ A;  3X1U C;  4G91 C;  3C1B A;  4YM6 C;  2ARO D;  3REL C;  3MGS B;  1N1J A;  3H0L C;  1P3O B;  1M18 A;  3AV1 C;  3R45 B;  5AV6 A;  3UTA B;  1EQZ B;  5DNN D;  1U35 D;  4Z66 D;  2DQN C;  4LD9 B;  3H0R C;  4ZUX B;  3B6G A;  5BS7 A;  5GSU A;  4R8P D;  5CPK B;  3C1C C;  3UTB A;  3X1V D;  1KX3 C;  3REI A;  2BYM B;  4J8U A;  4J8W A;  2NZD B;  1BH9 B;  5GT0 C;  5GT0 D;  2Y2K A;  5B32 A;  1P3K C;  1M1A A;  2HUE B;  4Z5T D;  3LZ1 C;  3WA9 C;  3NQU A;  3WA9 A;  5G49 B;  3VH5 T;  5GT3 A;  3A1K A;  3AZN D;  3W96 D;  5DNN C;  1P3A B;  4EO5 C;  3A6N D;  5JRG A;  5B32 C;  1ID3 D;  3EPK A;  3X1T A;  4X23 D;  1S32 D;  1P34 D;  5B2J A;  4H9Q B;  1F66 D;  3MNN B;  3UTB C;  5AY8 D;  1ZLA A;  1BFM A;  1B6W A;  4WNN B;  4Z66 B;  3WTP A;  5E5A D;  1P3L A;  3UT9 B;  3EPL A;  5B0Y A;  4KUD D;  3AZE D;  4NE5 A;  3AZF D;  4H9P A;  3MGP D;  4LD9 A;  5F99 A;  3REH D;  2ZY3 A;  3C1B C;  3W97 B;  5GSU B;  4XZQ D;  4WV4 B;  4YS3 D;  1HQ3 A;  1TZY B;  3AZJ A;  5AV8 B;  5B1L A;  5CP6 C;  3AZI B;  1KX4 B;  1TZY C;  2NZD A;  2F8N A;  5B24 C;  4J8V C;  5AVC B;  1W2E A;  1T3U A;  3AZH C;  3AZN B;  1N1J B;  3IP4 C;  3W99 C;  1P3O A;  1KX4 C;  3X1U D;  3UTA A;  1EQZ A;  2JCH A;  3AZK C;  4J8V D;  3REJ A;  2FJ7 B;  1KX5 D;  5FUG A;  1TZY D;  1P3A A;  3LEL A;  5B33 C;  3AN2 A;  5KDM A;  3MNN D;  3AFA C;  3UTB B;  2ZY2 A;  3W98 D;  3EG5 B;  4YS3 C;  4WU8 C;  3AZM D;  3WKJ D;  2CV5 C;  4WU8 B;  5AVB A;  4KUD B;  5B0Z A;  1M1A B;  3LZ0 B;  1M18 D;  5AV6 D;  1M19 C;  3AZE C;  3AZG A;  2NQB C;  4KGC D;  4Z66 A;  2G5I C;  4KHA A;  4R8P A;  1P3B C;  3UT9 C;  3X1V A;  3REI D;  4J8U D;  4J8W D;  1P3M C;  3AYW D;  4H9O B;  4ZUX C;  2L5A A;  3KUY A;  2RVQ D;  3A6N C;  3KXB B;  3LZ1 B;  5B1L B;  2ZY4 A;  4H9Q A;  2VQR A;  4KGC B;  2F8N B;  2HIO A;  3B0D C;  1BH8 B;  4XUJ B;  3KWQ C;  2PYO B;  4J8X B;  2Y2N A;  4JJN C;  3WA9 D;  3V9R A;  2PYO C;  1KX5 B;  5GT3 D;  4Z5T C;  3AZN A;  3W96 A;  2Y2O A;  1ULY A;  2Y2G A;  3NQJ B;  1ID3 A;  2F8N H;  1H3O B;  5CPI A;  5AV5 B;  3X1T D;  5DNM B;  1P3G B;  1R4V A;  1S32 A;  3AV2 C;  5FUG B;  5B40 C;  2Y2J A;  5AY8 A;  3AZJ B;  1ZLA D;  5BO0 A;  2CV5 B;  5B1M C;  5E5A A;  1P3L D;  4YS3 B;  5B0Y D;  2ZM5 A;  4WU9 A;  4KUD A;  3WAA D;  1M19 B;  3AZF A;  1P3P B;  3X1S D;  3MGP A;  3O62 C;  4JJN D;  3REH A;  3B6F B;  2ARO C;  3AYW B;  3O62 B;  3REJ B;  4XZQ A;  3A1I A;  1P3P C;  3B0B A;  1HQ3 D;  3X1V B;  1P3K B;  3X1U B;  5B1L D;  5B2I C;  1AOI D;  2NZD D;  3AYW C;  3AV1 B;  3WAA B;  4Z2M H;  1P3F C;  3LZ0 A;  5AV8 D;  4J8X C;  3AZG B;  3MVD B;  5B24 B;  4KGC C;  2NQB D;  1KX5 A;  3AZL A;  2BYK A;  3VH6 T;  1AOI B;  1ID3 B;  3MGQ C;  3TU4 C;  5CPI B;  5CHL B;  5B33 B;  3AFA D;  5AVB D;  5B0Z D;  5B2I D;  1AOI C;  1Z2C B;  2IO5 B;  3KXB A;  4G92 B;  3AZG D;  3X1S B;  4QLC A;  4KGC A;  1P3I C;  1P3I D;  2HIO B;  4XUJ A;  3AZM B;  2NQB B;  4J8X A;  3C1B B;  4WU9 B;  2J8P A;  4NE3 A;  3W99 D;  1P3F A;  4DQY B;  3MGS A;  3X1S C;  3AYW A;  4UUZ B;  1S32 B;  3KUY D;  4XZQ C;  1U35 B;  2HIO D;  4J8W B;  5B40 D;  5AV8 C;  2YFW A;  1BH9 A;  5BNX B;  4Z2M G;  2XD5 A;  5B32 B;  2HUE C;  5CPK C;  2F2A C;  5E5A C;  5BT1 D;  2FJ7 C;  5CPI D;  5GT0 B;  1WWI A;  3B0C T;  5B31 C;  1P3P D;  2F8N K;  5JRG B;  5B31 D;  3W97 A;  3O62 D;  1P3I B;  2YFV B;  1ID3 C;  5CPJ C;  4ZUX D;  5B1M B;  4H9S A;  5B2J B;  4H9S C;  4WU9 D;  3WAA A;  5CPK D;  3X1S A;  5CPJ A;  3MGS C;  3W97 C;  4JJN A;  4WJ3 C;  1KU5 A;  3MVD A;  3MGR C;  3VH5 W;  1F66 B;  1M19 D;  2JE5 A;  3KXB C;  1AOI A;  2FJ7 A;  3MGR B;  1P3M B;  3AZE B;  3X1V C;  3C1C D;  1KX3 D;  1WWS A;  5KDM B;  1P3B A;  3TU4 A;  4CAY B;  3LZ0 D;  5GXQ B;  5B33 D;  5AV8 A;  3A6N B;  3KWQ D;  2YFW B;  3AZL C;  3AZG C;  2NQB A;  3EPH A;  3AZL D;  1TAF B;  4NE6 A;  1P3F B;  2Y2L A;  1KX4 D;  3B0C W;  3AZH D;  5B31 B;  4KHA B;  3AFA A;  3UT9 D;  1A7W A;  3MGQ D;  5B2I A;  3KXB D;  4QLC D;  1JFI A;  1P3I A;  4XUJ D;  4QLC C;  2BG1 A;  3H0M C;  4J8X D;  3AL0 C;  1P3F D;  3REH C;  3W99 A;  4E44 A;  3MGS D;  5CPJ B;  5B0Z B;  5JA4 A;  3AV2 B;  3AZI D;  4WU8 D;  5CP6 A;  5B1L C;  3AZJ C;  2Y2P A;  4R8P B;  3C1C B;  3R45 A;  5AV6 B;  1KX3 B;  3P5J B;  1H3O A;  1HTA A;  5BNV A;  3MGR A;  5B40 A;  4LD9 C;  3MVD C;  1S32 C;  2YFV A;  3F6T A;  5AY8 B;  5B0Y C;  3REL B;  3WAA C;  1P3L C;  3AZH B;  4JJN B;  2PYO A;  4HGA B;  5B1M D;  1ZLA C;  3VH5 A;  2ZY5 A;  5C3I B;  3LZ1 D;  3AZF B;  1P3P A;  4CSR B;  3MGQ B;  4G92 C;  5B31 A;  3X1T C;  3O62 A;  3W97 D;  5G49 A;  3AFA B;  1Q9C A;  4ZUX A;  3AZF C;  3B6G B;  1P3M A;  4WU9 C;  5CPK A;  5DNN B;  5CPJ D;  1JFI B;  2Y2Q A;  5AV5 D;  2BYM A;  4J8U B;  3X1T B;  1P3G D;  3MVD D;  2Y2H A;  2FFF B;  5JA4 B;  5GXQ D;  1M19 A;  3AV2 A;  4WNN A;  5BT1 C;  2FJ7 D;  4J8W C;  4YM6 D;  2IO5 C;  2BYK B;  3W96 C;  3C1C A;  1KX3 A;  1F1E A;  1P3B D;  3TU4 D;  5B2I B;  5B33 A;  4ZBJ C;  3KWQ A;  4G91 B;  5DNM D;  4XUJ C;  3REJ C;  3AV1 A;  3WTP E;  1P3K D;  3W99 B;  3UTA C;  1EQZ C;  3REL A;  1KX4 A;  3AZH A;  4X23 B;  1P34 B;  4H9N A;  4EO5 B;  2CV5 D;  5B24 A;  1P3L B;  3UT9 A;  5B31 G;  5AV9 D;  3MGQ A;  2Y2M A;  4AWL C;  1KX5 C;  5BNV B;  3B6F D;  1PZR A;  3REK C;  4DRA A;  5B0Z C;  3AZK D;  3LEL B;  5F99 C;  3AN2 B;  3LZ0 C;  2F8N G;  3LJA D;  2LY8 A;  3EPJ A;  4AWL B;  2Y2I A;  3VH6 A;  3REK D;  3AZI A;  4QLC B;  4WU8 A;  5BNX A;  5CP6 D;  4YM6 B;  3LEL C;  3AN2 C;  1P3A C;  4M6B A;  5AVC A;  4CSR A;  3MGR D;  5B2J C;  3C1B D;  1P3O C;  2ARO A;  4UUZ A;  3LJA B;  3MGP C;  4NFT A;  5DNN A;  3KWQ B;  4KUD C;  1U35 A;  2NZD C;  2PYO D;  3B6G D;  5B1M A;  5GSU D;  3LZ1 A;  5AY8 C;  5AV9 B;  4DRB A;  5AVB B;  3UTB D;  1BH8 A;  5C3I C;  4H9R A;  4X23 C;  1P34 C;  3B0D B;  4HGA C;  3KFU G;  3V9R B;  5CPI C;  5GT0 A;  5GXQ C;  5B32 D;  1P3M D;  1M18 B;  3AZK B;  1M1A D;  4J8U C;  3NQJ A;  4Z5T A;  3WTP C;  3AZN C;  5AV5 A;  1P3G A;  5B32 G;  3REK B;  4J8V B;  5AV5 C;  1P3G C;  4H9O A;  3B6G C;  2HIO C;  3TU4 B;  3KSY A;  4CAY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...