5CPIA

Nucleosome containing unmethylated sat2r dna
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Influence of DNA methylation on positioning and DNA flexibility of nucleosomes with pericentric satellite DNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 32
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5cpiA00
1WWIA 5BO0B 5BO0A 5AV6B 3X1TA 1ID3B 3WA9B 5AV6A 1ID3A 3KUYD 5CP6C 5B33D 3LZ1D 4J8UD 1KU5A 4EO5C 1ZLAD 1P3FD 5DNMB 3UT9B 1KX3C 5DNMA 4J8WB 3UT9A 4J8WA 3O62A 4NE3A 3MGQD 3AZEC 5E5AB 3AZMC 4ZUXD 1P34C 3REID 3A6NB 3AZJB 3W96D 5GT3A 3A6NA 2PYOC 4LD9B 5GSUB 3KWQD 4LD9A 5GSUA 2NZDB 5C3IC 5AV8C 1S32B 2NZDA 4YM6C 4QLCB 4AWLB 3C1CC 2YFVB 1P3KD 5B24D 1M1AC 2YFVA 3B0BA 5DNND 3AFAA 1P3GD 3REHD 3WAAC 2AROC 4R8PC 4KUDD 1P3ID 5CP6B 1P3LB 5BS7C 3MNND 2RVQD 4G92C 1P3LA 1KX4D 1M18D 3VH5A 2CWEA 3VH6T 3TU4B 3B6GC 3X1UB 1KX3B 4J8VB 3NQUB 3TU4A 3X1UA 1KX3A 4J8VA 3NQUA 4J8XB 4E45A 1KX5D 1F66C 5B0YC 4J8XA 5B0ZD 5BT1D 3AZEB 2NQBC 4E44A 3AZEA 1U35C 4X23D 5B2JB 5AVCC 5B2JA 3X1SC 2BYKB 1HQ3D 2BYKA 3AZFD 1F1EA 2PYOB 4H9QB 4YS3B 3AV2C 4H9QA 5C3IB 4YS3A 2HIOA 2F8NB 5AV5D 4YM6B 2F8NA 2BYMB 1M1AB 2BYMA 3MGSD 4KGCC 4Z66C 1M19D 3WAAB 3REKD 3WTPE 3WTPC 4Z5TB 4Z5TA 4CSRB 1P3IA 3W98C 4XUJD 4CSRA 5B2ID 5F99D 5CPJD 3LELC 3X1TC 3B6GB 5AV6C 1ID3C 3B6GA 5AV9B 2FJ7D 3AZLA 5AV9A 1KX5A 5B1MD 1F66B 5B0YB 1F66A 1BH9B 2NQBB 2F8NH 1BH9A 2NQBA 1P3OB 2F8NG 3UT9C 1P3OA 4J8WC 3WKJC 3O62C 3AZKA 1BFMA 4JJNB 3LZ0B 3MVDD 4WZSB 4JJNA 3LZ0A 4Z2MH 3MGRD 4WU8A 4Z2MG 3AV2B 5CHLB 5GT3C 3WA9D 3A6NC 3AV1D 4LD9C 5GSUC 4Z66B 3UTAD 4Z66A 3AZHD 3AZGD 3REJD 3AFAC 1B6WA 5B31A 3B6FD 3LELB 3X1TB 3LELA 3W97A 4G91C 5JRGD 3C1BD 3AN2D 5E5AD 5B33C 5CPID 5AY8D 1P3LC 2CV5A 1P3AD 1R4VA 3AZIB 3AZJD 1P3FC 4DRBA 3AZIA 5B1LB 3X1VA 3TU4C 3X1UC 5B1LA 4J8VC 3MGPD 3WKJB 5GT0D 3O62B 3WKJA 4J8XC 5B40D 4QLCD 4H9PB 1AOID 4NE5A 4H9PA 3W99B 3W99A 5B32B 3VH6A 5B2JC 5B32A 2F8NK 1TZYB 1TZYA 5GT3B 3KXBB 3KXBA 1EQZA 3LJAA 4YS3C 2HIOC 1H3OA 1P3BA 1P3MA 5DNNC 3AFAB 3B6FA 3KSYA 3B0DC 5CPKD 3KUYB 4G91B 4Z5TC 1P3IC 5B33B 3KUYA 3AZMD 2RVQC 3LZ1B 1KX4C 5B33A 3LZ1A 3AYWD 4J8UA 1P34D 1ZLAB 1P3FB 1ZLAA 5B32G 5AVBD 1P3FA 3AZLC 5AV9C 3AZND 5AV8D 1KX5C 4YM6D 3MGQB 5BT1C 3MGQA 3C1CD 4XZQD 1M1AD 4X23C 1P3OC 4ZUXB 4ZBJC 3AZKC 4ZUXA 1TAFB 3REIA 3W96B 4JJNC 3WAAD 1TAFA 3LZ0C 3W96A 2AROD 3KWQB 4WU8C 4R8PD 1B67A 3KWQA 5GXQD 4HGAB 2HIOB 3R45B 5B24B 3MGSC 1P3KA 3R45A 5DNNB 5B24A 5DNNA 4NFTA 1P3GA 3REHA 5B0YD 3RELD 3B0DB 2L5AA 1P3PD 1U35D 4KUDB 1P3IB 5AVCD 4XUJC 4KUDA 1KX4B 3MNNA 1M18B 1Q9CA 5F99C 3X1SD 1KX4A 5B31C 1M18A 5AVBA 4WU9D 3W97C 3AZLB 3AV2D 3AZNA 1KX5B 3UTBD 2CV5C 5B0ZB 5B0ZA 3AZIC 3X1VC 4X23B 5B1LC 4H9OB 4X23A 4KGCD 4H9OA 4ZBJB 3AZKB 3MVDC 3AZFB 1HQ3A 3AZFA 2YFWB 3WTPD 4WU8B 2YFWA 3W98D 3W99C 5GXQA 5B32C 5AV5B 5AV5A 3B0CW 1TZYC 3X1TD 5AV6D 1ID3D 3MGSB 4KHAB 3KXBC 1EQZC 3VH5W 3MGSA 4KHAA 3LJAC 3V9RB 1M19B 3UTAC 3AZHC 3V9RA 1M19A 5FUGB 1P3BC 3REKA 5FUGA 1P3MC 4XUJB 5DNMD 1A7WA 5BNVB 3UT9D 4H9SA 4XUJA 4J8WD 5BNVA 5B2IA 5F99B 3O62D 5B31B 3B6FC 5CPJB 5F99A 5CPJA 4NE6A 2FJ7B 3W97B 3AN2C 2FJ7A 3C1BC 5CPIC 3KUYC 5B1MB 2CV5B 3LZ1C 4J8UC 5B1MA 5GT3D 1ZLAC 3A6ND 1JFIB 3X1VB 1JFIA 4LD9D 5GSUD 2NZDD 3MVDB 1S32D 3MVDA 3MGQC 3MGRB 2IO5C 3MGRA 3AFAD 4ZUXC 3REIC 3W96C 3WA9A 3AV1B 1EQZB 5B31G 3KWQC 3AV1A 3LJAB 1N1JB 5CP6D 1P3LD 3UTAB 3AZHB 1N1JA 4HGAC 3UTAA 3AZHA 1H3OB 1P3BB 1P3MB 3AZGB 3TU4D 1P3KC 3X1UD 5B24C 3REJB 4J8VD 1BH8B 3AZGA 1KX3D 3REJA 1BH8A 3B6FB 1P3GC 3REHC 4J8XD 4M6BA 4WV4B 5CPKC 5JRGB 3AZED 3C1BB 3AN2B 5CPIB 5JRGA 3AN2A 5AY8B 3C1BA 5E5AA 4KUDC 5B2JD 5CPIA 3MNNC 5AY8A 3AYWC 1P3AB 4J8UB 1M18C 1P3AA 5AVBC 3AZJA 2PYOD 3MGPB 5GT0B 4YS3D 3MGPA 2HIOD 5GT0A 3NQJB 3AZNC 5B40B 1S32A 3NQJA 2F8ND 1AOIB 4UUZB 5B40A 4QLCA 5B0ZC 2IO5B 4XZQC 4UUZA 1AOIA 5G49B 5G49A 3REIB 4DRAA 1HQ3C 3AZFC 4Z5TD 5GXQC 5BNXB 4CAYB 5CP6A 5BNXA 4CAYA 4EO5B 2LY8A 2HUEC 5AV5C 1P3KB 3B6GD 3AZLD 5AV9D 1P3GB 3REHB 3RELC 1M19C 1F66D 5CPKB 3REKC 1P3PC 2NQBD 5CPKA 3AZMB 4H9SC 1P3OD 3MNNB 3AZMA 3AYWB 5B2IC 1P34B 3AZKD 3AYWA 1P34A 5CPJC 4JJND 3LZ0D 5AVBB 3VH6W 4WU9C 4WU8D 1WWSA 1HTAA 2PYOA 2FJ7C 3AZNB 5AV8B 3UTBC 4H9NB 5AV8A 5B1MC 4H9NA 3B0CT 4YM6A 3C1CB 4XZQB 3C1CA 4XZQA 1M1AA 3VH5T 4Z66D 2JSSA 1HQ3B 2AROB 3WAAA 4R8PB 2AROA 3MGRC 4R8PA 5GXQB 4G92B 5BS7A 5B31D 2HUEB 3LELD 3W97D 3WA9C 3AV1C 5KDMB 3RELB 2CV5D 5KDMA 1ULYA 5B0YA 3RELA 1P3PB 3REKB 1U35B 5JA4B 3AZID 3X1VD 1P3PA 5AVCB 1U35A 5JA4A 5DNMC 5B1LD 3AZGC 5AVCA 4WNNB 5B2IB 3X1SB 3REJC 4WNNA 3WKJD 3X1SA 4WU9B 4H9RB 4WU9A 4H9RA 3W99D 5JRGC 3AV2A 5E5AC 3UTBB 5B32D 5AY8C 3UTBA 1P3AC 1TZYD 3AZJC 3KXBD 1EQZD 4KGCB 3LJAD 3MGPC 4KGCA 2NZDC 5GT0C 1S32C 3WTPB 4AWLC 4QLCC 5B40C 1P3BD 1AOIC 3WTPA 1P3MD 3W98B 3W98A
chains in the Genus database with same CATH superfamily
1WWIA 2Y2OA 5BO0B 5BO0A 5AV6B 3X1TA 1ID3B 3WA9B 5AV6A 1ID3A 3KUYD 5CP6C 5B33D 3LZ1D 4J8UD 1KU5A 4EO5C 4UPKA 1ZLAD 1P3FD 5DNMB 3UT9B 1KX3C 5DNMA 4J8WB 3UT9A 3EPJA 4J8WA 3O62A 4NE3A 3MGQD 3AZEC 5E5AB 3AZMC 4ZUXD 1P34C 3REID 3A6NB 3AZJB 3W96D 5GT3A 3A6NA 2PYOC 4LD9B 5GSUB 3KWQD 4LD9A 3EG5B 5GSUA 2NZDB 5C3IC 5AV8C 1S32B 2NZDA 4YM6C 4QLCB 4AWLB 3C1CC 2YFVB 1P3KD 5B24D 1M1AC 2YFVA 3B0BA 5DNND 3AFAA 1P3GD 3REHD 3WAAC 2AROC 4R8PC 4KUDD 1P3ID 5CP6B 1P3LB 5BS7C 3MNND 2RVQD 4G92C 1P3LA 1KX4D 2Y2GA 1M18D 3VH5A 2CWEA 3VH6T 3TU4B 3B6GC 3X1UB 1KX3B 4J8VB 3NQUB 3TU4A 3X1UA 1KX3A 4J8VA 3NQUA 1W2EA 4J8XB 4E45A 1KX5D 1F66C 5B0YC 4J8XA 5B0ZD 5BT1D 3AZEB 2NQBC 4E44A 3AZEA 1U35C 4X23D 5B2JB 5AVCC 5B2JA 3X1SC 2BYKB 1HQ3D 2BYKA 3AZFD 3AL0C 1F1EA 2ZY4A 2PYOB 4H9QB 2Y2PA 4YS3B 3AV2C 4H9QA 5C3IB 4YS3A 2HIOA 2F8NB 5AV5D 2Y2MA 4YM6B 2F8NA 2BYMB 1M1AB 2BYMA 3MGSD 4KGCC 4Z66C 1M19D 2ZY3A 3WAAB 3A1KA 3WTPE 3WTPC 4Z5TB 3REKD 4Z5TA 4CSRB 4DQYB 1P3IA 3W98C 4XUJD 4CSRA 5B2ID 5F99D 5CPJD 3LELC 3X1TC 3B6GB 5AV6C 1ID3C 3B6GA 5AV9B 2FJ7D 3AZLA 5AV9A 1KX5A 5B1MD 1F66B 5B0YB 1F66A 1BH9B 2NQBB 2F8NH 1BH9A 3EPKA 2NQBA 1P3OB 2F8NG 3UT9C 1P3OA 4J8WC 3WKJC 3O62C 3AZKA 1BFMA 4JJNB 3LZ0B 3MVDD 4WZSB 4JJNA 3LZ0A 4Z2MH 3MGRD 4WU8A 4Z2MG 3AV2B 5CHLB 5GT3C 3WA9D 3A6NC 3AV1D 4LD9C 5GSUC 4Z66B 2DF4C 3UTAD 4Z66A 2ZM5A 3AZHD 3AZGD 3REJD 3AFAC 1B6WA 5B31A 3B6FD 3LELB 3X1TB 3LELA 3W97A 4G91C 5JRGD 3C1BD 3AN2D 5E5AD 5B33C 5CPID 5AY8D 1P3LC 2CV5A 1P3AD 1R4VA 3AZIB 3AZJD 1P3FC 4DRBA 3AZIA 5B1LB 3X1VA 3TU4C 3X1UC 5B1LA 1PZRA 4J8VC 3MGPD 3WKJB 5GT0D 3O62B 3WKJA 4J8XC 5B40D 4QLCD 2F2AC 4H9PB 1AOID 4NE5A 4H9PA 3W99B 3KFUG 3W99A 5B32B 3VH6A 5B2JC 5B32A 2F8NK 2BG1A 1TZYB 3H0RC 1TZYA 5GT3B 3KXBB 3KXBA 1EQZA 2Y2JA 3LJAA 4YS3C 2HIOC 1H3OA 1P3BA 1P3MA 5DNNC 3AFAB 3B6FA 3KSYA 3B0DC 5CPKD 3KUYB 4G91B 4Z5TC 1P3IC 5B33B 3KUYA 3AZMD 2RVQC 3LZ1B 1KX4C 5B33A 3LZ1A 3AYWD 4J8UA 1P34D 2RIQA 1ZLAB 1P3FB 1ZLAA 5B32G 5AVBD 1P3FA 3AZLC 5AV9C 3AZND 5AV8D 1KX5C 4YM6D 3MGQB 5BT1C 3MGQA 2XD1A 4XZQD 3C1CD 1M1AD 4X23C 2Y2IA 1P3OC 4ZUXB 4ZBJC 3AZKC 4ZUXA 1TAFB 2XD5A 3REIA 3W96B 4JJNC 3WAAD 1TAFA 3LZ0C 3W96A 2AROD 3KWQB 4WU8C 1T3UA 4R8PD 1B67A 3KWQA 5GXQD 4HGAB 2HIOB 3R45B 2JCHA 5B24B 3MGSC 1P3KA 3R45A 5DNNB 5B24A 5DNNA 4NFTA 1P3GA 3REHA 5B0YD 3RELD 3H0LC 3A1IA 3B0DB 3P5JB 2L5AA 1P3PD 1U35D 4KUDB 1P3IB 5AVCD 4XUJC 4KUDA 1KX4B 3MNNA 1M18B 1Q9CA 5F99C 3X1SD 1KX4A 5B31C 1M18A 5AVBA 4WU9D 3W97C 3AZLB 3AV2D 3AZNA 1KX5B 3UTBD 2CV5C 2W8SA 5B0ZB 5B0ZA 3AZIC 3X1VC 4X23B 5B1LC 4H9OB 4X23A 4KGCD 4H9OA 4ZBJB 3AZKB 3MVDC 3AZFB 1HQ3A 3AZFA 2YFWB 3WTPD 4WU8B 2VQRA 2YFWA 3W98D 3W99C 5GXQA 5B32C 5AV5B 5AV5A 3B0CW 1TZYC 3X1TD 5AV6D 1ID3D 3MGSB 4KHAB 3KXBC 1EQZC 3VH5W 3MGSA 4KHAA 3LJAC 3V9RB 1M19B 3UTAC 3AZHC 3V9RA 1M19A 5FUGB 1P3BC 3REKA 5FUGA 1P3MC 4XUJB 5DNMD 1A7WA 2Y2QA 5BNVB 4H9SA 3UT9D 4XUJA 4J8WD 5BNVA 5B2IA 5F99B 3O62D 5B31B 3B6FC 5CPJB 5F99A 5CPJA 4NE6A 2FJ7B 3W97B 3AN2C 2FJ7A 3C1BC 5CPIC 3KUYC 5B1MB 2CV5B 3LZ1C 4J8UC 5B1MA 5GT3D 1ZLAC 3A6ND 1JFIB 2J8PA 3X1VB 1JFIA 4LD9D 5GSUD 2Y2NA 2NZDD 3MVDB 1S32D 3MVDA 3MGQC 3MGRB 2IO5C 3MGRA 3AFAD 4ZUXC 3REIC 3W96C 3WA9A 3AV1B 1EQZB 5B31G 3KWQC 3AV1A 3LJAB 1N1JB 5CP6D 1P3LD 3UTAB 3AZHB 1N1JA 4HGAC 3UTAA 3AZHA 1H3OB 1P3BB 1P3MB 3AZGB 3TU4D 1P3KC 3X1UD 5B24C 3REJB 4J8VD 1BH8B 3AZGA 1KX3D 3REJA 1BH8A 3B6FB 1P3GC 3REHC 4J8XD 2JE5A 4M6BA 4WV4B 5CPKC 5JRGB 3AZED 3C1BB 3AN2B 5CPIB 5JRGA 3AN2A 5AY8B 3C1BA 5E5AA 4KUDC 5B2JD 5CPIA 3MNNC 5AY8A 3AYWC 1P3AB 4J8UB 1M18C 1P3AA 5AVBC 1Z2CB 3AZJA 2PYOD 3MGPB 2G5HC 5GT0B 4YS3D 3MGPA 2HIOD 5GT0A 3NQJB 3AZNC 5B40B 1S32A 3NQJA 2F8ND 1AOIB 4UUZB 5B40A 4QLCA 5B0ZC 2IO5B 2FFFB 4UUZA 4XZQC 1AOIA 5G49B 5G49A 3REIB 4DRAA 1HQ3C 3AZFC 2DQNC 4Z5TD 5GXQC 5BNXB 4CAYB 5CP6A 2ZY5A 5BNXA 4CAYA 4EO5B 2LY8A 2HUEC 2ZY2A 5AV5C 1P3KB 3B6GD 3AZLD 5AV9D 1P3GB 3REHB 3RELC 1M19C 1F66D 3EPLA 3REKC 5CPKB 1P3PC 2NQBD 5CPKA 3AZMB 4H9SC 1P3OD 3MNNB 3AZMA 3AYWB 5B2IC 1P34B 3AZKD 3H0MC 3EPHA 3AYWA 1P34A 5CPJC 4JJND 3LZ0D 5AVBB 3VH6W 4WU9C 4WU8D 1WWSA 1HTAA 2PYOA 2FJ7C 3AZNB 5AV8B 3UTBC 4H9NB 5AV8A 5B1MC 4H9NA 3B0CT 4YM6A 3C1CB 4XZQB 4WJ3C 3C1CA 4XZQA 1M1AA 3VH5T 2UWXA 4Z66D 2G5IC 2JSSA 1HQ3B 2AROB 3WAAA 4R8PB 2AROA 3MGRC 3IP4C 4R8PA 5GXQB 4G92B 3F6TA 5BS7A 5B31D 2HUEB 3LELD 3W97D 3WA9C 3AV1C 5KDMB 3RELB 2CV5D 5KDMA 1ULYA 5B0YA 3RELA 1P3PB 3REKB 1U35B 5JA4B 3AZID 3X1VD 1P3PA 5AVCB 1U35A 5JA4A 5DNMC 5B1LD 3AZGC 5AVCA 4WNNB 5B2IB 3X1SB 3REJC 4WNNA 3WKJD 3X1SA 4WU9B 4H9RB 4WU9A 4H9RA 3W99D 5JRGC 3AV2A 5E5AC 3UTBB 5B32D 5AY8C 3UTBA 1P3AC 1TZYD 3AZJC 3FDDA 3KXBD 1EQZD 4KGCB 3LJAD 3MGPC 4KGCA 2NZDC 5GT0C 1S32C 2Y2HA 2Y2LA 3WTPB 4AWLC 4QLCC 5B40C 2Y2KA 1P3BD 1AOIC 3WTPA 1P3MD 3W98B 3W98A
chains in the Genus database with same CATH topology
1WWIA 2Y2OA 5BO0B 5BO0A 5AV6B 3X1TA 1ID3B 3WA9B 5AV6A 1ID3A 3KUYD 5CP6C 5B33D 3LZ1D 4J8UD 1KU5A 4EO5C 4UPKA 1ZLAD 1P3FD 5DNMB 3UT9B 1KX3C 5DNMA 4J8WB 3UT9A 3EPJA 4J8WA 3O62A 4NE3A 3MGQD 3AZEC 5E5AB 3AZMC 4ZUXD 1P34C 3REID 3A6NB 3AZJB 3W96D 5GT3A 3A6NA 2PYOC 4LD9B 5GSUB 3KWQD 4LD9A 3EG5B 5GSUA 2NZDB 5C3IC 5AV8C 1S32B 2NZDA 4YM6C 4QLCB 4AWLB 3C1CC 2YFVB 1P3KD 5B24D 1M1AC 2YFVA 3B0BA 5DNND 3AFAA 1P3GD 3REHD 3WAAC 2AROC 4R8PC 4KUDD 1P3ID 5CP6B 1P3LB 5BS7C 3MNND 2RVQD 4G92C 1P3LA 1KX4D 2Y2GA 1M18D 3VH5A 2CWEA 3VH6T 3TU4B 3B6GC 3X1UB 1KX3B 4J8VB 3NQUB 3TU4A 3X1UA 1KX3A 4J8VA 3NQUA 1W2EA 4J8XB 4E45A 1KX5D 1F66C 5B0YC 4J8XA 5B0ZD 5BT1D 3AZEB 2NQBC 4E44A 3AZEA 1U35C 4X23D 5B2JB 5AVCC 5B2JA 3X1SC 2BYKB 1HQ3D 2BYKA 3AZFD 3AL0C 1F1EA 2ZY4A 2PYOB 4H9QB 2Y2PA 4YS3B 3AV2C 4H9QA 5C3IB 4YS3A 2HIOA 2F8NB 5AV5D 2Y2MA 4YM6B 2F8NA 2BYMB 1M1AB 2BYMA 3MGSD 4KGCC 4Z66C 1M19D 2ZY3A 3WAAB 3A1KA 3WTPE 3WTPC 4Z5TB 3REKD 4Z5TA 4CSRB 4DQYB 1P3IA 3W98C 4XUJD 4CSRA 5B2ID 5F99D 5CPJD 3LELC 3X1TC 3B6GB 5AV6C 1ID3C 3B6GA 5AV9B 2FJ7D 3AZLA 5AV9A 1KX5A 5B1MD 1F66B 5B0YB 1F66A 1BH9B 2NQBB 2F8NH 1BH9A 3EPKA 2NQBA 1P3OB 2F8NG 3UT9C 1P3OA 4J8WC 3WKJC 3O62C 3AZKA 1BFMA 4JJNB 3LZ0B 3MVDD 4WZSB 4JJNA 3LZ0A 4Z2MH 3MGRD 4WU8A 4Z2MG 3AV2B 5CHLB 5GT3C 3WA9D 3A6NC 3AV1D 4LD9C 5GSUC 4Z66B 2DF4C 3UTAD 4Z66A 2ZM5A 3AZHD 3AZGD 3REJD 3AFAC 1B6WA 5B31A 3B6FD 3LELB 3X1TB 3LELA 3W97A 4G91C 5JRGD 3C1BD 3AN2D 5E5AD 5B33C 5CPID 5AY8D 1P3LC 2CV5A 1P3AD 1R4VA 3AZIB 3AZJD 1P3FC 4DRBA 3AZIA 5B1LB 3X1VA 3TU4C 3X1UC 5B1LA 1PZRA 4J8VC 3MGPD 3WKJB 5GT0D 3O62B 3WKJA 4J8XC 5B40D 4QLCD 2F2AC 4H9PB 1AOID 4NE5A 4H9PA 3W99B 3KFUG 3W99A 5B32B 3VH6A 5B2JC 5B32A 2F8NK 2BG1A 1TZYB 3H0RC 1TZYA 5GT3B 3KXBB 3KXBA 1EQZA 2Y2JA 3LJAA 4YS3C 2HIOC 1H3OA 1P3BA 1P3MA 5DNNC 3AFAB 3B6FA 3KSYA 3B0DC 5CPKD 3KUYB 4G91B 4Z5TC 1P3IC 5B33B 3KUYA 3AZMD 2RVQC 3LZ1B 1KX4C 5B33A 3LZ1A 3AYWD 4J8UA 1P34D 2RIQA 1ZLAB 1P3FB 1ZLAA 5B32G 5AVBD 1P3FA 3AZLC 5AV9C 3AZND 5AV8D 1KX5C 4YM6D 3MGQB 5BT1C 3MGQA 2XD1A 4XZQD 3C1CD 1M1AD 4X23C 2Y2IA 1P3OC 4ZUXB 4ZBJC 3AZKC 4ZUXA 1TAFB 2XD5A 3REIA 3W96B 4JJNC 3WAAD 1TAFA 3LZ0C 3W96A 2AROD 3KWQB 4WU8C 1T3UA 4R8PD 1B67A 3KWQA 5GXQD 4HGAB 2HIOB 3R45B 2JCHA 5B24B 3MGSC 1P3KA 3R45A 5DNNB 5B24A 5DNNA 4NFTA 1P3GA 3REHA 5B0YD 3RELD 3H0LC 3A1IA 3B0DB 3P5JB 2L5AA 1P3PD 1U35D 4KUDB 1P3IB 5AVCD 4XUJC 4KUDA 1KX4B 3MNNA 1M18B 1Q9CA 5F99C 3X1SD 1KX4A 5B31C 1M18A 5AVBA 4WU9D 3W97C 3AZLB 3AV2D 3AZNA 1KX5B 3UTBD 2CV5C 2W8SA 5B0ZB 5B0ZA 3AZIC 3X1VC 4X23B 5B1LC 4H9OB 4X23A 4KGCD 4H9OA 4ZBJB 3AZKB 3MVDC 3AZFB 1HQ3A 3AZFA 2YFWB 3WTPD 4WU8B 2VQRA 2YFWA 3W98D 3W99C 5GXQA 5B32C 5AV5B 5AV5A 3B0CW 1TZYC 3X1TD 5AV6D 1ID3D 3MGSB 4KHAB 3KXBC 1EQZC 3VH5W 3MGSA 4KHAA 3LJAC 3V9RB 1M19B 3UTAC 3AZHC 3V9RA 1M19A 5FUGB 1P3BC 3REKA 5FUGA 1P3MC 4XUJB 5DNMD 1A7WA 2Y2QA 5BNVB 4H9SA 3UT9D 4XUJA 4J8WD 5BNVA 5B2IA 5F99B 3O62D 5B31B 3B6FC 5CPJB 5F99A 5CPJA 4NE6A 2FJ7B 3W97B 3AN2C 2FJ7A 3C1BC 5CPIC 3KUYC 5B1MB 2CV5B 3LZ1C 4J8UC 5B1MA 5GT3D 1ZLAC 3A6ND 1JFIB 2J8PA 3X1VB 1JFIA 4LD9D 5GSUD 2Y2NA 2NZDD 3MVDB 1S32D 3MVDA 3MGQC 3MGRB 2IO5C 3MGRA 3AFAD 4ZUXC 3REIC 3W96C 3WA9A 3AV1B 1EQZB 5B31G 3KWQC 3AV1A 3LJAB 1N1JB 5CP6D 1P3LD 3UTAB 3AZHB 1N1JA 4HGAC 3UTAA 3AZHA 1H3OB 1P3BB 1P3MB 3AZGB 3TU4D 1P3KC 3X1UD 5B24C 3REJB 4J8VD 1BH8B 3AZGA 1KX3D 3REJA 1BH8A 3B6FB 1P3GC 3REHC 4J8XD 2JE5A 4M6BA 4WV4B 5CPKC 5JRGB 3AZED 3C1BB 3AN2B 5CPIB 5JRGA 3AN2A 5AY8B 3C1BA 5E5AA 4KUDC 5B2JD 5CPIA 3MNNC 5AY8A 3AYWC 1P3AB 4J8UB 1M18C 1P3AA 5AVBC 1Z2CB 3AZJA 2PYOD 3MGPB 2G5HC 5GT0B 4YS3D 3MGPA 2HIOD 5GT0A 3NQJB 3AZNC 5B40B 1S32A 3NQJA 2F8ND 1AOIB 4UUZB 5B40A 4QLCA 5B0ZC 2IO5B 2FFFB 4UUZA 4XZQC 1AOIA 5G49B 5G49A 3REIB 4DRAA 1HQ3C 3AZFC 2DQNC 4Z5TD 5GXQC 5BNXB 4CAYB 5CP6A 2ZY5A 5BNXA 4CAYA 4EO5B 2LY8A 2HUEC 2ZY2A 5AV5C 1P3KB 3B6GD 3AZLD 5AV9D 1P3GB 3REHB 3RELC 1M19C 1F66D 3EPLA 3REKC 5CPKB 1P3PC 2NQBD 5CPKA 3AZMB 4H9SC 1P3OD 3MNNB 3AZMA 3AYWB 5B2IC 1P34B 3AZKD 3H0MC 3EPHA 3AYWA 1P34A 5CPJC 4JJND 3LZ0D 5AVBB 3VH6W 4WU9C 4WU8D 1WWSA 1HTAA 2PYOA 2FJ7C 3AZNB 5AV8B 3UTBC 4H9NB 5AV8A 5B1MC 4H9NA 3B0CT 4YM6A 3C1CB 4XZQB 4WJ3C 3C1CA 4XZQA 1M1AA 3VH5T 2UWXA 4Z66D 2G5IC 2JSSA 1HQ3B 2AROB 3WAAA 4R8PB 2AROA 3MGRC 3IP4C 4R8PA 5GXQB 4G92B 3F6TA 5BS7A 5B31D 2HUEB 3LELD 3W97D 3WA9C 3AV1C 5KDMB 3RELB 2CV5D 5KDMA 1ULYA 5B0YA 3RELA 1P3PB 3REKB 1U35B 5JA4B 3AZID 3X1VD 1P3PA 5AVCB 1U35A 5JA4A 5DNMC 5B1LD 3AZGC 5AVCA 4WNNB 5B2IB 3X1SB 3REJC 4WNNA 3WKJD 3X1SA 4WU9B 4H9RB 4WU9A 4H9RA 3W99D 5JRGC 3AV2A 5E5AC 3UTBB 5B32D 5AY8C 3UTBA 1P3AC 1TZYD 3AZJC 3FDDA 3KXBD 1EQZD 4KGCB 3LJAD 3MGPC 4KGCA 2NZDC 5GT0C 1S32C 2Y2HA 2Y2LA 3WTPB 4AWLC 4QLCC 5B40C 2Y2KA 1P3BD 1AOIC 3WTPA 1P3MD 3W98B 3W98A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WWI A;  5BO0 B;  5BO0 A;  5AV6 B;  3X1T A;  1ID3 B;  3WA9 B;  5AV6 A;  1ID3 A;  3KUY D;  5CP6 C;  5B33 D;  3LZ1 D;  4J8U D;  1KU5 A;  4EO5 C;  1ZLA D;  1P3F D;  5DNM B;  3UT9 B;  1KX3 C;  5DNM A;  4J8W B;  3UT9 A;  4J8W A;  3O62 A;  4NE3 A;  3MGQ D;  3AZE C;  5E5A B;  3AZM C;  4ZUX D;  1P34 C;  3REI D;  3A6N B;  3AZJ B;  3W96 D;  5GT3 A;  3A6N A;  2PYO C;  4LD9 B;  5GSU B;  3KWQ D;  4LD9 A;  5GSU A;  2NZD B;  5C3I C;  5AV8 C;  1S32 B;  2NZD A;  4YM6 C;  4QLC B;  4AWL B;  3C1C C;  2YFV B;  1P3K D;  5B24 D;  1M1A C;  2YFV A;  3B0B A;  5DNN D;  3AFA A;  1P3G D;  3REH D;  3WAA C;  2ARO C;  4R8P C;  4KUD D;  1P3I D;  5CP6 B;  1P3L B;  5BS7 C;  3MNN D;  2RVQ D;  4G92 C;  1P3L A;  1KX4 D;  1M18 D;  3VH5 A;  2CWE A;  3VH6 T;  3TU4 B;  3B6G C;  3X1U B;  1KX3 B;  4J8V B;  3NQU B;  3TU4 A;  3X1U A;  1KX3 A;  4J8V A;  3NQU A;  4J8X B;  4E45 A;  1KX5 D;  1F66 C;  5B0Y C;  4J8X A;  5B0Z D;  5BT1 D;  3AZE B;  2NQB C;  4E44 A;  3AZE A;  1U35 C;  4X23 D;  5B2J B;  5AVC C;  5B2J A;  3X1S C;  2BYK B;  1HQ3 D;  2BYK A;  3AZF D;  1F1E A;  2PYO B;  4H9Q B;  4YS3 B;  3AV2 C;  4H9Q A;  5C3I B;  4YS3 A;  2HIO A;  2F8N B;  5AV5 D;  4YM6 B;  2F8N A;  2BYM B;  1M1A B;  2BYM A;  3MGS D;  4KGC C;  4Z66 C;  1M19 D;  3WAA B;  3REK D;  3WTP E;  3WTP C;  4Z5T B;  4Z5T A;  4CSR B;  1P3I A;  3W98 C;  4XUJ D;  4CSR A;  5B2I D;  5F99 D;  5CPJ D;  3LEL C;  3X1T C;  3B6G B;  5AV6 C;  1ID3 C;  3B6G A;  5AV9 B;  2FJ7 D;  3AZL A;  5AV9 A;  1KX5 A;  5B1M D;  1F66 B;  5B0Y B;  1F66 A;  1BH9 B;  2NQB B;  2F8N H;  1BH9 A;  2NQB A;  1P3O B;  2F8N G;  3UT9 C;  1P3O A;  4J8W C;  3WKJ C;  3O62 C;  3AZK A;  1BFM A;  4JJN B;  3LZ0 B;  3MVD D;  4WZS B;  4JJN A;  3LZ0 A;  4Z2M H;  3MGR D;  4WU8 A;  4Z2M G;  3AV2 B;  5CHL B;  5GT3 C;  3WA9 D;  3A6N C;  3AV1 D;  4LD9 C;  5GSU C;  4Z66 B;  3UTA D;  4Z66 A;  3AZH D;  3AZG D;  3REJ D;  3AFA C;  1B6W A;  5B31 A;  3B6F D;  3LEL B;  3X1T B;  3LEL A;  3W97 A;  4G91 C;  5JRG D;  3C1B D;  3AN2 D;  5E5A D;  5B33 C;  5CPI D;  5AY8 D;  1P3L C;  2CV5 A;  1P3A D;  1R4V A;  3AZI B;  3AZJ D;  1P3F C;  4DRB A;  3AZI A;  5B1L B;  3X1V A;  3TU4 C;  3X1U C;  5B1L A;  4J8V C;  3MGP D;  3WKJ B;  5GT0 D;  3O62 B;  3WKJ A;  4J8X C;  5B40 D;  4QLC D;  4H9P B;  1AOI D;  4NE5 A;  4H9P A;  3W99 B;  3W99 A;  5B32 B;  3VH6 A;  5B2J C;  5B32 A;  2F8N K;  1TZY B;  1TZY A;  5GT3 B;  3KXB B;  3KXB A;  1EQZ A;  3LJA A;  4YS3 C;  2HIO C;  1H3O A;  1P3B A;  1P3M A;  5DNN C;  3AFA B;  3B6F A;  3KSY A;  3B0D C;  5CPK D;  3KUY B;  4G91 B;  4Z5T C;  1P3I C;  5B33 B;  3KUY A;  3AZM D;  2RVQ C;  3LZ1 B;  1KX4 C;  5B33 A;  3LZ1 A;  3AYW D;  4J8U A;  1P34 D;  1ZLA B;  1P3F B;  1ZLA A;  5B32 G;  5AVB D;  1P3F A;  3AZL C;  5AV9 C;  3AZN D;  5AV8 D;  1KX5 C;  4YM6 D;  3MGQ B;  5BT1 C;  3MGQ A;  3C1C D;  4XZQ D;  1M1A D;  4X23 C;  1P3O C;  4ZUX B;  4ZBJ C;  3AZK C;  4ZUX A;  1TAF B;  3REI A;  3W96 B;  4JJN C;  3WAA D;  1TAF A;  3LZ0 C;  3W96 A;  2ARO D;  3KWQ B;  4WU8 C;  4R8P D;  1B67 A;  3KWQ A;  5GXQ D;  4HGA B;  2HIO B;  3R45 B;  5B24 B;  3MGS C;  1P3K A;  3R45 A;  5DNN B;  5B24 A;  5DNN A;  4NFT A;  1P3G A;  3REH A;  5B0Y D;  3REL D;  3B0D B;  2L5A A;  1P3P D;  1U35 D;  4KUD B;  1P3I B;  5AVC D;  4XUJ C;  4KUD A;  1KX4 B;  3MNN A;  1M18 B;  1Q9C A;  5F99 C;  3X1S D;  1KX4 A;  5B31 C;  1M18 A;  5AVB A;  4WU9 D;  3W97 C;  3AZL B;  3AV2 D;  3AZN A;  1KX5 B;  3UTB D;  2CV5 C;  5B0Z B;  5B0Z A;  3AZI C;  3X1V C;  4X23 B;  5B1L C;  4H9O B;  4X23 A;  4KGC D;  4H9O A;  4ZBJ B;  3AZK B;  3MVD C;  3AZF B;  1HQ3 A;  3AZF A;  2YFW B;  3WTP D;  4WU8 B;  2YFW A;  3W98 D;  3W99 C;  5GXQ A;  5B32 C;  5AV5 B;  5AV5 A;  3B0C W;  1TZY C;  3X1T D;  5AV6 D;  1ID3 D;  3MGS B;  4KHA B;  3KXB C;  1EQZ C;  3VH5 W;  3MGS A;  4KHA A;  3LJA C;  3V9R B;  1M19 B;  3UTA C;  3AZH C;  3V9R A;  1M19 A;  5FUG B;  1P3B C;  3REK A;  5FUG A;  1P3M C;  4XUJ B;  5DNM D;  1A7W A;  5BNV B;  3UT9 D;  4H9S A;  4XUJ A;  4J8W D;  5BNV A;  5B2I A;  5F99 B;  3O62 D;  5B31 B;  3B6F C;  5CPJ B;  5F99 A;  5CPJ A;  4NE6 A;  2FJ7 B;  3W97 B;  3AN2 C;  2FJ7 A;  3C1B C;  5CPI C;  3KUY C;  5B1M B;  2CV5 B;  3LZ1 C;  4J8U C;  5B1M A;  5GT3 D;  1ZLA C;  3A6N D;  1JFI B;  3X1V B;  1JFI A;  4LD9 D;  5GSU D;  2NZD D;  3MVD B;  1S32 D;  3MVD A;  3MGQ C;  3MGR B;  2IO5 C;  3MGR A;  3AFA D;  4ZUX C;  3REI C;  3W96 C;  3WA9 A;  3AV1 B;  1EQZ B;  5B31 G;  3KWQ C;  3AV1 A;  3LJA B;  1N1J B;  5CP6 D;  1P3L D;  3UTA B;  3AZH B;  1N1J A;  4HGA C;  3UTA A;  3AZH A;  1H3O B;  1P3B B;  1P3M B;  3AZG B;  3TU4 D;  1P3K C;  3X1U D;  5B24 C;  3REJ B;  4J8V D;  1BH8 B;  3AZG A;  1KX3 D;  3REJ A;  1BH8 A;  3B6F B;  1P3G C;  3REH C;  4J8X D;  4M6B A;  4WV4 B;  5CPK C;  5JRG B;  3AZE D;  3C1B B;  3AN2 B;  5CPI B;  5JRG A;  3AN2 A;  5AY8 B;  3C1B A;  5E5A A;  4KUD C;  5B2J D;  5CPI A;  3MNN C;  5AY8 A;  3AYW C;  1P3A B;  4J8U B;  1M18 C;  1P3A A;  5AVB C;  3AZJ A;  2PYO D;  3MGP B;  5GT0 B;  4YS3 D;  3MGP A;  2HIO D;  5GT0 A;  3NQJ B;  3AZN C;  5B40 B;  1S32 A;  3NQJ A;  2F8N D;  1AOI B;  4UUZ B;  5B40 A;  4QLC A;  5B0Z C;  2IO5 B;  4XZQ C;  4UUZ A;  1AOI A;  5G49 B;  5G49 A;  3REI B;  4DRA A;  1HQ3 C;  3AZF C;  4Z5T D;  5GXQ C;  5BNX B;  4CAY B;  5CP6 A;  5BNX A;  4CAY A;  4EO5 B;  2LY8 A;  2HUE C;  5AV5 C;  1P3K B;  3B6G D;  3AZL D;  5AV9 D;  1P3G B;  3REH B;  3REL C;  1M19 C;  1F66 D;  5CPK B;  3REK C;  1P3P C;  2NQB D;  5CPK A;  3AZM B;  4H9S C;  1P3O D;  3MNN B;  3AZM A;  3AYW B;  5B2I C;  1P34 B;  3AZK D;  3AYW A;  1P34 A;  5CPJ C;  4JJN D;  3LZ0 D;  5AVB B;  3VH6 W;  4WU9 C;  4WU8 D;  1WWS A;  1HTA A;  2PYO A;  2FJ7 C;  3AZN B;  5AV8 B;  3UTB C;  4H9N B;  5AV8 A;  5B1M C;  4H9N A;  3B0C T;  4YM6 A;  3C1C B;  4XZQ B;  3C1C A;  4XZQ A;  1M1A A;  3VH5 T;  4Z66 D;  2JSS A;  1HQ3 B;  2ARO B;  3WAA A;  4R8P B;  2ARO A;  3MGR C;  4R8P A;  5GXQ B;  4G92 B;  5BS7 A;  5B31 D;  2HUE B;  3LEL D;  3W97 D;  3WA9 C;  3AV1 C;  5KDM B;  3REL B;  2CV5 D;  5KDM A;  1ULY A;  5B0Y A;  3REL A;  1P3P B;  3REK B;  1U35 B;  5JA4 B;  3AZI D;  3X1V D;  1P3P A;  5AVC B;  1U35 A;  5JA4 A;  5DNM C;  5B1L D;  3AZG C;  5AVC A;  4WNN B;  5B2I B;  3X1S B;  3REJ C;  4WNN A;  3WKJ D;  3X1S A;  4WU9 B;  4H9R B;  4WU9 A;  4H9R A;  3W99 D;  5JRG C;  3AV2 A;  5E5A C;  3UTB B;  5B32 D;  5AY8 C;  3UTB A;  1P3A C;  1TZY D;  3AZJ C;  3KXB D;  1EQZ D;  4KGC B;  3LJA D;  3MGP C;  4KGC A;  2NZD C;  5GT0 C;  1S32 C;  3WTP B;  4AWL C;  4QLC C;  5B40 C;  1P3B D;  1AOI C;  3WTP A;  1P3M D;  3W98 B;  3W98 A; 
#chains in the Genus database with same CATH topology
 1WWI A;  2Y2O A;  5BO0 B;  5BO0 A;  5AV6 B;  3X1T A;  1ID3 B;  3WA9 B;  5AV6 A;  1ID3 A;  3KUY D;  5CP6 C;  5B33 D;  3LZ1 D;  4J8U D;  1KU5 A;  4EO5 C;  4UPK A;  1ZLA D;  1P3F D;  5DNM B;  3UT9 B;  1KX3 C;  5DNM A;  4J8W B;  3UT9 A;  3EPJ A;  4J8W A;  3O62 A;  4NE3 A;  3MGQ D;  3AZE C;  5E5A B;  3AZM C;  4ZUX D;  1P34 C;  3REI D;  3A6N B;  3AZJ B;  3W96 D;  5GT3 A;  3A6N A;  2PYO C;  4LD9 B;  5GSU B;  3KWQ D;  4LD9 A;  3EG5 B;  5GSU A;  2NZD B;  5C3I C;  5AV8 C;  1S32 B;  2NZD A;  4YM6 C;  4QLC B;  4AWL B;  3C1C C;  2YFV B;  1P3K D;  5B24 D;  1M1A C;  2YFV A;  3B0B A;  5DNN D;  3AFA A;  1P3G D;  3REH D;  3WAA C;  2ARO C;  4R8P C;  4KUD D;  1P3I D;  5CP6 B;  1P3L B;  5BS7 C;  3MNN D;  2RVQ D;  4G92 C;  1P3L A;  1KX4 D;  2Y2G A;  1M18 D;  3VH5 A;  2CWE A;  3VH6 T;  3TU4 B;  3B6G C;  3X1U B;  1KX3 B;  4J8V B;  3NQU B;  3TU4 A;  3X1U A;  1KX3 A;  4J8V A;  3NQU A;  1W2E A;  4J8X B;  4E45 A;  1KX5 D;  1F66 C;  5B0Y C;  4J8X A;  5B0Z D;  5BT1 D;  3AZE B;  2NQB C;  4E44 A;  3AZE A;  1U35 C;  4X23 D;  5B2J B;  5AVC C;  5B2J A;  3X1S C;  2BYK B;  1HQ3 D;  2BYK A;  3AZF D;  3AL0 C;  1F1E A;  2ZY4 A;  2PYO B;  4H9Q B;  2Y2P A;  4YS3 B;  3AV2 C;  4H9Q A;  5C3I B;  4YS3 A;  2HIO A;  2F8N B;  5AV5 D;  2Y2M A;  4YM6 B;  2F8N A;  2BYM B;  1M1A B;  2BYM A;  3MGS D;  4KGC C;  4Z66 C;  1M19 D;  2ZY3 A;  3WAA B;  3A1K A;  3WTP E;  3WTP C;  4Z5T B;  3REK D;  4Z5T A;  4CSR B;  4DQY B;  1P3I A;  3W98 C;  4XUJ D;  4CSR A;  5B2I D;  5F99 D;  5CPJ D;  3LEL C;  3X1T C;  3B6G B;  5AV6 C;  1ID3 C;  3B6G A;  5AV9 B;  2FJ7 D;  3AZL A;  5AV9 A;  1KX5 A;  5B1M D;  1F66 B;  5B0Y B;  1F66 A;  1BH9 B;  2NQB B;  2F8N H;  1BH9 A;  3EPK A;  2NQB A;  1P3O B;  2F8N G;  3UT9 C;  1P3O A;  4J8W C;  3WKJ C;  3O62 C;  3AZK A;  1BFM A;  4JJN B;  3LZ0 B;  3MVD D;  4WZS B;  4JJN A;  3LZ0 A;  4Z2M H;  3MGR D;  4WU8 A;  4Z2M G;  3AV2 B;  5CHL B;  5GT3 C;  3WA9 D;  3A6N C;  3AV1 D;  4LD9 C;  5GSU C;  4Z66 B;  2DF4 C;  3UTA D;  4Z66 A;  2ZM5 A;  3AZH D;  3AZG D;  3REJ D;  3AFA C;  1B6W A;  5B31 A;  3B6F D;  3LEL B;  3X1T B;  3LEL A;  3W97 A;  4G91 C;  5JRG D;  3C1B D;  3AN2 D;  5E5A D;  5B33 C;  5CPI D;  5AY8 D;  1P3L C;  2CV5 A;  1P3A D;  1R4V A;  3AZI B;  3AZJ D;  1P3F C;  4DRB A;  3AZI A;  5B1L B;  3X1V A;  3TU4 C;  3X1U C;  5B1L A;  1PZR A;  4J8V C;  3MGP D;  3WKJ B;  5GT0 D;  3O62 B;  3WKJ A;  4J8X C;  5B40 D;  4QLC D;  2F2A C;  4H9P B;  1AOI D;  4NE5 A;  4H9P A;  3W99 B;  3KFU G;  3W99 A;  5B32 B;  3VH6 A;  5B2J C;  5B32 A;  2F8N K;  2BG1 A;  1TZY B;  3H0R C;  1TZY A;  5GT3 B;  3KXB B;  3KXB A;  1EQZ A;  2Y2J A;  3LJA A;  4YS3 C;  2HIO C;  1H3O A;  1P3B A;  1P3M A;  5DNN C;  3AFA B;  3B6F A;  3KSY A;  3B0D C;  5CPK D;  3KUY B;  4G91 B;  4Z5T C;  1P3I C;  5B33 B;  3KUY A;  3AZM D;  2RVQ C;  3LZ1 B;  1KX4 C;  5B33 A;  3LZ1 A;  3AYW D;  4J8U A;  1P34 D;  2RIQ A;  1ZLA B;  1P3F B;  1ZLA A;  5B32 G;  5AVB D;  1P3F A;  3AZL C;  5AV9 C;  3AZN D;  5AV8 D;  1KX5 C;  4YM6 D;  3MGQ B;  5BT1 C;  3MGQ A;  2XD1 A;  4XZQ D;  3C1C D;  1M1A D;  4X23 C;  2Y2I A;  1P3O C;  4ZUX B;  4ZBJ C;  3AZK C;  4ZUX A;  1TAF B;  2XD5 A;  3REI A;  3W96 B;  4JJN C;  3WAA D;  1TAF A;  3LZ0 C;  3W96 A;  2ARO D;  3KWQ B;  4WU8 C;  1T3U A;  4R8P D;  1B67 A;  3KWQ A;  5GXQ D;  4HGA B;  2HIO B;  3R45 B;  2JCH A;  5B24 B;  3MGS C;  1P3K A;  3R45 A;  5DNN B;  5B24 A;  5DNN A;  4NFT A;  1P3G A;  3REH A;  5B0Y D;  3REL D;  3H0L C;  3A1I A;  3B0D B;  3P5J B;  2L5A A;  1P3P D;  1U35 D;  4KUD B;  1P3I B;  5AVC D;  4XUJ C;  4KUD A;  1KX4 B;  3MNN A;  1M18 B;  1Q9C A;  5F99 C;  3X1S D;  1KX4 A;  5B31 C;  1M18 A;  5AVB A;  4WU9 D;  3W97 C;  3AZL B;  3AV2 D;  3AZN A;  1KX5 B;  3UTB D;  2CV5 C;  2W8S A;  5B0Z B;  5B0Z A;  3AZI C;  3X1V C;  4X23 B;  5B1L C;  4H9O B;  4X23 A;  4KGC D;  4H9O A;  4ZBJ B;  3AZK B;  3MVD C;  3AZF B;  1HQ3 A;  3AZF A;  2YFW B;  3WTP D;  4WU8 B;  2VQR A;  2YFW A;  3W98 D;  3W99 C;  5GXQ A;  5B32 C;  5AV5 B;  5AV5 A;  3B0C W;  1TZY C;  3X1T D;  5AV6 D;  1ID3 D;  3MGS B;  4KHA B;  3KXB C;  1EQZ C;  3VH5 W;  3MGS A;  4KHA A;  3LJA C;  3V9R B;  1M19 B;  3UTA C;  3AZH C;  3V9R A;  1M19 A;  5FUG B;  1P3B C;  3REK A;  5FUG A;  1P3M C;  4XUJ B;  5DNM D;  1A7W A;  2Y2Q A;  5BNV B;  4H9S A;  3UT9 D;  4XUJ A;  4J8W D;  5BNV A;  5B2I A;  5F99 B;  3O62 D;  5B31 B;  3B6F C;  5CPJ B;  5F99 A;  5CPJ A;  4NE6 A;  2FJ7 B;  3W97 B;  3AN2 C;  2FJ7 A;  3C1B C;  5CPI C;  3KUY C;  5B1M B;  2CV5 B;  3LZ1 C;  4J8U C;  5B1M A;  5GT3 D;  1ZLA C;  3A6N D;  1JFI B;  2J8P A;  3X1V B;  1JFI A;  4LD9 D;  5GSU D;  2Y2N A;  2NZD D;  3MVD B;  1S32 D;  3MVD A;  3MGQ C;  3MGR B;  2IO5 C;  3MGR A;  3AFA D;  4ZUX C;  3REI C;  3W96 C;  3WA9 A;  3AV1 B;  1EQZ B;  5B31 G;  3KWQ C;  3AV1 A;  3LJA B;  1N1J B;  5CP6 D;  1P3L D;  3UTA B;  3AZH B;  1N1J A;  4HGA C;  3UTA A;  3AZH A;  1H3O B;  1P3B B;  1P3M B;  3AZG B;  3TU4 D;  1P3K C;  3X1U D;  5B24 C;  3REJ B;  4J8V D;  1BH8 B;  3AZG A;  1KX3 D;  3REJ A;  1BH8 A;  3B6F B;  1P3G C;  3REH C;  4J8X D;  2JE5 A;  4M6B A;  4WV4 B;  5CPK C;  5JRG B;  3AZE D;  3C1B B;  3AN2 B;  5CPI B;  5JRG A;  3AN2 A;  5AY8 B;  3C1B A;  5E5A A;  4KUD C;  5B2J D;  5CPI A;  3MNN C;  5AY8 A;  3AYW C;  1P3A B;  4J8U B;  1M18 C;  1P3A A;  5AVB C;  1Z2C B;  3AZJ A;  2PYO D;  3MGP B;  2G5H C;  5GT0 B;  4YS3 D;  3MGP A;  2HIO D;  5GT0 A;  3NQJ B;  3AZN C;  5B40 B;  1S32 A;  3NQJ A;  2F8N D;  1AOI B;  4UUZ B;  5B40 A;  4QLC A;  5B0Z C;  2IO5 B;  2FFF B;  4UUZ A;  4XZQ C;  1AOI A;  5G49 B;  5G49 A;  3REI B;  4DRA A;  1HQ3 C;  3AZF C;  2DQN C;  4Z5T D;  5GXQ C;  5BNX B;  4CAY B;  5CP6 A;  2ZY5 A;  5BNX A;  4CAY A;  4EO5 B;  2LY8 A;  2HUE C;  2ZY2 A;  5AV5 C;  1P3K B;  3B6G D;  3AZL D;  5AV9 D;  1P3G B;  3REH B;  3REL C;  1M19 C;  1F66 D;  3EPL A;  3REK C;  5CPK B;  1P3P C;  2NQB D;  5CPK A;  3AZM B;  4H9S C;  1P3O D;  3MNN B;  3AZM A;  3AYW B;  5B2I C;  1P34 B;  3AZK D;  3H0M C;  3EPH A;  3AYW A;  1P34 A;  5CPJ C;  4JJN D;  3LZ0 D;  5AVB B;  3VH6 W;  4WU9 C;  4WU8 D;  1WWS A;  1HTA A;  2PYO A;  2FJ7 C;  3AZN B;  5AV8 B;  3UTB C;  4H9N B;  5AV8 A;  5B1M C;  4H9N A;  3B0C T;  4YM6 A;  3C1C B;  4XZQ B;  4WJ3 C;  3C1C A;  4XZQ A;  1M1A A;  3VH5 T;  2UWX A;  4Z66 D;  2G5I C;  2JSS A;  1HQ3 B;  2ARO B;  3WAA A;  4R8P B;  2ARO A;  3MGR C;  3IP4 C;  4R8P A;  5GXQ B;  4G92 B;  3F6T A;  5BS7 A;  5B31 D;  2HUE B;  3LEL D;  3W97 D;  3WA9 C;  3AV1 C;  5KDM B;  3REL B;  2CV5 D;  5KDM A;  1ULY A;  5B0Y A;  3REL A;  1P3P B;  3REK B;  1U35 B;  5JA4 B;  3AZI D;  3X1V D;  1P3P A;  5AVC B;  1U35 A;  5JA4 A;  5DNM C;  5B1L D;  3AZG C;  5AVC A;  4WNN B;  5B2I B;  3X1S B;  3REJ C;  4WNN A;  3WKJ D;  3X1S A;  4WU9 B;  4H9R B;  4WU9 A;  4H9R A;  3W99 D;  5JRG C;  3AV2 A;  5E5A C;  3UTB B;  5B32 D;  5AY8 C;  3UTB A;  1P3A C;  1TZY D;  3AZJ C;  3FDD A;  3KXB D;  1EQZ D;  4KGC B;  3LJA D;  3MGP C;  4KGC A;  2NZD C;  5GT0 C;  1S32 C;  2Y2H A;  2Y2L A;  3WTP B;  4AWL C;  4QLC C;  5B40 C;  2Y2K A;  1P3B D;  1AOI C;  3WTP A;  1P3M D;  3W98 B;  3W98 A; 
#chains in the Genus database with same CATH homology
 1WWI A;  2Y2O A;  5BO0 B;  5BO0 A;  5AV6 B;  3X1T A;  1ID3 B;  3WA9 B;  5AV6 A;  1ID3 A;  3KUY D;  5CP6 C;  5B33 D;  3LZ1 D;  4J8U D;  1KU5 A;  4EO5 C;  4UPK A;  1ZLA D;  1P3F D;  5DNM B;  3UT9 B;  1KX3 C;  5DNM A;  4J8W B;  3UT9 A;  3EPJ A;  4J8W A;  3O62 A;  4NE3 A;  3MGQ D;  3AZE C;  5E5A B;  3AZM C;  4ZUX D;  1P34 C;  3REI D;  3A6N B;  3AZJ B;  3W96 D;  5GT3 A;  3A6N A;  2PYO C;  4LD9 B;  5GSU B;  3KWQ D;  4LD9 A;  3EG5 B;  5GSU A;  2NZD B;  5C3I C;  5AV8 C;  1S32 B;  2NZD A;  4YM6 C;  4QLC B;  4AWL B;  3C1C C;  2YFV B;  1P3K D;  5B24 D;  1M1A C;  2YFV A;  3B0B A;  5DNN D;  3AFA A;  1P3G D;  3REH D;  3WAA C;  2ARO C;  4R8P C;  4KUD D;  1P3I D;  5CP6 B;  1P3L B;  5BS7 C;  3MNN D;  2RVQ D;  4G92 C;  1P3L A;  1KX4 D;  2Y2G A;  1M18 D;  3VH5 A;  2CWE A;  3VH6 T;  3TU4 B;  3B6G C;  3X1U B;  1KX3 B;  4J8V B;  3NQU B;  3TU4 A;  3X1U A;  1KX3 A;  4J8V A;  3NQU A;  1W2E A;  4J8X B;  4E45 A;  1KX5 D;  1F66 C;  5B0Y C;  4J8X A;  5B0Z D;  5BT1 D;  3AZE B;  2NQB C;  4E44 A;  3AZE A;  1U35 C;  4X23 D;  5B2J B;  5AVC C;  5B2J A;  3X1S C;  2BYK B;  1HQ3 D;  2BYK A;  3AZF D;  3AL0 C;  1F1E A;  2ZY4 A;  2PYO B;  4H9Q B;  2Y2P A;  4YS3 B;  3AV2 C;  4H9Q A;  5C3I B;  4YS3 A;  2HIO A;  2F8N B;  5AV5 D;  2Y2M A;  4YM6 B;  2F8N A;  2BYM B;  1M1A B;  2BYM A;  3MGS D;  4KGC C;  4Z66 C;  1M19 D;  2ZY3 A;  3WAA B;  3A1K A;  3WTP E;  3WTP C;  4Z5T B;  3REK D;  4Z5T A;  4CSR B;  4DQY B;  1P3I A;  3W98 C;  4XUJ D;  4CSR A;  5B2I D;  5F99 D;  5CPJ D;  3LEL C;  3X1T C;  3B6G B;  5AV6 C;  1ID3 C;  3B6G A;  5AV9 B;  2FJ7 D;  3AZL A;  5AV9 A;  1KX5 A;  5B1M D;  1F66 B;  5B0Y B;  1F66 A;  1BH9 B;  2NQB B;  2F8N H;  1BH9 A;  3EPK A;  2NQB A;  1P3O B;  2F8N G;  3UT9 C;  1P3O A;  4J8W C;  3WKJ C;  3O62 C;  3AZK A;  1BFM A;  4JJN B;  3LZ0 B;  3MVD D;  4WZS B;  4JJN A;  3LZ0 A;  4Z2M H;  3MGR D;  4WU8 A;  4Z2M G;  3AV2 B;  5CHL B;  5GT3 C;  3WA9 D;  3A6N C;  3AV1 D;  4LD9 C;  5GSU C;  4Z66 B;  2DF4 C;  3UTA D;  4Z66 A;  2ZM5 A;  3AZH D;  3AZG D;  3REJ D;  3AFA C;  1B6W A;  5B31 A;  3B6F D;  3LEL B;  3X1T B;  3LEL A;  3W97 A;  4G91 C;  5JRG D;  3C1B D;  3AN2 D;  5E5A D;  5B33 C;  5CPI D;  5AY8 D;  1P3L C;  2CV5 A;  1P3A D;  1R4V A;  3AZI B;  3AZJ D;  1P3F C;  4DRB A;  3AZI A;  5B1L B;  3X1V A;  3TU4 C;  3X1U C;  5B1L A;  1PZR A;  4J8V C;  3MGP D;  3WKJ B;  5GT0 D;  3O62 B;  3WKJ A;  4J8X C;  5B40 D;  4QLC D;  2F2A C;  4H9P B;  1AOI D;  4NE5 A;  4H9P A;  3W99 B;  3KFU G;  3W99 A;  5B32 B;  3VH6 A;  5B2J C;  5B32 A;  2F8N K;  2BG1 A;  1TZY B;  3H0R C;  1TZY A;  5GT3 B;  3KXB B;  3KXB A;  1EQZ A;  2Y2J A;  3LJA A;  4YS3 C;  2HIO C;  1H3O A;  1P3B A;  1P3M A;  5DNN C;  3AFA B;  3B6F A;  3KSY A;  3B0D C;  5CPK D;  3KUY B;  4G91 B;  4Z5T C;  1P3I C;  5B33 B;  3KUY A;  3AZM D;  2RVQ C;  3LZ1 B;  1KX4 C;  5B33 A;  3LZ1 A;  3AYW D;  4J8U A;  1P34 D;  2RIQ A;  1ZLA B;  1P3F B;  1ZLA A;  5B32 G;  5AVB D;  1P3F A;  3AZL C;  5AV9 C;  3AZN D;  5AV8 D;  1KX5 C;  4YM6 D;  3MGQ B;  5BT1 C;  3MGQ A;  2XD1 A;  4XZQ D;  3C1C D;  1M1A D;  4X23 C;  2Y2I A;  1P3O C;  4ZUX B;  4ZBJ C;  3AZK C;  4ZUX A;  1TAF B;  2XD5 A;  3REI A;  3W96 B;  4JJN C;  3WAA D;  1TAF A;  3LZ0 C;  3W96 A;  2ARO D;  3KWQ B;  4WU8 C;  1T3U A;  4R8P D;  1B67 A;  3KWQ A;  5GXQ D;  4HGA B;  2HIO B;  3R45 B;  2JCH A;  5B24 B;  3MGS C;  1P3K A;  3R45 A;  5DNN B;  5B24 A;  5DNN A;  4NFT A;  1P3G A;  3REH A;  5B0Y D;  3REL D;  3H0L C;  3A1I A;  3B0D B;  3P5J B;  2L5A A;  1P3P D;  1U35 D;  4KUD B;  1P3I B;  5AVC D;  4XUJ C;  4KUD A;  1KX4 B;  3MNN A;  1M18 B;  1Q9C A;  5F99 C;  3X1S D;  1KX4 A;  5B31 C;  1M18 A;  5AVB A;  4WU9 D;  3W97 C;  3AZL B;  3AV2 D;  3AZN A;  1KX5 B;  3UTB D;  2CV5 C;  2W8S A;  5B0Z B;  5B0Z A;  3AZI C;  3X1V C;  4X23 B;  5B1L C;  4H9O B;  4X23 A;  4KGC D;  4H9O A;  4ZBJ B;  3AZK B;  3MVD C;  3AZF B;  1HQ3 A;  3AZF A;  2YFW B;  3WTP D;  4WU8 B;  2VQR A;  2YFW A;  3W98 D;  3W99 C;  5GXQ A;  5B32 C;  5AV5 B;  5AV5 A;  3B0C W;  1TZY C;  3X1T D;  5AV6 D;  1ID3 D;  3MGS B;  4KHA B;  3KXB C;  1EQZ C;  3VH5 W;  3MGS A;  4KHA A;  3LJA C;  3V9R B;  1M19 B;  3UTA C;  3AZH C;  3V9R A;  1M19 A;  5FUG B;  1P3B C;  3REK A;  5FUG A;  1P3M C;  4XUJ B;  5DNM D;  1A7W A;  2Y2Q A;  5BNV B;  4H9S A;  3UT9 D;  4XUJ A;  4J8W D;  5BNV A;  5B2I A;  5F99 B;  3O62 D;  5B31 B;  3B6F C;  5CPJ B;  5F99 A;  5CPJ A;  4NE6 A;  2FJ7 B;  3W97 B;  3AN2 C;  2FJ7 A;  3C1B C;  5CPI C;  3KUY C;  5B1M B;  2CV5 B;  3LZ1 C;  4J8U C;  5B1M A;  5GT3 D;  1ZLA C;  3A6N D;  1JFI B;  2J8P A;  3X1V B;  1JFI A;  4LD9 D;  5GSU D;  2Y2N A;  2NZD D;  3MVD B;  1S32 D;  3MVD A;  3MGQ C;  3MGR B;  2IO5 C;  3MGR A;  3AFA D;  4ZUX C;  3REI C;  3W96 C;  3WA9 A;  3AV1 B;  1EQZ B;  5B31 G;  3KWQ C;  3AV1 A;  3LJA B;  1N1J B;  5CP6 D;  1P3L D;  3UTA B;  3AZH B;  1N1J A;  4HGA C;  3UTA A;  3AZH A;  1H3O B;  1P3B B;  1P3M B;  3AZG B;  3TU4 D;  1P3K C;  3X1U D;  5B24 C;  3REJ B;  4J8V D;  1BH8 B;  3AZG A;  1KX3 D;  3REJ A;  1BH8 A;  3B6F B;  1P3G C;  3REH C;  4J8X D;  2JE5 A;  4M6B A;  4WV4 B;  5CPK C;  5JRG B;  3AZE D;  3C1B B;  3AN2 B;  5CPI B;  5JRG A;  3AN2 A;  5AY8 B;  3C1B A;  5E5A A;  4KUD C;  5B2J D;  5CPI A;  3MNN C;  5AY8 A;  3AYW C;  1P3A B;  4J8U B;  1M18 C;  1P3A A;  5AVB C;  1Z2C B;  3AZJ A;  2PYO D;  3MGP B;  2G5H C;  5GT0 B;  4YS3 D;  3MGP A;  2HIO D;  5GT0 A;  3NQJ B;  3AZN C;  5B40 B;  1S32 A;  3NQJ A;  2F8N D;  1AOI B;  4UUZ B;  5B40 A;  4QLC A;  5B0Z C;  2IO5 B;  2FFF B;  4UUZ A;  4XZQ C;  1AOI A;  5G49 B;  5G49 A;  3REI B;  4DRA A;  1HQ3 C;  3AZF C;  2DQN C;  4Z5T D;  5GXQ C;  5BNX B;  4CAY B;  5CP6 A;  2ZY5 A;  5BNX A;  4CAY A;  4EO5 B;  2LY8 A;  2HUE C;  2ZY2 A;  5AV5 C;  1P3K B;  3B6G D;  3AZL D;  5AV9 D;  1P3G B;  3REH B;  3REL C;  1M19 C;  1F66 D;  3EPL A;  3REK C;  5CPK B;  1P3P C;  2NQB D;  5CPK A;  3AZM B;  4H9S C;  1P3O D;  3MNN B;  3AZM A;  3AYW B;  5B2I C;  1P34 B;  3AZK D;  3H0M C;  3EPH A;  3AYW A;  1P34 A;  5CPJ C;  4JJN D;  3LZ0 D;  5AVB B;  3VH6 W;  4WU9 C;  4WU8 D;  1WWS A;  1HTA A;  2PYO A;  2FJ7 C;  3AZN B;  5AV8 B;  3UTB C;  4H9N B;  5AV8 A;  5B1M C;  4H9N A;  3B0C T;  4YM6 A;  3C1C B;  4XZQ B;  4WJ3 C;  3C1C A;  4XZQ A;  1M1A A;  3VH5 T;  2UWX A;  4Z66 D;  2G5I C;  2JSS A;  1HQ3 B;  2ARO B;  3WAA A;  4R8P B;  2ARO A;  3MGR C;  3IP4 C;  4R8P A;  5GXQ B;  4G92 B;  3F6T A;  5BS7 A;  5B31 D;  2HUE B;  3LEL D;  3W97 D;  3WA9 C;  3AV1 C;  5KDM B;  3REL B;  2CV5 D;  5KDM A;  1ULY A;  5B0Y A;  3REL A;  1P3P B;  3REK B;  1U35 B;  5JA4 B;  3AZI D;  3X1V D;  1P3P A;  5AVC B;  1U35 A;  5JA4 A;  5DNM C;  5B1L D;  3AZG C;  5AVC A;  4WNN B;  5B2I B;  3X1S B;  3REJ C;  4WNN A;  3WKJ D;  3X1S A;  4WU9 B;  4H9R B;  4WU9 A;  4H9R A;  3W99 D;  5JRG C;  3AV2 A;  5E5A C;  3UTB B;  5B32 D;  5AY8 C;  3UTB A;  1P3A C;  1TZY D;  3AZJ C;  3FDD A;  3KXB D;  1EQZ D;  4KGC B;  3LJA D;  3MGP C;  4KGC A;  2NZD C;  5GT0 C;  1S32 C;  2Y2H A;  2Y2L A;  3WTP B;  4AWL C;  4QLC C;  5B40 C;  2Y2K A;  1P3B D;  1AOI C;  3WTP A;  1P3M D;  3W98 B;  3W98 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...