5CPIA

Nucleosome containing unmethylated sat2r dna
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Influence of DNA methylation on positioning and DNA flexibility of nucleosomes with pericentric satellite DNA.
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5cpiA00
3REIA 2BYMA 3MNNA 2YFVB 3W96B 4WU9A 3AZLC 3WAAD 3REHD 2F8NG 3REID 3MNND 4WU9D 3UTBB 4X23C 4H9RB 3B6FA 3REKB 1P3IA 1P34C 3WTPA 3WA9B 3KUYB 3C1BB 4J8XA 3B6FD 4EO5B 1N1JA 1P3AC 1P3ID 3B0CT 3O62A 3WTPD 1U35A 3AZIB 5B40C 3AZMB 1BH9A 4CSRB 4J8XD 1AOIA 1ID3C 3O62D 3RELC 5E5AB 1U35D 4Z5TB 3UTAB 2PYOC 3C1CC 5AVCB 5DNNA 1AOID 2YFWB 5CP6C 3X1TC 1P3PC 3B6GC 5DNND 3REIB 2CV5A 5GSUA 1HQ3C 5JRGC 4R8PA 4KHAB 4NFTA 3X1SC 4DRBA 5CPJC 5AY8A 5B31C 5CHLB 1KX4A 4YM6A 1M18C 2CV5D 5GSUD 4R8PD 5B0ZB 5AVBC 2NZDC 5AY8D 3B6FB 3AZNB 4H9PA 1P3IB 1KX4D 4YM6D 3WTPB 3LZ0B 5BO0A 1TZYC 4J8XB 5GXQB 1N1JB 1P3OC 1ZLAC 4ZUXB 3UT9C 1BH9B 1P3MC 1A7WA 4WNNA 4Z66D 3X1UA 4XZQB 1AOIB 5F99B 5B31G 5BT1D 4H9SC 3X1UD 3MGRA 3W99A 5AV6A 2IO5B 3REJC 2AROD 5B2JC 3MGRD 4XUJC 3W99D 5GSUB 4J8VA 3VH6A 4KUDA 5CPKC 3TU4B 4J8WC 5AY8B 1HTAA 3B0BA 4J8VD 1F66A 4KUDD 1S32C 3AZGC 3AN2B 5B33B 3W97C 1F66D 5BO0B 3REKC 3AZHC 4Z66B 3AV1A 3KUYC 3KWQA 1M1AB 3W98C 4WNNB 3B0DC 3AV1D 1P3FA 2YFVA 3VH6W 3W96A 3KWQD 1P3KA 3AV2B 3AZJB 4AWLC 5B1MC 3MGSC 1P3FD 4Z5TC 2AROB 5C3IC 3MGRB 3UTBA 1P3KD 3W96D 3W99B 3VH5A 4H9RA 4Z2MH 2JSSA 3AZKB 3WA9A 3UTBD 3C1BA 3WAAC 3AZEA 3MGQC 3REHC 3REIC 3MNNC 3REHA 4WU9C 5B32A 3AZIA 3WA9D 3AZMA 3AZED 1F66B 5AV5D 4G92B 5E5AA 5B32D 3AZID 3UTAA 3AZMD 5AVCA 3B6FC 1P3IC 2YFWA 2HIOB 3VH5W 3WTPC 3AV1B 3UTAD 3KWQB 4J8XC 5AVCD 3MVDA 3O62C 3AFAB 5AV9D 1U35C 1P3FB 4KHAA 1P3KB 4Z2MG 5B2IB 3MVDD 3LELA 1AOIC 5B1LA 5B0ZA 1TAFA 5DNNC 3AZNA 3LELD 4NE6A 3LZ0A 5B1LD 5B0ZD 2IO5C 4H9QB 3AZEB 5GXQA 3AZND 5BS7A 5AV5B 1P3GB 2CV5C 5GSUC 4ZUXA 4R8PC 3LZ0D 5B32B 1P3BB 5AY8C 5GXQD 1KX4C 4XZQA 4YM6C 4G91C 5F99A 4ZUXD 3X1VB 4CAYB 2HUEC 4XZQD 5F99D 5AV9B 1KX3B 3KXBA 1R4VA 3MVDB 5AV8B 4YS3A 5BT1C 3KXBD 3TU4A 3X1UC 4WU8B 4KGCA 3LELB 4YS3D 4ZBJB 5B1LB 1TAFB 3TU4D 2L5AA 3LZ1A 4KGCD 5B0YB 3AN2A 4UUZB 3W99C 5B33A 4QLCB 5AV6C 3AZLD 1P3LB 4Z66A 3KSYA 3LZ1D 3AN2D 5B33D 4J8VC 4J8UC 4KUDC 1M1AA 3AYWB 1JFIB 4H9NB 3AV2A 4LD9B 3AZJA 5GT3B 1F66C 2F8NB 1M1AD 2RVQC 2AROA 3AV2D 1EQZB 3AZJD 5KDMB 3KXBB 4HGAC 3AV1C 1ID3D 4NE3A 3AZKA 3KWQC 5GT0A 4YS3B 1P3FC 4KGCB 3W96C 3AZKD 5BNVB 5GT0D 5CPIA 3X1TD 1P3KC 3AZLB 5B24A 3LZ1B 3UTBC 5CPID 4X23B 3WTPE 5B24D 2HIOA 3WA9C 3C1BC 3AZEC 4EO5C 1B67A 3AFAA 1P3AB 2HIOD 5B32C 3AZIC 3AZMC 5B40B 5B2IA 4E45A 3AFAD 1ID3B 4H9OA 5E5AC 3UTAC 2PYOB 5AVCC 4DRAA 5B2ID 5CP6B 5GT0B 3X1TB 4H9QA 3MVDC 4JJNA 2NQBA 1P3GA 5AV5A 5JRGB 1HQ3B 5CPIB 3AZFA 5B32G 1P3BA 3MGPA 5CPJB 4JJND 3LELC 2NQBD 5B24B 1P3GD 5B31B 4XUJD 1M18B 5B1LC 5B0ZC 3X1VA 1F1EA 3AZFD 1P3BD 3MGPD 5AVBB 4CAYA 3AZNC 4J8WD 2FJ7A 3WKJA 2NZDB 3LZ0C 5AV9A 3X1VD 1KX3A 2FJ7D 5GXQC 3WKJD 5BS7C 5AV8A 2F8NH 1P3OB 3R45B 4ZUXC 1KX3D 3NQUB 4WU8A 1P3MB 4XZQC 5AV8D 5F99C 4H9OB 1WWIA 2CWEA 4WU8D 5BNXB 5B0YA 4UUZA 4QLCA 5DNMA 3KXBC 1P3LA 5B1MD 5G49A 4JJNB 3REJB 2NQBB 5B0YD 4YS3C 4QLCD 1H3OA 5DNMD 4XUJB 3AZFB 3TU4C 1P3LD 3MGPB 5CPKB 4KGCC 4J8WB 3AYWA 1JFIA 4H9NA 4LD9A 5GT3A 2F8NA 3MGQD 3LZ1C 3LJAA 1S32B 3AZGB 2FJ7B 3AYWD 3AN2C 3A6NA 3WKJB 5B33C 1EQZA 4LD9D 3W97B 5GT3D 5KDMA 2F8ND 4Z66C 3LJAD 3AZHB 3A6ND 5FUGB 1EQZD 1M19A 1M1AC 1KX5A 3NQJB 3W98B 3B0DB 5BNVA 3AV2C 3AZJC 3AZLA 1M19D 1KX5D 2BYKA 4AWLB 5B1MB 3MGSB 2AROC 3MGRC 5C3IB 5DNMB 4X23A 5G49B 3B0CW 3V9RB 5JA4A 3AZKC 1P34A 1KX5C 5GT0C 1H3OB 4X23D 3WAAB 3MGQB 3REHB 1P3AA 2BYMB 1P34D 3MNNB 5CPIC 4WU9B 5B40A 5B24C 3LJAB 1P3AD 4G92C 1ID3A 3RELA 3A6NB 4NE5A 5B40D 2PYOA 3C1CA 4E44A 2HIOC 3RELD 5CP6A 3X1TA 2PYOD 1P3PA 3C1CD 1M19B 1KX5B 3B6GA 3AFAC 3O62B 1U35B 5JRGA 1HQ3A 5CP6D 3X1SA 1P3PD 5B2IC 5CPJA 3B6GD 2BYKB 5B31A 1M18A 5JRGD 1HQ3D 3VH6T 3X1SD 1WWSA 5CPJD 5AVBA 2NZDA 5DNNB 5B31D 5JA4B 1P34B 1M18D 1BFMA 2F8NK 4JJNC 5AVBD 2NQBC 1TZYA 2NZDD 1P3GC 5AV5C 1P3OA 3R45A 2CV5B 5AV6D 1ZLAA 4J8UA 4R8PB 3AZFC 1P3BC 3NQUA 1BH8A 4WV4B 3MGPC 3UT9A 1TZYD 1P3MA 1P3OD 1KX4B 4YM6B 1ULYA 4G91B 3X1VC 3RELB 4J8UD 1ZLAD 1Q9CA 4H9SA 3C1CB 3UT9D 2FJ7C 3WKJC 1P3MD 5BNXA 2HUEB 4H9PB 5AV9C 1KX3C 1P3PB 3REJA 5AV8C 3B6GB 2RVQD 5B2JA 4XUJA 3VH5T 3X1SB 4WU8C 5CPKA 3REJD 3X1UB 4J8WA 5B2JD 4ZBJC 5CPKD 1S32A 5B0YC 3AZGA 4QLCC 5DNMC 3W97A 5AV6B 1P3LC 3REKA 4WZSB 3AZHA 3AZGD 1TZYB 1S32D 1KU5A 3KUYA 5FUGA 3W97D 4J8VB 1ZLAB 4J8UB 4M6BA 1BH8B 3REKD 3NQJA 4KUDB 3UT9B 2LY8A 3AYWC 3AZHD 3W98A 3KUYD 4LD9C 4CSRA 5GT3C 3C1BD 1B6WA 3LJAC 5B1MA 3A6NC 3MGSA 3W98D 4Z5TA 1EQZC 3V9RA 4HGAB 3MGSD 5E5AD 4Z5TD 5B2JB 1M19C 3WAAA 3MGQA
chains in the Genus database with same CATH superfamily
3REIA 2BYMA 3MNNA 2YFVB 3W96B 4WU9A 3AZLC 3WAAD 3REHD 2F8NG 3REID 3MNND 3AL0C 4WU9D 3UTBB 4X23C 4H9RB 3B6FA 3REKB 1P3IA 1P34C 3WTPA 3WA9B 3KUYB 3IP4C 3C1BB 4J8XA 3B6FD 4EO5B 1N1JA 1P3AC 1P3ID 3B0CT 3O62A 3WTPD 1U35A 3AZIB 5B40C 2Y2MA 3AZMB 1BH9A 4CSRB 4J8XD 3FDDA 1ID3C 1AOIA 3O62D 3RELC 2BG1A 2XD1A 5E5AB 1U35D 4Z5TB 3UTAB 2PYOC 3C1CC 1PZRA 5AVCB 5DNNA 1AOID 2YFWB 5CP6C 3X1TC 1P3PC 3B6GC 2UWXA 5DNND 3REIB 2CV5A 5GSUA 1HQ3C 5JRGC 4R8PA 4KHAB 4NFTA 3X1SC 4DRBA 5CPJC 5AY8A 5B31C 5CHLB 1KX4A 4YM6A 1M18C 2CV5D 5GSUD 2Y2IA 5B0ZB 4R8PD 5AVBC 2NZDC 5AY8D 3B6FB 3AZNB 4H9PA 1P3IB 1KX4D 4YM6D 3WTPB 3LZ0B 5BO0A 1TZYC 4J8XB 5GXQB 1N1JB 1P3OC 1ZLAC 4ZUXB 3UT9C 1BH9B 1P3MC 1A7WA 4WNNA 4Z66D 3X1UA 4XZQB 1AOIB 5F99B 5B31G 5BT1D 4H9SC 3X1UD 3H0LC 3MGRA 3W99A 2Y2LA 5AV6A 2IO5B 3REJC 2AROD 5B2JC 3MGRD 4XUJC 3W99D 5GSUB 4J8VA 3VH6A 4KUDA 5CPKC 3TU4B 4J8WC 5AY8B 1HTAA 3B0BA 4J8VD 1F66A 4KUDD 1S32C 3AZGC 3AN2B 5B33B 3W97C 3EPHA 1F66D 4UPKA 5BO0B 3REKC 3AZHC 4Z66B 3AV1A 3KUYC 3KWQA 1M1AB 3W98C 4WNNB 3B0DC 3AV1D 1P3FA 2YFVA 3VH6W 3W96A 3KWQD 1P3KA 3AV2B 3AZJB 4AWLC 5B1MC 3MGSC 1P3FD 4Z5TC 2AROB 5C3IC 3MGRB 3UTBA 1P3KD 3W96D 3W99B 3VH5A 4H9RA 4Z2MH 2JSSA 3AZKB 3WA9A 3UTBD 2ZY2A 3C1BA 3WAAC 3AZEA 3MGQC 3REHC 3REIC 3MNNC 3REHA 4WU9C 5B32A 3AZIA 3WA9D 3AZMA 3AZED 1F66B 5AV5D 2ZY5A 4G92B 5E5AA 5B32D 3AZID 3UTAA 3AZMD 5AVCA 3B6FC 1P3IC 2JE5A 2Y2OA 2YFWA 2HIOB 3A1KA 3VH5W 3WTPC 3AV1B 3UTAD 3KWQB 4J8XC 5AVCD 3MVDA 3O62C 3AFAB 5AV9D 1U35C 1P3FB 4KHAA 1P3KB 4Z2MG 5B2IB 3MVDD 3LELA 1AOIC 5B1LA 5B0ZA 1TAFA 5DNNC 3AZNA 3LELD 4NE6A 3LZ0A 5B1LD 5B0ZD 2IO5C 4H9QB 3AZEB 5GXQA 3AZND 5BS7A 5AV5B 1P3GB 2CV5C 5GSUC 4ZUXA 4R8PC 3LZ0D 5B32B 1P3BB 5AY8C 2RIQA 5GXQD 1KX4C 4XZQA 4YM6C 4G91C 5F99A 4ZUXD 3X1VB 2XD5A 4CAYB 2HUEC 2JCHA 4XZQD 5F99D 5AV9B 2ZM5A 2W8SA 1KX3B 3KXBA 1R4VA 3MVDB 5AV8B 4YS3A 5BT1C 3KXBD 3TU4A 3X1UC 4WU8B 4KGCA 3LELB 4YS3D 4ZBJB 2DQNC 5B1LB 1TAFB 3TU4D 2L5AA 3LZ1A 4KGCD 5B0YB 3AN2A 4UUZB 3W99C 5B33A 4QLCB 5AV6C 3AZLD 1P3LB 4Z66A 3KSYA 3LZ1D 3AN2D 5B33D 4J8VC 4J8UC 4KUDC 1M1AA 3AYWB 1JFIB 4H9NB 3AV2A 4LD9B 2FFFB 5GT3B 3AZJA 1F66C 2F8NB 3EG5B 1M1AD 2RVQC 2AROA 2Y2GA 3AV2D 1EQZB 3AZJD 5KDMB 3F6TA 3KXBB 4HGAC 3AV1C 1ID3D 4NE3A 3AZKA 3KWQC 5GT0A 4YS3B 1P3FC 4KGCB 3W96C 3AZKD 2Y2NA 5BNVB 5GT0D 3X1TD 5CPIA 1P3KC 3AZLB 5B24A 3LZ1B 3UTBC 5CPID 4X23B 3WTPE 5B24D 2HIOA 3WA9C 3C1BC 2Y2HA 3AZEC 4EO5C 1B67A 3AFAA 1P3AB 2HIOD 5B32C 3AZIC 3AZMC 5B40B 5B2IA 4E45A 3AFAD 1ID3B 4H9OA 5E5AC 3UTAC 2PYOB 5AVCC 4DRAA 5B2ID 2Y2PA 2Y2KA 5CP6B 5GT0B 3X1TB 4H9QA 3MVDC 4JJNA 2NQBA 1P3GA 5AV5A 5JRGB 1HQ3B 5CPIB 3AZFA 5B32G 1P3BA 3MGPA 5CPJB 4JJND 3LELC 2NQBD 5B24B 1P3GD 5B31B 4XUJD 1M18B 5B1LC 5B0ZC 3X1VA 1F1EA 3AZFD 1P3BD 3MGPD 5AVBB 4CAYA 3AZNC 4J8WD 2FJ7A 3WKJA 2NZDB 2F2AC 3LZ0C 5AV9A 3X1VD 1KX3A 2FJ7D 5GXQC 3WKJD 1Z2CB 5BS7C 5AV8A 1P3OB 2F8NH 3R45B 4ZUXC 1KX3D 3NQUB 4WU8A 1P3MB 4XZQC 5AV8D 5F99C 3H0RC 4H9OB 1WWIA 2CWEA 4WU8D 5BNXB 5B0YA 4UUZA 4QLCA 5DNMA 3KXBC 1P3LA 5B1MD 5G49A 4JJNB 2Y2QA 3REJB 5B0YD 2NQBB 4YS3C 4QLCD 1H3OA 5DNMD 4XUJB 3AZFB 3TU4C 1P3LD 3MGPB 5CPKB 4KGCC 4J8WB 3AYWA 1JFIA 4H9NA 4LD9A 5GT3A 2F8NA 3MGQD 3LZ1C 3LJAA 1S32B 3AZGB 2FJ7B 3AYWD 3AN2C 3A6NA 3WKJB 5B33C 1EQZA 4LD9D 3W97B 5GT3D 5KDMA 2F8ND 4Z66C 3LJAD 3AZHB 3A6ND 5FUGB 1EQZD 1M19A 1M1AC 1KX5A 3NQJB 2ZY4A 3W98B 3B0DB 3P5JB 5BNVA 3AV2C 3AZJC 3AZLA 1M19D 1KX5D 2BYKA 4AWLB 5B1MB 3MGSB 2AROC 3MGRC 5C3IB 5DNMB 4X23A 5G49B 3B0CW 3V9RB 5JA4A 3AZKC 1P34A 1KX5C 2DF4C 5GT0C 2Y2JA 1H3OB 4X23D 3WAAB 3MGQB 3REHB 1P3AA 2BYMB 1P34D 3MNNB 2J8PA 5CPIC 4WU9B 5B40A 2ZY3A 5B24C 3LJAB 1P3AD 4G92C 1ID3A 3RELA 3A6NB 4NE5A 5B40D 2PYOA 2G5IC 3C1CA 4E44A 2HIOC 3RELD 3EPJA 4WJ3C 5CP6A 3X1TA 2PYOD 1P3PA 3C1CD 1M19B 1KX5B 3B6GA 3AFAC 3O62B 1U35B 5JRGA 1HQ3A 5CP6D 3X1SA 1P3PD 5B2IC 5CPJA 1T3UA 3B6GD 2BYKB 5B31A 1M18A 5JRGD 1HQ3D 3VH6T 1W2EA 3X1SD 1WWSA 5CPJD 5AVBA 2NZDA 5DNNB 2G5HC 5B31D 5JA4B 1P34B 1M18D 1BFMA 2F8NK 4JJNC 5AVBD 2NQBC 1TZYA 2NZDD 1P3GC 5AV5C 1P3OA 3R45A 2CV5B 5AV6D 1ZLAA 4J8UA 4R8PB 3AZFC 1P3BC 3NQUA 1BH8A 4WV4B 3MGPC 3UT9A 1TZYD 1P3MA 1P3OD 1KX4B 4YM6B 1ULYA 4G91B 3X1VC 3RELB 4J8UD 1ZLAD 1Q9CA 4H9SA 3C1CB 3UT9D 2FJ7C 3WKJC 1P3MD 5BNXA 2HUEB 4H9PB 5AV9C 1KX3C 1P3PB 3REJA 5AV8C 3B6GB 2RVQD 5B2JA 4XUJA 3VH5T 3X1SB 4WU8C 5CPKA 3EPLA 4DQYB 3REJD 3X1UB 4J8WA 2VQRA 5B2JD 4ZBJC 3KFUG 5CPKD 1S32A 5B0YC 3AZGA 4QLCC 5DNMC 3A1IA 3W97A 5AV6B 1P3LC 3REKA 4WZSB 3AZHA 3AZGD 1TZYB 1S32D 1KU5A 3KUYA 5FUGA 3H0MC 4J8VB 3W97D 1ZLAB 4J8UB 4M6BA 1BH8B 3REKD 3NQJA 4KUDB 3UT9B 2LY8A 3AYWC 3AZHD 3W98A 3KUYD 4LD9C 4CSRA 5GT3C 3C1BD 1B6WA 3LJAC 5B1MA 3A6NC 3MGSA 3W98D 4Z5TA 1EQZC 3EPKA 3V9RA 4HGAB 3MGSD 5E5AD 4Z5TD 5B2JB 1M19C 3WAAA 3MGQA
chains in the Genus database with same CATH topology
3REIA 2BYMA 3MNNA 2YFVB 3W96B 4WU9A 3AZLC 3WAAD 3REHD 2F8NG 3REID 3MNND 3AL0C 4WU9D 3UTBB 4X23C 4H9RB 3B6FA 3REKB 1P3IA 1P34C 3WTPA 3WA9B 3KUYB 3IP4C 3C1BB 4J8XA 3B6FD 4EO5B 1N1JA 1P3AC 1P3ID 3B0CT 3O62A 3WTPD 1U35A 3AZIB 5B40C 2Y2MA 3AZMB 1BH9A 4CSRB 4J8XD 3FDDA 1ID3C 1AOIA 3O62D 3RELC 2BG1A 2XD1A 5E5AB 1U35D 4Z5TB 3UTAB 2PYOC 3C1CC 1PZRA 5AVCB 5DNNA 1AOID 2YFWB 5CP6C 3X1TC 1P3PC 3B6GC 2UWXA 5DNND 3REIB 2CV5A 5GSUA 1HQ3C 5JRGC 4R8PA 4KHAB 4NFTA 3X1SC 4DRBA 5CPJC 5AY8A 5B31C 5CHLB 1KX4A 4YM6A 1M18C 2CV5D 5GSUD 2Y2IA 5B0ZB 4R8PD 5AVBC 2NZDC 5AY8D 3B6FB 3AZNB 4H9PA 1P3IB 1KX4D 4YM6D 3WTPB 3LZ0B 5BO0A 1TZYC 4J8XB 5GXQB 1N1JB 1P3OC 1ZLAC 4ZUXB 3UT9C 1BH9B 1P3MC 1A7WA 4WNNA 4Z66D 3X1UA 4XZQB 1AOIB 5F99B 5B31G 5BT1D 4H9SC 3X1UD 3H0LC 3MGRA 3W99A 2Y2LA 5AV6A 2IO5B 3REJC 2AROD 5B2JC 3MGRD 4XUJC 3W99D 5GSUB 4J8VA 3VH6A 4KUDA 5CPKC 3TU4B 4J8WC 5AY8B 1HTAA 3B0BA 4J8VD 1F66A 4KUDD 1S32C 3AZGC 3AN2B 5B33B 3W97C 3EPHA 1F66D 4UPKA 5BO0B 3REKC 3AZHC 4Z66B 3AV1A 3KUYC 3KWQA 1M1AB 3W98C 4WNNB 3B0DC 3AV1D 1P3FA 2YFVA 3VH6W 3W96A 3KWQD 1P3KA 3AV2B 3AZJB 4AWLC 5B1MC 3MGSC 1P3FD 4Z5TC 2AROB 5C3IC 3MGRB 3UTBA 1P3KD 3W96D 3W99B 3VH5A 4H9RA 4Z2MH 2JSSA 3AZKB 3WA9A 3UTBD 2ZY2A 3C1BA 3WAAC 3AZEA 3MGQC 3REHC 3REIC 3MNNC 3REHA 4WU9C 5B32A 3AZIA 3WA9D 3AZMA 3AZED 1F66B 5AV5D 2ZY5A 4G92B 5E5AA 5B32D 3AZID 3UTAA 3AZMD 5AVCA 3B6FC 1P3IC 2JE5A 2Y2OA 2YFWA 2HIOB 3A1KA 3VH5W 3WTPC 3AV1B 3UTAD 3KWQB 4J8XC 5AVCD 3MVDA 3O62C 3AFAB 5AV9D 1U35C 1P3FB 4KHAA 1P3KB 4Z2MG 5B2IB 3MVDD 3LELA 1AOIC 5B1LA 5B0ZA 1TAFA 5DNNC 3AZNA 3LELD 4NE6A 3LZ0A 5B1LD 5B0ZD 2IO5C 4H9QB 3AZEB 5GXQA 3AZND 5BS7A 5AV5B 1P3GB 2CV5C 5GSUC 4ZUXA 4R8PC 3LZ0D 5B32B 1P3BB 5AY8C 2RIQA 5GXQD 1KX4C 4XZQA 4YM6C 4G91C 5F99A 4ZUXD 3X1VB 2XD5A 4CAYB 2HUEC 2JCHA 4XZQD 5F99D 5AV9B 2ZM5A 2W8SA 1KX3B 3KXBA 1R4VA 3MVDB 5AV8B 4YS3A 5BT1C 3KXBD 3TU4A 3X1UC 4WU8B 4KGCA 3LELB 4YS3D 4ZBJB 2DQNC 5B1LB 1TAFB 3TU4D 2L5AA 3LZ1A 4KGCD 5B0YB 3AN2A 4UUZB 3W99C 5B33A 4QLCB 5AV6C 3AZLD 1P3LB 4Z66A 3KSYA 3LZ1D 3AN2D 5B33D 4J8VC 4J8UC 4KUDC 1M1AA 3AYWB 1JFIB 4H9NB 3AV2A 4LD9B 2FFFB 5GT3B 3AZJA 1F66C 2F8NB 3EG5B 1M1AD 2RVQC 2AROA 2Y2GA 3AV2D 1EQZB 3AZJD 5KDMB 3F6TA 3KXBB 4HGAC 3AV1C 1ID3D 4NE3A 3AZKA 3KWQC 5GT0A 4YS3B 1P3FC 4KGCB 3W96C 3AZKD 2Y2NA 5BNVB 5GT0D 3X1TD 5CPIA 1P3KC 3AZLB 5B24A 3LZ1B 3UTBC 5CPID 4X23B 3WTPE 5B24D 2HIOA 3WA9C 3C1BC 2Y2HA 3AZEC 4EO5C 1B67A 3AFAA 1P3AB 2HIOD 5B32C 3AZIC 3AZMC 5B40B 5B2IA 4E45A 3AFAD 1ID3B 4H9OA 5E5AC 3UTAC 2PYOB 5AVCC 4DRAA 5B2ID 2Y2PA 2Y2KA 5CP6B 5GT0B 3X1TB 4H9QA 3MVDC 4JJNA 2NQBA 1P3GA 5AV5A 5JRGB 1HQ3B 5CPIB 3AZFA 5B32G 1P3BA 3MGPA 5CPJB 4JJND 3LELC 2NQBD 5B24B 1P3GD 5B31B 4XUJD 1M18B 5B1LC 5B0ZC 3X1VA 1F1EA 3AZFD 1P3BD 3MGPD 5AVBB 4CAYA 3AZNC 4J8WD 2FJ7A 3WKJA 2NZDB 2F2AC 3LZ0C 5AV9A 3X1VD 1KX3A 2FJ7D 5GXQC 3WKJD 1Z2CB 5BS7C 5AV8A 1P3OB 2F8NH 3R45B 4ZUXC 1KX3D 3NQUB 4WU8A 1P3MB 4XZQC 5AV8D 5F99C 3H0RC 4H9OB 1WWIA 2CWEA 4WU8D 5BNXB 5B0YA 4UUZA 4QLCA 5DNMA 3KXBC 1P3LA 5B1MD 5G49A 4JJNB 2Y2QA 3REJB 5B0YD 2NQBB 4YS3C 4QLCD 1H3OA 5DNMD 4XUJB 3AZFB 3TU4C 1P3LD 3MGPB 5CPKB 4KGCC 4J8WB 3AYWA 1JFIA 4H9NA 4LD9A 5GT3A 2F8NA 3MGQD 3LZ1C 3LJAA 1S32B 3AZGB 2FJ7B 3AYWD 3AN2C 3A6NA 3WKJB 5B33C 1EQZA 4LD9D 3W97B 5GT3D 5KDMA 2F8ND 4Z66C 3LJAD 3AZHB 3A6ND 5FUGB 1EQZD 1M19A 1M1AC 1KX5A 3NQJB 2ZY4A 3W98B 3B0DB 3P5JB 5BNVA 3AV2C 3AZJC 3AZLA 1M19D 1KX5D 2BYKA 4AWLB 5B1MB 3MGSB 2AROC 3MGRC 5C3IB 5DNMB 4X23A 5G49B 3B0CW 3V9RB 5JA4A 3AZKC 1P34A 1KX5C 2DF4C 5GT0C 2Y2JA 1H3OB 4X23D 3WAAB 3MGQB 3REHB 1P3AA 2BYMB 1P34D 3MNNB 2J8PA 5CPIC 4WU9B 5B40A 2ZY3A 5B24C 3LJAB 1P3AD 4G92C 1ID3A 3RELA 3A6NB 4NE5A 5B40D 2PYOA 2G5IC 3C1CA 4E44A 2HIOC 3RELD 3EPJA 4WJ3C 5CP6A 3X1TA 2PYOD 1P3PA 3C1CD 1M19B 1KX5B 3B6GA 3AFAC 3O62B 1U35B 5JRGA 1HQ3A 5CP6D 3X1SA 1P3PD 5B2IC 5CPJA 1T3UA 3B6GD 2BYKB 5B31A 1M18A 5JRGD 1HQ3D 3VH6T 1W2EA 3X1SD 1WWSA 5CPJD 5AVBA 2NZDA 5DNNB 2G5HC 5B31D 5JA4B 1P34B 1M18D 1BFMA 2F8NK 4JJNC 5AVBD 2NQBC 1TZYA 2NZDD 1P3GC 5AV5C 1P3OA 3R45A 2CV5B 5AV6D 1ZLAA 4J8UA 4R8PB 3AZFC 1P3BC 3NQUA 1BH8A 4WV4B 3MGPC 3UT9A 1TZYD 1P3MA 1P3OD 1KX4B 4YM6B 1ULYA 4G91B 3X1VC 3RELB 4J8UD 1ZLAD 1Q9CA 4H9SA 3C1CB 3UT9D 2FJ7C 3WKJC 1P3MD 5BNXA 2HUEB 4H9PB 5AV9C 1KX3C 1P3PB 3REJA 5AV8C 3B6GB 2RVQD 5B2JA 4XUJA 3VH5T 3X1SB 4WU8C 5CPKA 3EPLA 4DQYB 3REJD 3X1UB 4J8WA 2VQRA 5B2JD 4ZBJC 3KFUG 5CPKD 1S32A 5B0YC 3AZGA 4QLCC 5DNMC 3A1IA 3W97A 5AV6B 1P3LC 3REKA 4WZSB 3AZHA 3AZGD 1TZYB 1S32D 1KU5A 3KUYA 5FUGA 3H0MC 4J8VB 3W97D 1ZLAB 4J8UB 4M6BA 1BH8B 3REKD 3NQJA 4KUDB 3UT9B 2LY8A 3AYWC 3AZHD 3W98A 3KUYD 4LD9C 4CSRA 5GT3C 3C1BD 1B6WA 3LJAC 5B1MA 3A6NC 3MGSA 3W98D 4Z5TA 1EQZC 3EPKA 3V9RA 4HGAB 3MGSD 5E5AD 4Z5TD 5B2JB 1M19C 3WAAA 3MGQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3REI A;  2BYM A;  3MNN A;  2YFV B;  3W96 B;  4WU9 A;  3AZL C;  3WAA D;  3REH D;  2F8N G;  3REI D;  3MNN D;  4WU9 D;  3UTB B;  4X23 C;  4H9R B;  3B6F A;  3REK B;  1P3I A;  1P34 C;  3WTP A;  3WA9 B;  3KUY B;  3C1B B;  4J8X A;  3B6F D;  4EO5 B;  1N1J A;  1P3A C;  1P3I D;  3B0C T;  3O62 A;  3WTP D;  1U35 A;  3AZI B;  5B40 C;  3AZM B;  1BH9 A;  4CSR B;  4J8X D;  1AOI A;  1ID3 C;  3O62 D;  3REL C;  5E5A B;  1U35 D;  4Z5T B;  3UTA B;  2PYO C;  3C1C C;  5AVC B;  5DNN A;  1AOI D;  2YFW B;  5CP6 C;  3X1T C;  1P3P C;  3B6G C;  5DNN D;  3REI B;  2CV5 A;  5GSU A;  1HQ3 C;  5JRG C;  4R8P A;  4KHA B;  4NFT A;  3X1S C;  4DRB A;  5CPJ C;  5AY8 A;  5B31 C;  5CHL B;  1KX4 A;  4YM6 A;  1M18 C;  2CV5 D;  5GSU D;  4R8P D;  5B0Z B;  5AVB C;  2NZD C;  5AY8 D;  3B6F B;  3AZN B;  4H9P A;  1P3I B;  1KX4 D;  4YM6 D;  3WTP B;  3LZ0 B;  5BO0 A;  1TZY C;  4J8X B;  5GXQ B;  1N1J B;  1P3O C;  1ZLA C;  4ZUX B;  3UT9 C;  1BH9 B;  1P3M C;  1A7W A;  4WNN A;  4Z66 D;  3X1U A;  4XZQ B;  1AOI B;  5F99 B;  5B31 G;  5BT1 D;  4H9S C;  3X1U D;  3MGR A;  3W99 A;  5AV6 A;  2IO5 B;  3REJ C;  2ARO D;  5B2J C;  3MGR D;  4XUJ C;  3W99 D;  5GSU B;  4J8V A;  3VH6 A;  4KUD A;  5CPK C;  3TU4 B;  4J8W C;  5AY8 B;  1HTA A;  3B0B A;  4J8V D;  1F66 A;  4KUD D;  1S32 C;  3AZG C;  3AN2 B;  5B33 B;  3W97 C;  1F66 D;  5BO0 B;  3REK C;  3AZH C;  4Z66 B;  3AV1 A;  3KUY C;  3KWQ A;  1M1A B;  3W98 C;  4WNN B;  3B0D C;  3AV1 D;  1P3F A;  2YFV A;  3VH6 W;  3W96 A;  3KWQ D;  1P3K A;  3AV2 B;  3AZJ B;  4AWL C;  5B1M C;  3MGS C;  1P3F D;  4Z5T C;  2ARO B;  5C3I C;  3MGR B;  3UTB A;  1P3K D;  3W96 D;  3W99 B;  3VH5 A;  4H9R A;  4Z2M H;  2JSS A;  3AZK B;  3WA9 A;  3UTB D;  3C1B A;  3WAA C;  3AZE A;  3MGQ C;  3REH C;  3REI C;  3MNN C;  3REH A;  4WU9 C;  5B32 A;  3AZI A;  3WA9 D;  3AZM A;  3AZE D;  1F66 B;  5AV5 D;  4G92 B;  5E5A A;  5B32 D;  3AZI D;  3UTA A;  3AZM D;  5AVC A;  3B6F C;  1P3I C;  2YFW A;  2HIO B;  3VH5 W;  3WTP C;  3AV1 B;  3UTA D;  3KWQ B;  4J8X C;  5AVC D;  3MVD A;  3O62 C;  3AFA B;  5AV9 D;  1U35 C;  1P3F B;  4KHA A;  1P3K B;  4Z2M G;  5B2I B;  3MVD D;  3LEL A;  1AOI C;  5B1L A;  5B0Z A;  1TAF A;  5DNN C;  3AZN A;  3LEL D;  4NE6 A;  3LZ0 A;  5B1L D;  5B0Z D;  2IO5 C;  4H9Q B;  3AZE B;  5GXQ A;  3AZN D;  5BS7 A;  5AV5 B;  1P3G B;  2CV5 C;  5GSU C;  4ZUX A;  4R8P C;  3LZ0 D;  5B32 B;  1P3B B;  5AY8 C;  5GXQ D;  1KX4 C;  4XZQ A;  4YM6 C;  4G91 C;  5F99 A;  4ZUX D;  3X1V B;  4CAY B;  2HUE C;  4XZQ D;  5F99 D;  5AV9 B;  1KX3 B;  3KXB A;  1R4V A;  3MVD B;  5AV8 B;  4YS3 A;  5BT1 C;  3KXB D;  3TU4 A;  3X1U C;  4WU8 B;  4KGC A;  3LEL B;  4YS3 D;  4ZBJ B;  5B1L B;  1TAF B;  3TU4 D;  2L5A A;  3LZ1 A;  4KGC D;  5B0Y B;  3AN2 A;  4UUZ B;  3W99 C;  5B33 A;  4QLC B;  5AV6 C;  3AZL D;  1P3L B;  4Z66 A;  3KSY A;  3LZ1 D;  3AN2 D;  5B33 D;  4J8V C;  4J8U C;  4KUD C;  1M1A A;  3AYW B;  1JFI B;  4H9N B;  3AV2 A;  4LD9 B;  3AZJ A;  5GT3 B;  1F66 C;  2F8N B;  1M1A D;  2RVQ C;  2ARO A;  3AV2 D;  1EQZ B;  3AZJ D;  5KDM B;  3KXB B;  4HGA C;  3AV1 C;  1ID3 D;  4NE3 A;  3AZK A;  3KWQ C;  5GT0 A;  4YS3 B;  1P3F C;  4KGC B;  3W96 C;  3AZK D;  5BNV B;  5GT0 D;  5CPI A;  3X1T D;  1P3K C;  3AZL B;  5B24 A;  3LZ1 B;  3UTB C;  5CPI D;  4X23 B;  3WTP E;  5B24 D;  2HIO A;  3WA9 C;  3C1B C;  3AZE C;  4EO5 C;  1B67 A;  3AFA A;  1P3A B;  2HIO D;  5B32 C;  3AZI C;  3AZM C;  5B40 B;  5B2I A;  4E45 A;  3AFA D;  1ID3 B;  4H9O A;  5E5A C;  3UTA C;  2PYO B;  5AVC C;  4DRA A;  5B2I D;  5CP6 B;  5GT0 B;  3X1T B;  4H9Q A;  3MVD C;  4JJN A;  2NQB A;  1P3G A;  5AV5 A;  5JRG B;  1HQ3 B;  5CPI B;  3AZF A;  5B32 G;  1P3B A;  3MGP A;  5CPJ B;  4JJN D;  3LEL C;  2NQB D;  5B24 B;  1P3G D;  5B31 B;  4XUJ D;  1M18 B;  5B1L C;  5B0Z C;  3X1V A;  1F1E A;  3AZF D;  1P3B D;  3MGP D;  5AVB B;  4CAY A;  3AZN C;  4J8W D;  2FJ7 A;  3WKJ A;  2NZD B;  3LZ0 C;  5AV9 A;  3X1V D;  1KX3 A;  2FJ7 D;  5GXQ C;  3WKJ D;  5BS7 C;  5AV8 A;  2F8N H;  1P3O B;  3R45 B;  4ZUX C;  1KX3 D;  3NQU B;  4WU8 A;  1P3M B;  4XZQ C;  5AV8 D;  5F99 C;  4H9O B;  1WWI A;  2CWE A;  4WU8 D;  5BNX B;  5B0Y A;  4UUZ A;  4QLC A;  5DNM A;  3KXB C;  1P3L A;  5B1M D;  5G49 A;  4JJN B;  3REJ B;  2NQB B;  5B0Y D;  4YS3 C;  4QLC D;  1H3O A;  5DNM D;  4XUJ B;  3AZF B;  3TU4 C;  1P3L D;  3MGP B;  5CPK B;  4KGC C;  4J8W B;  3AYW A;  1JFI A;  4H9N A;  4LD9 A;  5GT3 A;  2F8N A;  3MGQ D;  3LZ1 C;  3LJA A;  1S32 B;  3AZG B;  2FJ7 B;  3AYW D;  3AN2 C;  3A6N A;  3WKJ B;  5B33 C;  1EQZ A;  4LD9 D;  3W97 B;  5GT3 D;  5KDM A;  2F8N D;  4Z66 C;  3LJA D;  3AZH B;  3A6N D;  5FUG B;  1EQZ D;  1M19 A;  1M1A C;  1KX5 A;  3NQJ B;  3W98 B;  3B0D B;  5BNV A;  3AV2 C;  3AZJ C;  3AZL A;  1M19 D;  1KX5 D;  2BYK A;  4AWL B;  5B1M B;  3MGS B;  2ARO C;  3MGR C;  5C3I B;  5DNM B;  4X23 A;  5G49 B;  3B0C W;  3V9R B;  5JA4 A;  3AZK C;  1P34 A;  1KX5 C;  5GT0 C;  1H3O B;  4X23 D;  3WAA B;  3MGQ B;  3REH B;  1P3A A;  2BYM B;  1P34 D;  3MNN B;  5CPI C;  4WU9 B;  5B40 A;  5B24 C;  3LJA B;  1P3A D;  4G92 C;  1ID3 A;  3REL A;  3A6N B;  4NE5 A;  5B40 D;  2PYO A;  3C1C A;  4E44 A;  2HIO C;  3REL D;  5CP6 A;  3X1T A;  2PYO D;  1P3P A;  3C1C D;  1M19 B;  1KX5 B;  3B6G A;  3AFA C;  3O62 B;  1U35 B;  5JRG A;  1HQ3 A;  5CP6 D;  3X1S A;  1P3P D;  5B2I C;  5CPJ A;  3B6G D;  2BYK B;  5B31 A;  1M18 A;  5JRG D;  1HQ3 D;  3VH6 T;  3X1S D;  1WWS A;  5CPJ D;  5AVB A;  2NZD A;  5DNN B;  5B31 D;  5JA4 B;  1P34 B;  1M18 D;  1BFM A;  2F8N K;  4JJN C;  5AVB D;  2NQB C;  1TZY A;  2NZD D;  1P3G C;  5AV5 C;  1P3O A;  3R45 A;  2CV5 B;  5AV6 D;  1ZLA A;  4J8U A;  4R8P B;  3AZF C;  1P3B C;  3NQU A;  1BH8 A;  4WV4 B;  3MGP C;  3UT9 A;  1TZY D;  1P3M A;  1P3O D;  1KX4 B;  4YM6 B;  1ULY A;  4G91 B;  3X1V C;  3REL B;  4J8U D;  1ZLA D;  1Q9C A;  4H9S A;  3C1C B;  3UT9 D;  2FJ7 C;  3WKJ C;  1P3M D;  5BNX A;  2HUE B;  4H9P B;  5AV9 C;  1KX3 C;  1P3P B;  3REJ A;  5AV8 C;  3B6G B;  2RVQ D;  5B2J A;  4XUJ A;  3VH5 T;  3X1S B;  4WU8 C;  5CPK A;  3REJ D;  3X1U B;  4J8W A;  5B2J D;  4ZBJ C;  5CPK D;  1S32 A;  5B0Y C;  3AZG A;  4QLC C;  5DNM C;  3W97 A;  5AV6 B;  1P3L C;  3REK A;  4WZS B;  3AZH A;  3AZG D;  1TZY B;  1S32 D;  1KU5 A;  3KUY A;  5FUG A;  3W97 D;  4J8V B;  1ZLA B;  4J8U B;  4M6B A;  1BH8 B;  3REK D;  3NQJ A;  4KUD B;  3UT9 B;  2LY8 A;  3AYW C;  3AZH D;  3W98 A;  3KUY D;  4LD9 C;  4CSR A;  5GT3 C;  3C1B D;  1B6W A;  3LJA C;  5B1M A;  3A6N C;  3MGS A;  3W98 D;  4Z5T A;  1EQZ C;  3V9R A;  4HGA B;  3MGS D;  5E5A D;  4Z5T D;  5B2J B;  1M19 C;  3WAA A;  3MGQ A; 
#chains in the Genus database with same CATH topology
 3REI A;  2BYM A;  3MNN A;  2YFV B;  3W96 B;  4WU9 A;  3AZL C;  3WAA D;  3REH D;  2F8N G;  3REI D;  3MNN D;  3AL0 C;  4WU9 D;  3UTB B;  4X23 C;  4H9R B;  3B6F A;  3REK B;  1P3I A;  1P34 C;  3WTP A;  3WA9 B;  3KUY B;  3IP4 C;  3C1B B;  4J8X A;  3B6F D;  4EO5 B;  1N1J A;  1P3A C;  1P3I D;  3B0C T;  3O62 A;  3WTP D;  1U35 A;  3AZI B;  5B40 C;  2Y2M A;  3AZM B;  1BH9 A;  4CSR B;  4J8X D;  3FDD A;  1ID3 C;  1AOI A;  3O62 D;  3REL C;  2BG1 A;  2XD1 A;  5E5A B;  1U35 D;  4Z5T B;  3UTA B;  2PYO C;  3C1C C;  1PZR A;  5AVC B;  5DNN A;  1AOI D;  2YFW B;  5CP6 C;  3X1T C;  1P3P C;  3B6G C;  2UWX A;  5DNN D;  3REI B;  2CV5 A;  5GSU A;  1HQ3 C;  5JRG C;  4R8P A;  4KHA B;  4NFT A;  3X1S C;  4DRB A;  5CPJ C;  5AY8 A;  5B31 C;  5CHL B;  1KX4 A;  4YM6 A;  1M18 C;  2CV5 D;  5GSU D;  2Y2I A;  5B0Z B;  4R8P D;  5AVB C;  2NZD C;  5AY8 D;  3B6F B;  3AZN B;  4H9P A;  1P3I B;  1KX4 D;  4YM6 D;  3WTP B;  3LZ0 B;  5BO0 A;  1TZY C;  4J8X B;  5GXQ B;  1N1J B;  1P3O C;  1ZLA C;  4ZUX B;  3UT9 C;  1BH9 B;  1P3M C;  1A7W A;  4WNN A;  4Z66 D;  3X1U A;  4XZQ B;  1AOI B;  5F99 B;  5B31 G;  5BT1 D;  4H9S C;  3X1U D;  3H0L C;  3MGR A;  3W99 A;  2Y2L A;  5AV6 A;  2IO5 B;  3REJ C;  2ARO D;  5B2J C;  3MGR D;  4XUJ C;  3W99 D;  5GSU B;  4J8V A;  3VH6 A;  4KUD A;  5CPK C;  3TU4 B;  4J8W C;  5AY8 B;  1HTA A;  3B0B A;  4J8V D;  1F66 A;  4KUD D;  1S32 C;  3AZG C;  3AN2 B;  5B33 B;  3W97 C;  3EPH A;  1F66 D;  4UPK A;  5BO0 B;  3REK C;  3AZH C;  4Z66 B;  3AV1 A;  3KUY C;  3KWQ A;  1M1A B;  3W98 C;  4WNN B;  3B0D C;  3AV1 D;  1P3F A;  2YFV A;  3VH6 W;  3W96 A;  3KWQ D;  1P3K A;  3AV2 B;  3AZJ B;  4AWL C;  5B1M C;  3MGS C;  1P3F D;  4Z5T C;  2ARO B;  5C3I C;  3MGR B;  3UTB A;  1P3K D;  3W96 D;  3W99 B;  3VH5 A;  4H9R A;  4Z2M H;  2JSS A;  3AZK B;  3WA9 A;  3UTB D;  2ZY2 A;  3C1B A;  3WAA C;  3AZE A;  3MGQ C;  3REH C;  3REI C;  3MNN C;  3REH A;  4WU9 C;  5B32 A;  3AZI A;  3WA9 D;  3AZM A;  3AZE D;  1F66 B;  5AV5 D;  2ZY5 A;  4G92 B;  5E5A A;  5B32 D;  3AZI D;  3UTA A;  3AZM D;  5AVC A;  3B6F C;  1P3I C;  2JE5 A;  2Y2O A;  2YFW A;  2HIO B;  3A1K A;  3VH5 W;  3WTP C;  3AV1 B;  3UTA D;  3KWQ B;  4J8X C;  5AVC D;  3MVD A;  3O62 C;  3AFA B;  5AV9 D;  1U35 C;  1P3F B;  4KHA A;  1P3K B;  4Z2M G;  5B2I B;  3MVD D;  3LEL A;  1AOI C;  5B1L A;  5B0Z A;  1TAF A;  5DNN C;  3AZN A;  3LEL D;  4NE6 A;  3LZ0 A;  5B1L D;  5B0Z D;  2IO5 C;  4H9Q B;  3AZE B;  5GXQ A;  3AZN D;  5BS7 A;  5AV5 B;  1P3G B;  2CV5 C;  5GSU C;  4ZUX A;  4R8P C;  3LZ0 D;  5B32 B;  1P3B B;  5AY8 C;  2RIQ A;  5GXQ D;  1KX4 C;  4XZQ A;  4YM6 C;  4G91 C;  5F99 A;  4ZUX D;  3X1V B;  2XD5 A;  4CAY B;  2HUE C;  2JCH A;  4XZQ D;  5F99 D;  5AV9 B;  2ZM5 A;  2W8S A;  1KX3 B;  3KXB A;  1R4V A;  3MVD B;  5AV8 B;  4YS3 A;  5BT1 C;  3KXB D;  3TU4 A;  3X1U C;  4WU8 B;  4KGC A;  3LEL B;  4YS3 D;  4ZBJ B;  2DQN C;  5B1L B;  1TAF B;  3TU4 D;  2L5A A;  3LZ1 A;  4KGC D;  5B0Y B;  3AN2 A;  4UUZ B;  3W99 C;  5B33 A;  4QLC B;  5AV6 C;  3AZL D;  1P3L B;  4Z66 A;  3KSY A;  3LZ1 D;  3AN2 D;  5B33 D;  4J8V C;  4J8U C;  4KUD C;  1M1A A;  3AYW B;  1JFI B;  4H9N B;  3AV2 A;  4LD9 B;  2FFF B;  5GT3 B;  3AZJ A;  1F66 C;  2F8N B;  3EG5 B;  1M1A D;  2RVQ C;  2ARO A;  2Y2G A;  3AV2 D;  1EQZ B;  3AZJ D;  5KDM B;  3F6T A;  3KXB B;  4HGA C;  3AV1 C;  1ID3 D;  4NE3 A;  3AZK A;  3KWQ C;  5GT0 A;  4YS3 B;  1P3F C;  4KGC B;  3W96 C;  3AZK D;  2Y2N A;  5BNV B;  5GT0 D;  3X1T D;  5CPI A;  1P3K C;  3AZL B;  5B24 A;  3LZ1 B;  3UTB C;  5CPI D;  4X23 B;  3WTP E;  5B24 D;  2HIO A;  3WA9 C;  3C1B C;  2Y2H A;  3AZE C;  4EO5 C;  1B67 A;  3AFA A;  1P3A B;  2HIO D;  5B32 C;  3AZI C;  3AZM C;  5B40 B;  5B2I A;  4E45 A;  3AFA D;  1ID3 B;  4H9O A;  5E5A C;  3UTA C;  2PYO B;  5AVC C;  4DRA A;  5B2I D;  2Y2P A;  2Y2K A;  5CP6 B;  5GT0 B;  3X1T B;  4H9Q A;  3MVD C;  4JJN A;  2NQB A;  1P3G A;  5AV5 A;  5JRG B;  1HQ3 B;  5CPI B;  3AZF A;  5B32 G;  1P3B A;  3MGP A;  5CPJ B;  4JJN D;  3LEL C;  2NQB D;  5B24 B;  1P3G D;  5B31 B;  4XUJ D;  1M18 B;  5B1L C;  5B0Z C;  3X1V A;  1F1E A;  3AZF D;  1P3B D;  3MGP D;  5AVB B;  4CAY A;  3AZN C;  4J8W D;  2FJ7 A;  3WKJ A;  2NZD B;  2F2A C;  3LZ0 C;  5AV9 A;  3X1V D;  1KX3 A;  2FJ7 D;  5GXQ C;  3WKJ D;  1Z2C B;  5BS7 C;  5AV8 A;  1P3O B;  2F8N H;  3R45 B;  4ZUX C;  1KX3 D;  3NQU B;  4WU8 A;  1P3M B;  4XZQ C;  5AV8 D;  5F99 C;  3H0R C;  4H9O B;  1WWI A;  2CWE A;  4WU8 D;  5BNX B;  5B0Y A;  4UUZ A;  4QLC A;  5DNM A;  3KXB C;  1P3L A;  5B1M D;  5G49 A;  4JJN B;  2Y2Q A;  3REJ B;  5B0Y D;  2NQB B;  4YS3 C;  4QLC D;  1H3O A;  5DNM D;  4XUJ B;  3AZF B;  3TU4 C;  1P3L D;  3MGP B;  5CPK B;  4KGC C;  4J8W B;  3AYW A;  1JFI A;  4H9N A;  4LD9 A;  5GT3 A;  2F8N A;  3MGQ D;  3LZ1 C;  3LJA A;  1S32 B;  3AZG B;  2FJ7 B;  3AYW D;  3AN2 C;  3A6N A;  3WKJ B;  5B33 C;  1EQZ A;  4LD9 D;  3W97 B;  5GT3 D;  5KDM A;  2F8N D;  4Z66 C;  3LJA D;  3AZH B;  3A6N D;  5FUG B;  1EQZ D;  1M19 A;  1M1A C;  1KX5 A;  3NQJ B;  2ZY4 A;  3W98 B;  3B0D B;  3P5J B;  5BNV A;  3AV2 C;  3AZJ C;  3AZL A;  1M19 D;  1KX5 D;  2BYK A;  4AWL B;  5B1M B;  3MGS B;  2ARO C;  3MGR C;  5C3I B;  5DNM B;  4X23 A;  5G49 B;  3B0C W;  3V9R B;  5JA4 A;  3AZK C;  1P34 A;  1KX5 C;  2DF4 C;  5GT0 C;  2Y2J A;  1H3O B;  4X23 D;  3WAA B;  3MGQ B;  3REH B;  1P3A A;  2BYM B;  1P34 D;  3MNN B;  2J8P A;  5CPI C;  4WU9 B;  5B40 A;  2ZY3 A;  5B24 C;  3LJA B;  1P3A D;  4G92 C;  1ID3 A;  3REL A;  3A6N B;  4NE5 A;  5B40 D;  2PYO A;  2G5I C;  3C1C A;  4E44 A;  2HIO C;  3REL D;  3EPJ A;  4WJ3 C;  5CP6 A;  3X1T A;  2PYO D;  1P3P A;  3C1C D;  1M19 B;  1KX5 B;  3B6G A;  3AFA C;  3O62 B;  1U35 B;  5JRG A;  1HQ3 A;  5CP6 D;  3X1S A;  1P3P D;  5B2I C;  5CPJ A;  1T3U A;  3B6G D;  2BYK B;  5B31 A;  1M18 A;  5JRG D;  1HQ3 D;  3VH6 T;  1W2E A;  3X1S D;  1WWS A;  5CPJ D;  5AVB A;  2NZD A;  5DNN B;  2G5H C;  5B31 D;  5JA4 B;  1P34 B;  1M18 D;  1BFM A;  2F8N K;  4JJN C;  5AVB D;  2NQB C;  1TZY A;  2NZD D;  1P3G C;  5AV5 C;  1P3O A;  3R45 A;  2CV5 B;  5AV6 D;  1ZLA A;  4J8U A;  4R8P B;  3AZF C;  1P3B C;  3NQU A;  1BH8 A;  4WV4 B;  3MGP C;  3UT9 A;  1TZY D;  1P3M A;  1P3O D;  1KX4 B;  4YM6 B;  1ULY A;  4G91 B;  3X1V C;  3REL B;  4J8U D;  1ZLA D;  1Q9C A;  4H9S A;  3C1C B;  3UT9 D;  2FJ7 C;  3WKJ C;  1P3M D;  5BNX A;  2HUE B;  4H9P B;  5AV9 C;  1KX3 C;  1P3P B;  3REJ A;  5AV8 C;  3B6G B;  2RVQ D;  5B2J A;  4XUJ A;  3VH5 T;  3X1S B;  4WU8 C;  5CPK A;  3EPL A;  4DQY B;  3REJ D;  3X1U B;  4J8W A;  2VQR A;  5B2J D;  4ZBJ C;  3KFU G;  5CPK D;  1S32 A;  5B0Y C;  3AZG A;  4QLC C;  5DNM C;  3A1I A;  3W97 A;  5AV6 B;  1P3L C;  3REK A;  4WZS B;  3AZH A;  3AZG D;  1TZY B;  1S32 D;  1KU5 A;  3KUY A;  5FUG A;  3H0M C;  4J8V B;  3W97 D;  1ZLA B;  4J8U B;  4M6B A;  1BH8 B;  3REK D;  3NQJ A;  4KUD B;  3UT9 B;  2LY8 A;  3AYW C;  3AZH D;  3W98 A;  3KUY D;  4LD9 C;  4CSR A;  5GT3 C;  3C1B D;  1B6W A;  3LJA C;  5B1M A;  3A6N C;  3MGS A;  3W98 D;  4Z5T A;  1EQZ C;  3EPK A;  3V9R A;  4HGA B;  3MGS D;  5E5A D;  4Z5T D;  5B2J B;  1M19 C;  3WAA A;  3MGQ A; 
#chains in the Genus database with same CATH homology
 3REI A;  2BYM A;  3MNN A;  2YFV B;  3W96 B;  4WU9 A;  3AZL C;  3WAA D;  3REH D;  2F8N G;  3REI D;  3MNN D;  3AL0 C;  4WU9 D;  3UTB B;  4X23 C;  4H9R B;  3B6F A;  3REK B;  1P3I A;  1P34 C;  3WTP A;  3WA9 B;  3KUY B;  3IP4 C;  3C1B B;  4J8X A;  3B6F D;  4EO5 B;  1N1J A;  1P3A C;  1P3I D;  3B0C T;  3O62 A;  3WTP D;  1U35 A;  3AZI B;  5B40 C;  2Y2M A;  3AZM B;  1BH9 A;  4CSR B;  4J8X D;  3FDD A;  1ID3 C;  1AOI A;  3O62 D;  3REL C;  2BG1 A;  2XD1 A;  5E5A B;  1U35 D;  4Z5T B;  3UTA B;  2PYO C;  3C1C C;  1PZR A;  5AVC B;  5DNN A;  1AOI D;  2YFW B;  5CP6 C;  3X1T C;  1P3P C;  3B6G C;  2UWX A;  5DNN D;  3REI B;  2CV5 A;  5GSU A;  1HQ3 C;  5JRG C;  4R8P A;  4KHA B;  4NFT A;  3X1S C;  4DRB A;  5CPJ C;  5AY8 A;  5B31 C;  5CHL B;  1KX4 A;  4YM6 A;  1M18 C;  2CV5 D;  5GSU D;  2Y2I A;  5B0Z B;  4R8P D;  5AVB C;  2NZD C;  5AY8 D;  3B6F B;  3AZN B;  4H9P A;  1P3I B;  1KX4 D;  4YM6 D;  3WTP B;  3LZ0 B;  5BO0 A;  1TZY C;  4J8X B;  5GXQ B;  1N1J B;  1P3O C;  1ZLA C;  4ZUX B;  3UT9 C;  1BH9 B;  1P3M C;  1A7W A;  4WNN A;  4Z66 D;  3X1U A;  4XZQ B;  1AOI B;  5F99 B;  5B31 G;  5BT1 D;  4H9S C;  3X1U D;  3H0L C;  3MGR A;  3W99 A;  2Y2L A;  5AV6 A;  2IO5 B;  3REJ C;  2ARO D;  5B2J C;  3MGR D;  4XUJ C;  3W99 D;  5GSU B;  4J8V A;  3VH6 A;  4KUD A;  5CPK C;  3TU4 B;  4J8W C;  5AY8 B;  1HTA A;  3B0B A;  4J8V D;  1F66 A;  4KUD D;  1S32 C;  3AZG C;  3AN2 B;  5B33 B;  3W97 C;  3EPH A;  1F66 D;  4UPK A;  5BO0 B;  3REK C;  3AZH C;  4Z66 B;  3AV1 A;  3KUY C;  3KWQ A;  1M1A B;  3W98 C;  4WNN B;  3B0D C;  3AV1 D;  1P3F A;  2YFV A;  3VH6 W;  3W96 A;  3KWQ D;  1P3K A;  3AV2 B;  3AZJ B;  4AWL C;  5B1M C;  3MGS C;  1P3F D;  4Z5T C;  2ARO B;  5C3I C;  3MGR B;  3UTB A;  1P3K D;  3W96 D;  3W99 B;  3VH5 A;  4H9R A;  4Z2M H;  2JSS A;  3AZK B;  3WA9 A;  3UTB D;  2ZY2 A;  3C1B A;  3WAA C;  3AZE A;  3MGQ C;  3REH C;  3REI C;  3MNN C;  3REH A;  4WU9 C;  5B32 A;  3AZI A;  3WA9 D;  3AZM A;  3AZE D;  1F66 B;  5AV5 D;  2ZY5 A;  4G92 B;  5E5A A;  5B32 D;  3AZI D;  3UTA A;  3AZM D;  5AVC A;  3B6F C;  1P3I C;  2JE5 A;  2Y2O A;  2YFW A;  2HIO B;  3A1K A;  3VH5 W;  3WTP C;  3AV1 B;  3UTA D;  3KWQ B;  4J8X C;  5AVC D;  3MVD A;  3O62 C;  3AFA B;  5AV9 D;  1U35 C;  1P3F B;  4KHA A;  1P3K B;  4Z2M G;  5B2I B;  3MVD D;  3LEL A;  1AOI C;  5B1L A;  5B0Z A;  1TAF A;  5DNN C;  3AZN A;  3LEL D;  4NE6 A;  3LZ0 A;  5B1L D;  5B0Z D;  2IO5 C;  4H9Q B;  3AZE B;  5GXQ A;  3AZN D;  5BS7 A;  5AV5 B;  1P3G B;  2CV5 C;  5GSU C;  4ZUX A;  4R8P C;  3LZ0 D;  5B32 B;  1P3B B;  5AY8 C;  2RIQ A;  5GXQ D;  1KX4 C;  4XZQ A;  4YM6 C;  4G91 C;  5F99 A;  4ZUX D;  3X1V B;  2XD5 A;  4CAY B;  2HUE C;  2JCH A;  4XZQ D;  5F99 D;  5AV9 B;  2ZM5 A;  2W8S A;  1KX3 B;  3KXB A;  1R4V A;  3MVD B;  5AV8 B;  4YS3 A;  5BT1 C;  3KXB D;  3TU4 A;  3X1U C;  4WU8 B;  4KGC A;  3LEL B;  4YS3 D;  4ZBJ B;  2DQN C;  5B1L B;  1TAF B;  3TU4 D;  2L5A A;  3LZ1 A;  4KGC D;  5B0Y B;  3AN2 A;  4UUZ B;  3W99 C;  5B33 A;  4QLC B;  5AV6 C;  3AZL D;  1P3L B;  4Z66 A;  3KSY A;  3LZ1 D;  3AN2 D;  5B33 D;  4J8V C;  4J8U C;  4KUD C;  1M1A A;  3AYW B;  1JFI B;  4H9N B;  3AV2 A;  4LD9 B;  2FFF B;  5GT3 B;  3AZJ A;  1F66 C;  2F8N B;  3EG5 B;  1M1A D;  2RVQ C;  2ARO A;  2Y2G A;  3AV2 D;  1EQZ B;  3AZJ D;  5KDM B;  3F6T A;  3KXB B;  4HGA C;  3AV1 C;  1ID3 D;  4NE3 A;  3AZK A;  3KWQ C;  5GT0 A;  4YS3 B;  1P3F C;  4KGC B;  3W96 C;  3AZK D;  2Y2N A;  5BNV B;  5GT0 D;  3X1T D;  5CPI A;  1P3K C;  3AZL B;  5B24 A;  3LZ1 B;  3UTB C;  5CPI D;  4X23 B;  3WTP E;  5B24 D;  2HIO A;  3WA9 C;  3C1B C;  2Y2H A;  3AZE C;  4EO5 C;  1B67 A;  3AFA A;  1P3A B;  2HIO D;  5B32 C;  3AZI C;  3AZM C;  5B40 B;  5B2I A;  4E45 A;  3AFA D;  1ID3 B;  4H9O A;  5E5A C;  3UTA C;  2PYO B;  5AVC C;  4DRA A;  5B2I D;  2Y2P A;  2Y2K A;  5CP6 B;  5GT0 B;  3X1T B;  4H9Q A;  3MVD C;  4JJN A;  2NQB A;  1P3G A;  5AV5 A;  5JRG B;  1HQ3 B;  5CPI B;  3AZF A;  5B32 G;  1P3B A;  3MGP A;  5CPJ B;  4JJN D;  3LEL C;  2NQB D;  5B24 B;  1P3G D;  5B31 B;  4XUJ D;  1M18 B;  5B1L C;  5B0Z C;  3X1V A;  1F1E A;  3AZF D;  1P3B D;  3MGP D;  5AVB B;  4CAY A;  3AZN C;  4J8W D;  2FJ7 A;  3WKJ A;  2NZD B;  2F2A C;  3LZ0 C;  5AV9 A;  3X1V D;  1KX3 A;  2FJ7 D;  5GXQ C;  3WKJ D;  1Z2C B;  5BS7 C;  5AV8 A;  1P3O B;  2F8N H;  3R45 B;  4ZUX C;  1KX3 D;  3NQU B;  4WU8 A;  1P3M B;  4XZQ C;  5AV8 D;  5F99 C;  3H0R C;  4H9O B;  1WWI A;  2CWE A;  4WU8 D;  5BNX B;  5B0Y A;  4UUZ A;  4QLC A;  5DNM A;  3KXB C;  1P3L A;  5B1M D;  5G49 A;  4JJN B;  2Y2Q A;  3REJ B;  5B0Y D;  2NQB B;  4YS3 C;  4QLC D;  1H3O A;  5DNM D;  4XUJ B;  3AZF B;  3TU4 C;  1P3L D;  3MGP B;  5CPK B;  4KGC C;  4J8W B;  3AYW A;  1JFI A;  4H9N A;  4LD9 A;  5GT3 A;  2F8N A;  3MGQ D;  3LZ1 C;  3LJA A;  1S32 B;  3AZG B;  2FJ7 B;  3AYW D;  3AN2 C;  3A6N A;  3WKJ B;  5B33 C;  1EQZ A;  4LD9 D;  3W97 B;  5GT3 D;  5KDM A;  2F8N D;  4Z66 C;  3LJA D;  3AZH B;  3A6N D;  5FUG B;  1EQZ D;  1M19 A;  1M1A C;  1KX5 A;  3NQJ B;  2ZY4 A;  3W98 B;  3B0D B;  3P5J B;  5BNV A;  3AV2 C;  3AZJ C;  3AZL A;  1M19 D;  1KX5 D;  2BYK A;  4AWL B;  5B1M B;  3MGS B;  2ARO C;  3MGR C;  5C3I B;  5DNM B;  4X23 A;  5G49 B;  3B0C W;  3V9R B;  5JA4 A;  3AZK C;  1P34 A;  1KX5 C;  2DF4 C;  5GT0 C;  2Y2J A;  1H3O B;  4X23 D;  3WAA B;  3MGQ B;  3REH B;  1P3A A;  2BYM B;  1P34 D;  3MNN B;  2J8P A;  5CPI C;  4WU9 B;  5B40 A;  2ZY3 A;  5B24 C;  3LJA B;  1P3A D;  4G92 C;  1ID3 A;  3REL A;  3A6N B;  4NE5 A;  5B40 D;  2PYO A;  2G5I C;  3C1C A;  4E44 A;  2HIO C;  3REL D;  3EPJ A;  4WJ3 C;  5CP6 A;  3X1T A;  2PYO D;  1P3P A;  3C1C D;  1M19 B;  1KX5 B;  3B6G A;  3AFA C;  3O62 B;  1U35 B;  5JRG A;  1HQ3 A;  5CP6 D;  3X1S A;  1P3P D;  5B2I C;  5CPJ A;  1T3U A;  3B6G D;  2BYK B;  5B31 A;  1M18 A;  5JRG D;  1HQ3 D;  3VH6 T;  1W2E A;  3X1S D;  1WWS A;  5CPJ D;  5AVB A;  2NZD A;  5DNN B;  2G5H C;  5B31 D;  5JA4 B;  1P34 B;  1M18 D;  1BFM A;  2F8N K;  4JJN C;  5AVB D;  2NQB C;  1TZY A;  2NZD D;  1P3G C;  5AV5 C;  1P3O A;  3R45 A;  2CV5 B;  5AV6 D;  1ZLA A;  4J8U A;  4R8P B;  3AZF C;  1P3B C;  3NQU A;  1BH8 A;  4WV4 B;  3MGP C;  3UT9 A;  1TZY D;  1P3M A;  1P3O D;  1KX4 B;  4YM6 B;  1ULY A;  4G91 B;  3X1V C;  3REL B;  4J8U D;  1ZLA D;  1Q9C A;  4H9S A;  3C1C B;  3UT9 D;  2FJ7 C;  3WKJ C;  1P3M D;  5BNX A;  2HUE B;  4H9P B;  5AV9 C;  1KX3 C;  1P3P B;  3REJ A;  5AV8 C;  3B6G B;  2RVQ D;  5B2J A;  4XUJ A;  3VH5 T;  3X1S B;  4WU8 C;  5CPK A;  3EPL A;  4DQY B;  3REJ D;  3X1U B;  4J8W A;  2VQR A;  5B2J D;  4ZBJ C;  3KFU G;  5CPK D;  1S32 A;  5B0Y C;  3AZG A;  4QLC C;  5DNM C;  3A1I A;  3W97 A;  5AV6 B;  1P3L C;  3REK A;  4WZS B;  3AZH A;  3AZG D;  1TZY B;  1S32 D;  1KU5 A;  3KUY A;  5FUG A;  3H0M C;  4J8V B;  3W97 D;  1ZLA B;  4J8U B;  4M6B A;  1BH8 B;  3REK D;  3NQJ A;  4KUD B;  3UT9 B;  2LY8 A;  3AYW C;  3AZH D;  3W98 A;  3KUY D;  4LD9 C;  4CSR A;  5GT3 C;  3C1B D;  1B6W A;  3LJA C;  5B1M A;  3A6N C;  3MGS A;  3W98 D;  4Z5T A;  1EQZ C;  3EPK A;  3V9R A;  4HGA B;  3MGS D;  5E5A D;  4Z5T D;  5B2J B;  1M19 C;  3WAA A;  3MGQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...