3AFAD

The human nucleosome structure
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
96
structure length
96
Chain Sequence
KRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of instability of the nucleosome containing a testis-specific histone variant, human H3T
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
molecule keywords Histone H3.1
total genus 37
structure length 96
sequence length 96
chains with identical sequence H
ec nomenclature
pdb deposition date 2010-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3afaD00
3AV2D 4WU9C 1P3LC 3MVDD 5B1LD 3X1UD 5CP6D 5AV8A 5CPJC 4Z66A 3LZ1D 3AV2A 3WKJA 3LELD 5B24B 1P34A 1WWIA 5GXQA 2FJ7A 5B2IB 3W99C 2NZDA 5GSUB 5JRGB 1KX4B 3MVDB 3AZMA 3AZJB 1TZYB 4ZBJC 3AZIA 4X23A 3B6GB 3WA9B 4H9PB 5G49A 3A6NB 3REKB 5BNXA 2F8NA 4KUDA 4J8WD 4YM6A 4LD9B 5AV8C 4X23B 4Z66C 3B6GA 4Z66D 5B0YB 1AOIA 1M1AB 4H9NA 1N1JB 5AVCD 2FJ7C 1ID3B 3C1CC 4KGCB 1P3FA 3KUYC 3X1SD 5AV6C 1M1AC 5AV6D 3AZIC 4X23C 5CPIB 1S32B 1HTAA 4LD9C 4YM6C 3A6NC 3MGQB 3AV1A 1P3BB 3MGRB 3B6GC 3AN2D 4H9OB 4YS3A 1H3OA 1P3FC 3MGPA 1EQZB 5CPIC 5CPJB 3VH5A 5B33B 3KUYB 2PYOC 5FUGA 3AZKA 4YS3C 5BT1D 3AZMD 4XZQC 1M18A 3MGPC 3NQUB 5F99B 3REKC 3LJAB 3WKJB 5CPIA 1P34B 3AZJC 3C1BD 5BO0A 2AROA 1TAFA 3W96C 1U35B 3C1BA 2HIOC 2AROB 1P3AA 5DNMD 1P3KB 5B31B 5CPKB 3AZHA 4XZQA 1M18C 5KDMB 1M18D 1P3MB 3O62C 5BS7C 1U35A 1B67A 2BYMA 3LZ0A 4G91B 3AN2B 5AVCA 4WU8A 3NQJB 1F66C 5B31D 5CPKD 2AROC 3AZNB 4Z5TA 3X1TC 3AN2A 4XUJD 5B0ZA 3UTAC 3C1BC 3RELD 1P3AC 5CHLB 3V9RB 1BFMA 3AZHC 1P3GC 1ID3D 3LZ0C 5F99D 5BNVB 4J8VD 3VH6T 4J8XA 3AZFA 5DNND 4YS3B 5GT3D 3AZNC 1F66A 5AV8D 2IO5B 1M19A 3WAAB 1P3BA 4G91C 4WZSB 3AN2C 5C3IC 4NE5A 2LY8A 4H9SA 5DNNA 3AZJD 2PYOB 1P3PD 4NE6A 4J8UA 5GSUD 5JRGD 3KUYD 3W98B 5AV9A 4WV4B 4NFTA 3W96B 4YM6D 3AZNA 1N1JA 2CV5B 4UUZA 3X1VB 1P34C 1P34D 1P3BC 4YM6B 4H9SC 5DNNC 4JJNC 4J8UD 3UT9B 3KWQD 3TU4B 1U35D 5B32B 3VH6W 3REHB 4XUJC 3UTAD 4KUDC 3C1CD 3MGQA 2FJ7D 2CV5D 3B6FC 3RELC 1P3AD 4Z5TD 2FJ7B 1HQ3D 4KGCD 4ZUXD 3AZEB 3W97D 5B0YC 5AV8B 2RVQC 3C1CA 3LZ0D 1P3OB 2YFVB 5DNNB 3KXBB 3O62D 4LD9A 5AVBA 3KXBD 4XUJA 3MGRC 3MGQC 3KSYA 4H9PA 5G49B 3X1TD 3A6NA 4H9RB 1P3OD 5CPJD 1P3OC 4KGCA 3B0DB 5B0YA 4H9NB 5B40D 4KHAA 1BH9A 3W99D 5C3IB 4HGAB 1KX5A 1M19D 3WAAC 5AV5B 3WTPA 3UT9D 5AVBC 3TU4D 4Z66B 4AWLB 3MGRA 2NQBB 4YS3D 5B1MB 3UTBC 3AZKC 2CWEA 3AZGC 4CSRA 5AV5D 3AFAA 4ZUXB 3AZED 4DRAA 4R8PC 2CV5C 4H9QB 1P3AB 3MNND 3C1BB 2JSSA 4Z2MH 3UTAB 3REKA 4UUZB 3REJC 1P3IA 3REIB 1P3KA 3W96A 3W97A 3O62B 3B6GD 3AZMC 1M18B 4J8XD 3AZFD 3KWQB 1JFIB 3MGQD 3REID 1P3KD 4JJND 5B33D 4XZQD 3REJB 1P3FD 4J8VB 3O62A 1U35C 5AVCC 3NQUA 3X1SB 1P3IC 2PYOD 5CP6B 4Z5TC 3AYWC 3X1TA 3X1UB 3B0CW 3W97C 3LELA 1BH8A 4XZQB 3REJD 1WWSA 4J8VC 4H9QA 3X1TB 1P3PB 5AVBB 5B31A 5CPKA 1KX5D 1S32D 5B33A 1P3GA 2NQBC 3KWQC 1R4VA 4HGAC 4J8XC 4H9RA 3AZFC 4QLCB 4WNNB 4NE3A 3MNNC 5B40B 2YFWB 1M1AD 3LELC 3LZ1C 3R45B 3W98D 1B6WA 4QLCD 1F1EA 5F99A 5B1MA 2NQBA 5GT0A 3WA9D 5AV9C 3WAAD 3B0BA 3AZEA 4J8WC 2AROD 3AZND 5AV6B 2YFVA 4JJNA 3RELB 3C1CB 1TAFB 3W96D 3B0CT 4XUJB 3REHC 5B32D 3AZHD 5B32C 5B2JB 2RVQD 3B6FA 4JJNB 3RELA 3VH5W 4CAYA 4J8WA 4KHAB 5JA4B 3MGRD 3MVDC 3KXBC 2F8NG 5B2IC 3LELB 5B32A 3W98C 3WTPE 5B40C 1KX3D 3MNNB 3VH6A 4QLCC 2F8NK 1P3OA 4KGCC 1P3BD 3LJAD 4J8UB 1KU5A 3UT9C 3MVDA 3KXBA 3MGSC 3TU4C 1KX5C 3AZLA 4WNNA 2NQBD 5B2IA 3REKD 1M19B 3WAAA 2F8ND 3WTPC 1AOIB 3W98A 3R45A 5AY8C 1ZLAD 5AV9B 3UTBA 1KX4D 3AZLD 4QLCA 5DNMB 1P3IB 3AZGA 5AVCB 5BNXB 1HQ3C 1ULYA 3AFAC 4X23D 5B24D 5CPID 3AZID 5B24C 4R8PA 2CV5A 1ZLAA 3UT9A 3TU4A 5B32G 3MGSA 5GT3C 4E44A 3X1SA 1TZYD 1P3MC 3REJA 1Q9CA 1P3KC 5GT3B 3REIC 1P3PC 5E5AD 2F8NH 3AFAB 5GXQB 1HQ3B 1KX3C 1ZLAC 4M6BA 3AZHB 3AYWB 3REHD 3X1SC 3LJAC 3MGPB 3AYWA 3REIA 3VH5T 4AWLC 3AZKD 1P3PA 5B0ZB 3X1VD 5AV5C 5B1LB 3WTPD 4E45A 4WU9D 3AV2C 1P3LD 4J8VA 1KX3A 5BO0B 5B31C 5CPKC 3W99A 5B33C 1S32A 3KWQA 1EQZC 2HIOB 3B0DC 2HIOD 4CSRB 3MNNA 5DNMC 3AZLB 3LZ1A 3WKJD 5AY8B 5AV5A 3WTPB 1AOIC 5F99C 5B1MC 3UTBB 2HUEB 5GT0C 5GT0D 3WA9A 5B31G 1S32C 2L5AA 1TZYA 3KUYA 3AZIB 1EQZA 5AV6A 1M1AA 3AZEC 5E5AA 5DNMA 4KUDB 5B0YD 1EQZD 3AV1C 5B2JA 2BYKB 4LD9D 2HUEC 5FUGB 5GT0B 5E5AB 4CAYB 4J8WB 1P3FB 3REHA 3MGPD 1ID3A 3WA9C 1P3MD 3X1VC 1TZYC 4ZBJB 5B0ZD 2PYOA 5E5AC 4H9OA 3LZ1B 3X1UA 5B2JC 5B2JD 3AV1B 5CP6A 3B6FD 5GSUA 5JRGA 1H3OB 3AYWD 3B6FB 4DRBA 5AV9D 3AV2B 1P3GD 4WU9B 1P3LB 1ID3C 1BH8B 2IO5C 3X1VA 2F8NB 5B40A 3AZMB 5JA4A 3AZJA 2NZDB 4Z2MG 3AZGD 3A6ND 4KUDD 2BYKA 3X1UC 2YFWA 5AY8D 1P3ID 1A7WA 2HIOA 3AZLC 5CP6C 1KX4C 5GSUC 5JRGC 1ZLAB 5B2ID 3W99B 1JFIA 5BNVA 3AFAD 4EO5C 5AY8A 5BS7A 3V9RA 1F66B 4WU8C 1HQ3A 4ZUXA 4J8XB 3AZFB 5B24A 1AOID 5B1LC 3UTAA 5B0ZC 5GT3A 4WU8B 3MGSD 1F66D 3UTBD 1KX4A 4EO5B 1P3MA 4WU9A 4G92B 1P3LA 2BYMB 3LZ0B 1P3GB 5KDMA 4R8PD 3W97B 1BH9B 4R8PB 4Z5TB 5CPJA 4ZUXC 3AV1D 3WKJC 3NQJA 1KX3B 5GXQD 1M19C 5GXQC 3AZGB 4G92C 3AZKB 5B1LA 5AVBD 1KX5B 2NZDD 2NZDC 3MGSB 5B1MD 4WU8D 5BT1C 4J8UC 3LJAA
chains in the Genus database with same CATH superfamily
3AV2D 4WU9C 1P3LC 3MVDD 5B1LD 3X1UD 5CP6D 5AV8A 5CPJC 4Z66A 3LZ1D 3AV2A 3WKJA 3LELD 5B24B 1P34A 1WWIA 5GXQA 2FJ7A 5B2IB 3P5JB 3W99C 2NZDA 5GSUB 5JRGB 1KX4B 3MVDB 3AZMA 3A1KA 3AZJB 1TZYB 4ZBJC 3AZIA 4X23A 3B6GB 2Y2IA 3WA9B 4H9PB 5G49A 3A6NB 3REKB 5BNXA 2F8NA 4KUDA 4J8WD 4YM6A 4LD9B 5AV8C 4X23B 4Z66C 3B6GA 4Z66D 5B0YB 1AOIA 1M1AB 2JE5A 1N1JB 4H9NA 5AVCD 2FJ7C 1ID3B 3C1CC 4KGCB 1P3FA 3KUYC 3X1SD 5AV6C 1M1AC 5AV6D 3EG5B 3AZIC 4X23C 5CPIB 1S32B 1HTAA 4LD9C 4YM6C 3A6NC 3MGQB 3AV1A 1P3BB 3MGRB 3B6GC 3AN2D 4H9OB 4YS3A 1H3OA 1P3FC 3MGPA 1EQZB 5CPIC 5CPJB 3VH5A 5B33B 3KUYB 2PYOC 5FUGA 3AZKA 4YS3C 5BT1D 3AZMD 4XZQC 1M18A 3MGPC 3NQUB 5F99B 3REKC 3LJAB 3WKJB 5CPIA 1P34B 3AZJC 3C1BD 5BO0A 2AROA 1TAFA 3W96C 1U35B 3AL0C 3C1BA 2HIOC 2AROB 2Y2JA 1P3AA 5DNMD 1P3KB 5B31B 5CPKB 3AZHA 4XZQA 1M18C 5KDMB 1M18D 1P3MB 3O62C 5BS7C 1U35A 1B67A 2BYMA 3LZ0A 4G91B 3AN2B 1T3UA 5AVCA 4WU8A 3NQJB 1F66C 5B31D 5CPKD 2AROC 3AZNB 4Z5TA 3X1TC 3AN2A 4XUJD 5B0ZA 3UTAC 3C1BC 4UPKA 3RELD 1P3AC 5CHLB 3V9RB 1BFMA 3AZHC 1P3GC 1ID3D 3LZ0C 2DQNC 5F99D 5BNVB 4J8VD 3VH6T 4J8XA 3AZFA 5DNND 4YS3B 5GT3D 3AZNC 1F66A 5AV8D 2IO5B 1M19A 3WAAB 1P3BA 4G91C 4WZSB 3AN2C 5C3IC 4NE5A 2LY8A 4H9SA 5DNNA 3AZJD 2PYOB 1P3PD 4NE6A 4J8UA 5GSUD 5JRGD 3KUYD 3W98B 2DF4C 5AV9A 4WV4B 4NFTA 3W96B 4YM6D 3AZNA 1N1JA 2CV5B 4UUZA 3X1VB 1P34C 1P34D 1P3BC 4YM6B 4H9SC 5DNNC 4JJNC 4J8UD 3UT9B 3KWQD 3TU4B 1U35D 5B32B 3VH6W 3REHB 4XUJC 3UTAD 4KUDC 3C1CD 3MGQA 2FJ7D 2CV5D 3B6FC 3RELC 1P3AD 2Y2PA 4Z5TD 2FJ7B 1HQ3D 4KGCD 4ZUXD 3AZEB 2JCHA 3W97D 5B0YC 4WJ3C 5AV8B 2RVQC 3C1CA 3LZ0D 1P3OB 2YFVB 5DNNB 2ZY3A 3KXBB 3O62D 4LD9A 5AVBA 3KXBD 4XUJA 3MGRC 1W2EA 3MGQC 3KSYA 4H9PA 5G49B 3X1TD 3A6NA 4H9RB 1P3OD 5CPJD 1P3OC 4KGCA 3B0DB 5B0YA 4H9NB 5B40D 4KHAA 1BH9A 3W99D 5C3IB 4HGAB 1KX5A 1M19D 3WAAC 5AV5B 3WTPA 3UT9D 5AVBC 3TU4D 4Z66B 4AWLB 3MGRA 4J8UC 2NQBB 4YS3D 5B1MB 3UTBC 3AZKC 2CWEA 2Y2HA 3AZGC 4CSRA 5AV5D 3AFAA 4ZUXB 3AZED 4DRAA 2ZM5A 4R8PC 2CV5C 4H9QB 1P3AB 3MNND 3C1BB 2JSSA 4Z2MH 3UTAB 2XD5A 3REKA 4UUZB 3REJC 1P3IA 3REIB 1P3KA 3W96A 3W97A 3O62B 3B6GD 3AZMC 1M18B 4J8XD 3AZFD 3KWQB 1JFIB 3MGQD 3REID 1P3KD 4JJND 5B33D 4XZQD 3REJB 1P3FD 4J8VB 3O62A 1U35C 5AVCC 2G5IC 3NQUA 3X1SB 1P3IC 2PYOD 2Y2OA 5CP6B 4Z5TC 3AYWC 3X1TA 3X1UB 3B0CW 3W97C 3LELA 1BH8A 4XZQB 3REJD 1WWSA 4J8VC 4H9QA 3X1TB 1P3PB 5AVBB 5B31A 5CPKA 1KX5D 1PZRA 5B33A 1S32D 1P3GA 3KWQC 2NQBC 1R4VA 4HGAC 4J8XC 4H9RA 3AZFC 4QLCB 4WNNB 4NE3A 3MNNC 5B40B 2YFWB 1M1AD 3LELC 3LZ1C 3R45B 3W98D 1B6WA 4QLCD 1F1EA 5F99A 5B1MA 2NQBA 5GT0A 3WA9D 5AV9C 4DQYB 3WAAD 3B0BA 3AZEA 2ZY5A 4J8WC 2AROD 3AZND 5AV6B 2YFVA 4JJNA 3RELB 3C1CB 1TAFB 3W96D 3B0CT 4XUJB 3REHC 5B32D 3AZHD 5B32C 5B2JB 2RVQD 3B6FA 4JJNB 3RELA 3VH5W 4CAYA 4J8WA 4KHAB 5JA4B 3MGRD 3MVDC 2XD1A 3KXBC 2F8NG 5B2IC 2ZY4A 3LELB 5B32A 3W98C 3WTPE 2Y2QA 5B40C 1KX3D 3MNNB 3VH6A 4QLCC 2F8NK 1P3OA 4KGCC 1P3BD 2BG1A 3LJAD 3EPHA 4J8UB 1KU5A 3UT9C 3MVDA 3KXBA 3MGSC 3TU4C 1KX5C 3AZLA 3H0MC 4WNNA 2NQBD 5B2IA 3REKD 1M19B 3WAAA 2F8ND 3WTPC 1AOIB 3W98A 3R45A 5AY8C 1ZLAD 5AV9B 3UTBA 1KX4D 3AZLD 4QLCA 5DNMB 1P3IB 3AZGA 5AVCB 2G5HC 5BNXB 1HQ3C 1ULYA 3AFAC 4X23D 5B24D 5CPID 3AZID 5B24C 4R8PA 2CV5A 1ZLAA 3UT9A 3TU4A 5B32G 3MGSA 5GT3C 4E44A 3X1SA 1TZYD 1P3MC 3REJA 1Q9CA 1P3KC 5GT3B 3REIC 2Y2LA 1P3PC 2J8PA 5E5AD 3EPKA 2F8NH 3AFAB 5GXQB 1HQ3B 1KX3C 1ZLAC 4M6BA 3AZHB 3AYWB 3REHD 3H0RC 3X1SC 3LJAC 3MGPB 3A1IA 3AYWA 3REIA 3VH5T 4AWLC 3AZKD 1P3PA 5B0ZB 3X1VD 5AV5C 5B1LB 3WTPD 4E45A 4WU9D 3AV2C 1P3LD 4J8VA 1KX3A 5BO0B 5B31C 5CPKC 3W99A 5B33C 1S32A 3KWQA 1EQZC 2HIOB 3B0DC 2HIOD 3H0LC 3FDDA 4CSRB 3MNNA 5DNMC 3AZLB 3LZ1A 3WKJD 5AY8B 5AV5A 3WTPB 1AOIC 5F99C 5B1MC 3EPLA 3UTBB 2HUEB 5GT0C 5GT0D 3WA9A 5B31G 1S32C 2L5AA 1TZYA 3KUYA 3AZIB 1EQZA 5AV6A 1M1AA 3AZEC 2W8SA 5E5AA 5DNMA 4KUDB 3KFUG 5B0YD 1EQZD 3AV1C 5B2JA 2BYKB 4LD9D 2HUEC 5FUGB 5GT0B 5E5AB 4CAYB 4J8WB 1P3FB 3REHA 3MGPD 1ID3A 3WA9C 1P3MD 3X1VC 1TZYC 2VQRA 4ZBJB 5B0ZD 2PYOA 5E5AC 4H9OA 3EPJA 3LZ1B 3X1UA 5B2JC 5B2JD 3AV1B 5CP6A 3B6FD 5GSUA 5JRGA 1H3OB 3AYWD 3B6FB 4DRBA 5AV9D 3AV2B 1P3GD 4WU9B 1P3LB 1ID3C 1BH8B 2IO5C 3X1VA 2F8NB 5B40A 3AZMB 5JA4A 3AZJA 2NZDB 4Z2MG 3AZGD 3A6ND 4KUDD 2BYKA 3X1UC 2YFWA 5AY8D 1P3ID 1A7WA 2HIOA 3AZLC 5CP6C 2F2AC 1KX4C 5GSUC 5JRGC 1ZLAB 5B2ID 3W99B 1JFIA 5BNVA 3AFAD 2ZY2A 4EO5C 5AY8A 5BS7A 3V9RA 2Y2GA 2Y2MA 1F66B 4WU8C 3IP4C 1HQ3A 2UWXA 4ZUXA 4J8XB 3AZFB 5B24A 1AOID 5B1LC 2RIQA 3UTAA 5B0ZC 5GT3A 4WU8B 3MGSD 1F66D 3UTBD 1KX4A 4EO5B 1P3MA 4WU9A 2Y2NA 4G92B 1P3LA 2BYMB 3LZ0B 1Z2CB 1P3GB 5KDMA 4R8PD 3W97B 1BH9B 4R8PB 4Z5TB 5CPJA 3F6TA 4ZUXC 3AV1D 3WKJC 3NQJA 1KX3B 5GXQD 1M19C 5GXQC 3AZGB 2Y2KA 4G92C 3AZKB 5B1LA 5AVBD 1KX5B 2NZDD 2NZDC 3MGSB 5B1MD 4WU8D 5BT1C 2FFFB 3LJAA
chains in the Genus database with same CATH topology
3AV2D 4WU9C 1P3LC 3MVDD 5B1LD 3X1UD 5CP6D 5AV8A 5CPJC 4Z66A 3LZ1D 3AV2A 3WKJA 3LELD 5B24B 1P34A 1WWIA 5GXQA 2FJ7A 5B2IB 3P5JB 3W99C 2NZDA 5GSUB 5JRGB 1KX4B 3MVDB 3AZMA 3A1KA 3AZJB 1TZYB 4ZBJC 3AZIA 4X23A 3B6GB 2Y2IA 3WA9B 4H9PB 5G49A 3A6NB 3REKB 5BNXA 2F8NA 4KUDA 4J8WD 4YM6A 4LD9B 5AV8C 4X23B 4Z66C 3B6GA 4Z66D 5B0YB 1AOIA 1M1AB 2JE5A 1N1JB 4H9NA 5AVCD 2FJ7C 1ID3B 3C1CC 4KGCB 1P3FA 3KUYC 3X1SD 5AV6C 1M1AC 5AV6D 3EG5B 3AZIC 4X23C 5CPIB 1S32B 1HTAA 4LD9C 4YM6C 3A6NC 3MGQB 3AV1A 1P3BB 3MGRB 3B6GC 3AN2D 4H9OB 4YS3A 1H3OA 1P3FC 3MGPA 1EQZB 5CPIC 5CPJB 3VH5A 5B33B 3KUYB 2PYOC 5FUGA 3AZKA 4YS3C 5BT1D 3AZMD 4XZQC 1M18A 3MGPC 3NQUB 5F99B 3REKC 3LJAB 3WKJB 5CPIA 1P34B 3AZJC 3C1BD 5BO0A 2AROA 1TAFA 3W96C 1U35B 3AL0C 3C1BA 2HIOC 2AROB 2Y2JA 1P3AA 5DNMD 1P3KB 5B31B 5CPKB 3AZHA 4XZQA 1M18C 5KDMB 1M18D 1P3MB 3O62C 5BS7C 1U35A 1B67A 2BYMA 3LZ0A 4G91B 3AN2B 1T3UA 5AVCA 4WU8A 3NQJB 1F66C 5B31D 5CPKD 2AROC 3AZNB 4Z5TA 3X1TC 3AN2A 4XUJD 5B0ZA 3UTAC 3C1BC 4UPKA 3RELD 1P3AC 5CHLB 3V9RB 1BFMA 3AZHC 1P3GC 1ID3D 3LZ0C 2DQNC 5F99D 5BNVB 4J8VD 3VH6T 4J8XA 3AZFA 5DNND 4YS3B 5GT3D 3AZNC 1F66A 5AV8D 2IO5B 1M19A 3WAAB 1P3BA 4G91C 4WZSB 3AN2C 5C3IC 4NE5A 2LY8A 4H9SA 5DNNA 3AZJD 2PYOB 1P3PD 4NE6A 4J8UA 5GSUD 5JRGD 3KUYD 3W98B 2DF4C 5AV9A 4WV4B 4NFTA 3W96B 4YM6D 3AZNA 1N1JA 2CV5B 4UUZA 3X1VB 1P34C 1P34D 1P3BC 4YM6B 4H9SC 5DNNC 4JJNC 4J8UD 3UT9B 3KWQD 3TU4B 1U35D 5B32B 3VH6W 3REHB 4XUJC 3UTAD 4KUDC 3C1CD 3MGQA 2FJ7D 2CV5D 3B6FC 3RELC 1P3AD 2Y2PA 4Z5TD 2FJ7B 1HQ3D 4KGCD 4ZUXD 3AZEB 2JCHA 3W97D 5B0YC 4WJ3C 5AV8B 2RVQC 3C1CA 3LZ0D 1P3OB 2YFVB 5DNNB 2ZY3A 3KXBB 3O62D 4LD9A 5AVBA 3KXBD 4XUJA 3MGRC 1W2EA 3MGQC 3KSYA 4H9PA 5G49B 3X1TD 3A6NA 4H9RB 1P3OD 5CPJD 1P3OC 4KGCA 3B0DB 5B0YA 4H9NB 5B40D 4KHAA 1BH9A 3W99D 5C3IB 4HGAB 1KX5A 1M19D 3WAAC 5AV5B 3WTPA 3UT9D 5AVBC 3TU4D 4Z66B 4AWLB 3MGRA 4J8UC 2NQBB 4YS3D 5B1MB 3UTBC 3AZKC 2CWEA 2Y2HA 3AZGC 4CSRA 5AV5D 3AFAA 4ZUXB 3AZED 4DRAA 2ZM5A 4R8PC 2CV5C 4H9QB 1P3AB 3MNND 3C1BB 2JSSA 4Z2MH 3UTAB 2XD5A 3REKA 4UUZB 3REJC 1P3IA 3REIB 1P3KA 3W96A 3W97A 3O62B 3B6GD 3AZMC 1M18B 4J8XD 3AZFD 3KWQB 1JFIB 3MGQD 3REID 1P3KD 4JJND 5B33D 4XZQD 3REJB 1P3FD 4J8VB 3O62A 1U35C 5AVCC 2G5IC 3NQUA 3X1SB 1P3IC 2PYOD 2Y2OA 5CP6B 4Z5TC 3AYWC 3X1TA 3X1UB 3B0CW 3W97C 3LELA 1BH8A 4XZQB 3REJD 1WWSA 4J8VC 4H9QA 3X1TB 1P3PB 5AVBB 5B31A 5CPKA 1KX5D 1PZRA 5B33A 1S32D 1P3GA 3KWQC 2NQBC 1R4VA 4HGAC 4J8XC 4H9RA 3AZFC 4QLCB 4WNNB 4NE3A 3MNNC 5B40B 2YFWB 1M1AD 3LELC 3LZ1C 3R45B 3W98D 1B6WA 4QLCD 1F1EA 5F99A 5B1MA 2NQBA 5GT0A 3WA9D 5AV9C 4DQYB 3WAAD 3B0BA 3AZEA 2ZY5A 4J8WC 2AROD 3AZND 5AV6B 2YFVA 4JJNA 3RELB 3C1CB 1TAFB 3W96D 3B0CT 4XUJB 3REHC 5B32D 3AZHD 5B32C 5B2JB 2RVQD 3B6FA 4JJNB 3RELA 3VH5W 4CAYA 4J8WA 4KHAB 5JA4B 3MGRD 3MVDC 2XD1A 3KXBC 2F8NG 5B2IC 2ZY4A 3LELB 5B32A 3W98C 3WTPE 2Y2QA 5B40C 1KX3D 3MNNB 3VH6A 4QLCC 2F8NK 1P3OA 4KGCC 1P3BD 2BG1A 3LJAD 3EPHA 4J8UB 1KU5A 3UT9C 3MVDA 3KXBA 3MGSC 3TU4C 1KX5C 3AZLA 3H0MC 4WNNA 2NQBD 5B2IA 3REKD 1M19B 3WAAA 2F8ND 3WTPC 1AOIB 3W98A 3R45A 5AY8C 1ZLAD 5AV9B 3UTBA 1KX4D 3AZLD 4QLCA 5DNMB 1P3IB 3AZGA 5AVCB 2G5HC 5BNXB 1HQ3C 1ULYA 3AFAC 4X23D 5B24D 5CPID 3AZID 5B24C 4R8PA 2CV5A 1ZLAA 3UT9A 3TU4A 5B32G 3MGSA 5GT3C 4E44A 3X1SA 1TZYD 1P3MC 3REJA 1Q9CA 1P3KC 5GT3B 3REIC 2Y2LA 1P3PC 2J8PA 5E5AD 3EPKA 2F8NH 3AFAB 5GXQB 1HQ3B 1KX3C 1ZLAC 4M6BA 3AZHB 3AYWB 3REHD 3H0RC 3X1SC 3LJAC 3MGPB 3A1IA 3AYWA 3REIA 3VH5T 4AWLC 3AZKD 1P3PA 5B0ZB 3X1VD 5AV5C 5B1LB 3WTPD 4E45A 4WU9D 3AV2C 1P3LD 4J8VA 1KX3A 5BO0B 5B31C 5CPKC 3W99A 5B33C 1S32A 3KWQA 1EQZC 2HIOB 3B0DC 2HIOD 3H0LC 3FDDA 4CSRB 3MNNA 5DNMC 3AZLB 3LZ1A 3WKJD 5AY8B 5AV5A 3WTPB 1AOIC 5F99C 5B1MC 3EPLA 3UTBB 2HUEB 5GT0C 5GT0D 3WA9A 5B31G 1S32C 2L5AA 1TZYA 3KUYA 3AZIB 1EQZA 5AV6A 1M1AA 3AZEC 2W8SA 5E5AA 5DNMA 4KUDB 3KFUG 5B0YD 1EQZD 3AV1C 5B2JA 2BYKB 4LD9D 2HUEC 5FUGB 5GT0B 5E5AB 4CAYB 4J8WB 1P3FB 3REHA 3MGPD 1ID3A 3WA9C 1P3MD 3X1VC 1TZYC 2VQRA 4ZBJB 5B0ZD 2PYOA 5E5AC 4H9OA 3EPJA 3LZ1B 3X1UA 5B2JC 5B2JD 3AV1B 5CP6A 3B6FD 5GSUA 5JRGA 1H3OB 3AYWD 3B6FB 4DRBA 5AV9D 3AV2B 1P3GD 4WU9B 1P3LB 1ID3C 1BH8B 2IO5C 3X1VA 2F8NB 5B40A 3AZMB 5JA4A 3AZJA 2NZDB 4Z2MG 3AZGD 3A6ND 4KUDD 2BYKA 3X1UC 2YFWA 5AY8D 1P3ID 1A7WA 2HIOA 3AZLC 5CP6C 2F2AC 1KX4C 5GSUC 5JRGC 1ZLAB 5B2ID 3W99B 1JFIA 5BNVA 3AFAD 2ZY2A 4EO5C 5AY8A 5BS7A 3V9RA 2Y2GA 2Y2MA 1F66B 4WU8C 3IP4C 1HQ3A 2UWXA 4ZUXA 4J8XB 3AZFB 5B24A 1AOID 5B1LC 2RIQA 3UTAA 5B0ZC 5GT3A 4WU8B 3MGSD 1F66D 3UTBD 1KX4A 4EO5B 1P3MA 4WU9A 2Y2NA 4G92B 1P3LA 2BYMB 3LZ0B 1Z2CB 1P3GB 5KDMA 4R8PD 3W97B 1BH9B 4R8PB 4Z5TB 5CPJA 3F6TA 4ZUXC 3AV1D 3WKJC 3NQJA 1KX3B 5GXQD 1M19C 5GXQC 3AZGB 2Y2KA 4G92C 3AZKB 5B1LA 5AVBD 1KX5B 2NZDD 2NZDC 3MGSB 5B1MD 4WU8D 5BT1C 2FFFB 3LJAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AV2 D;  4WU9 C;  1P3L C;  3MVD D;  5B1L D;  3X1U D;  5CP6 D;  5AV8 A;  5CPJ C;  4Z66 A;  3LZ1 D;  3AV2 A;  3WKJ A;  3LEL D;  5B24 B;  1P34 A;  1WWI A;  5GXQ A;  2FJ7 A;  5B2I B;  3W99 C;  2NZD A;  5GSU B;  5JRG B;  1KX4 B;  3MVD B;  3AZM A;  3AZJ B;  1TZY B;  4ZBJ C;  3AZI A;  4X23 A;  3B6G B;  3WA9 B;  4H9P B;  5G49 A;  3A6N B;  3REK B;  5BNX A;  2F8N A;  4KUD A;  4J8W D;  4YM6 A;  4LD9 B;  5AV8 C;  4X23 B;  4Z66 C;  3B6G A;  4Z66 D;  5B0Y B;  1AOI A;  1M1A B;  4H9N A;  1N1J B;  5AVC D;  2FJ7 C;  1ID3 B;  3C1C C;  4KGC B;  1P3F A;  3KUY C;  3X1S D;  5AV6 C;  1M1A C;  5AV6 D;  3AZI C;  4X23 C;  5CPI B;  1S32 B;  1HTA A;  4LD9 C;  4YM6 C;  3A6N C;  3MGQ B;  3AV1 A;  1P3B B;  3MGR B;  3B6G C;  3AN2 D;  4H9O B;  4YS3 A;  1H3O A;  1P3F C;  3MGP A;  1EQZ B;  5CPI C;  5CPJ B;  3VH5 A;  5B33 B;  3KUY B;  2PYO C;  5FUG A;  3AZK A;  4YS3 C;  5BT1 D;  3AZM D;  4XZQ C;  1M18 A;  3MGP C;  3NQU B;  5F99 B;  3REK C;  3LJA B;  3WKJ B;  5CPI A;  1P34 B;  3AZJ C;  3C1B D;  5BO0 A;  2ARO A;  1TAF A;  3W96 C;  1U35 B;  3C1B A;  2HIO C;  2ARO B;  1P3A A;  5DNM D;  1P3K B;  5B31 B;  5CPK B;  3AZH A;  4XZQ A;  1M18 C;  5KDM B;  1M18 D;  1P3M B;  3O62 C;  5BS7 C;  1U35 A;  1B67 A;  2BYM A;  3LZ0 A;  4G91 B;  3AN2 B;  5AVC A;  4WU8 A;  3NQJ B;  1F66 C;  5B31 D;  5CPK D;  2ARO C;  3AZN B;  4Z5T A;  3X1T C;  3AN2 A;  4XUJ D;  5B0Z A;  3UTA C;  3C1B C;  3REL D;  1P3A C;  5CHL B;  3V9R B;  1BFM A;  3AZH C;  1P3G C;  1ID3 D;  3LZ0 C;  5F99 D;  5BNV B;  4J8V D;  3VH6 T;  4J8X A;  3AZF A;  5DNN D;  4YS3 B;  5GT3 D;  3AZN C;  1F66 A;  5AV8 D;  2IO5 B;  1M19 A;  3WAA B;  1P3B A;  4G91 C;  4WZS B;  3AN2 C;  5C3I C;  4NE5 A;  2LY8 A;  4H9S A;  5DNN A;  3AZJ D;  2PYO B;  1P3P D;  4NE6 A;  4J8U A;  5GSU D;  5JRG D;  3KUY D;  3W98 B;  5AV9 A;  4WV4 B;  4NFT A;  3W96 B;  4YM6 D;  3AZN A;  1N1J A;  2CV5 B;  4UUZ A;  3X1V B;  1P34 C;  1P34 D;  1P3B C;  4YM6 B;  4H9S C;  5DNN C;  4JJN C;  4J8U D;  3UT9 B;  3KWQ D;  3TU4 B;  1U35 D;  5B32 B;  3VH6 W;  3REH B;  4XUJ C;  3UTA D;  4KUD C;  3C1C D;  3MGQ A;  2FJ7 D;  2CV5 D;  3B6F C;  3REL C;  1P3A D;  4Z5T D;  2FJ7 B;  1HQ3 D;  4KGC D;  4ZUX D;  3AZE B;  3W97 D;  5B0Y C;  5AV8 B;  2RVQ C;  3C1C A;  3LZ0 D;  1P3O B;  2YFV B;  5DNN B;  3KXB B;  3O62 D;  4LD9 A;  5AVB A;  3KXB D;  4XUJ A;  3MGR C;  3MGQ C;  3KSY A;  4H9P A;  5G49 B;  3X1T D;  3A6N A;  4H9R B;  1P3O D;  5CPJ D;  1P3O C;  4KGC A;  3B0D B;  5B0Y A;  4H9N B;  5B40 D;  4KHA A;  1BH9 A;  3W99 D;  5C3I B;  4HGA B;  1KX5 A;  1M19 D;  3WAA C;  5AV5 B;  3WTP A;  3UT9 D;  5AVB C;  3TU4 D;  4Z66 B;  4AWL B;  3MGR A;  2NQB B;  4YS3 D;  5B1M B;  3UTB C;  3AZK C;  2CWE A;  3AZG C;  4CSR A;  5AV5 D;  3AFA A;  4ZUX B;  3AZE D;  4DRA A;  4R8P C;  2CV5 C;  4H9Q B;  1P3A B;  3MNN D;  3C1B B;  2JSS A;  4Z2M H;  3UTA B;  3REK A;  4UUZ B;  3REJ C;  1P3I A;  3REI B;  1P3K A;  3W96 A;  3W97 A;  3O62 B;  3B6G D;  3AZM C;  1M18 B;  4J8X D;  3AZF D;  3KWQ B;  1JFI B;  3MGQ D;  3REI D;  1P3K D;  4JJN D;  5B33 D;  4XZQ D;  3REJ B;  1P3F D;  4J8V B;  3O62 A;  1U35 C;  5AVC C;  3NQU A;  3X1S B;  1P3I C;  2PYO D;  5CP6 B;  4Z5T C;  3AYW C;  3X1T A;  3X1U B;  3B0C W;  3W97 C;  3LEL A;  1BH8 A;  4XZQ B;  3REJ D;  1WWS A;  4J8V C;  4H9Q A;  3X1T B;  1P3P B;  5AVB B;  5B31 A;  5CPK A;  1KX5 D;  1S32 D;  5B33 A;  1P3G A;  2NQB C;  3KWQ C;  1R4V A;  4HGA C;  4J8X C;  4H9R A;  3AZF C;  4QLC B;  4WNN B;  4NE3 A;  3MNN C;  5B40 B;  2YFW B;  1M1A D;  3LEL C;  3LZ1 C;  3R45 B;  3W98 D;  1B6W A;  4QLC D;  1F1E A;  5F99 A;  5B1M A;  2NQB A;  5GT0 A;  3WA9 D;  5AV9 C;  3WAA D;  3B0B A;  3AZE A;  4J8W C;  2ARO D;  3AZN D;  5AV6 B;  2YFV A;  4JJN A;  3REL B;  3C1C B;  1TAF B;  3W96 D;  3B0C T;  4XUJ B;  3REH C;  5B32 D;  3AZH D;  5B32 C;  5B2J B;  2RVQ D;  3B6F A;  4JJN B;  3REL A;  3VH5 W;  4CAY A;  4J8W A;  4KHA B;  5JA4 B;  3MGR D;  3MVD C;  3KXB C;  2F8N G;  5B2I C;  3LEL B;  5B32 A;  3W98 C;  3WTP E;  5B40 C;  1KX3 D;  3MNN B;  3VH6 A;  4QLC C;  2F8N K;  1P3O A;  4KGC C;  1P3B D;  3LJA D;  4J8U B;  1KU5 A;  3UT9 C;  3MVD A;  3KXB A;  3MGS C;  3TU4 C;  1KX5 C;  3AZL A;  4WNN A;  2NQB D;  5B2I A;  3REK D;  1M19 B;  3WAA A;  2F8N D;  3WTP C;  1AOI B;  3W98 A;  3R45 A;  5AY8 C;  1ZLA D;  5AV9 B;  3UTB A;  1KX4 D;  3AZL D;  4QLC A;  5DNM B;  1P3I B;  3AZG A;  5AVC B;  5BNX B;  1HQ3 C;  1ULY A;  3AFA C;  4X23 D;  5B24 D;  5CPI D;  3AZI D;  5B24 C;  4R8P A;  2CV5 A;  1ZLA A;  3UT9 A;  3TU4 A;  5B32 G;  3MGS A;  5GT3 C;  4E44 A;  3X1S A;  1TZY D;  1P3M C;  3REJ A;  1Q9C A;  1P3K C;  5GT3 B;  3REI C;  1P3P C;  5E5A D;  2F8N H;  3AFA B;  5GXQ B;  1HQ3 B;  1KX3 C;  1ZLA C;  4M6B A;  3AZH B;  3AYW B;  3REH D;  3X1S C;  3LJA C;  3MGP B;  3AYW A;  3REI A;  3VH5 T;  4AWL C;  3AZK D;  1P3P A;  5B0Z B;  3X1V D;  5AV5 C;  5B1L B;  3WTP D;  4E45 A;  4WU9 D;  3AV2 C;  1P3L D;  4J8V A;  1KX3 A;  5BO0 B;  5B31 C;  5CPK C;  3W99 A;  5B33 C;  1S32 A;  3KWQ A;  1EQZ C;  2HIO B;  3B0D C;  2HIO D;  4CSR B;  3MNN A;  5DNM C;  3AZL B;  3LZ1 A;  3WKJ D;  5AY8 B;  5AV5 A;  3WTP B;  1AOI C;  5F99 C;  5B1M C;  3UTB B;  2HUE B;  5GT0 C;  5GT0 D;  3WA9 A;  5B31 G;  1S32 C;  2L5A A;  1TZY A;  3KUY A;  3AZI B;  1EQZ A;  5AV6 A;  1M1A A;  3AZE C;  5E5A A;  5DNM A;  4KUD B;  5B0Y D;  1EQZ D;  3AV1 C;  5B2J A;  2BYK B;  4LD9 D;  2HUE C;  5FUG B;  5GT0 B;  5E5A B;  4CAY B;  4J8W B;  1P3F B;  3REH A;  3MGP D;  1ID3 A;  3WA9 C;  1P3M D;  3X1V C;  1TZY C;  4ZBJ B;  5B0Z D;  2PYO A;  5E5A C;  4H9O A;  3LZ1 B;  3X1U A;  5B2J C;  5B2J D;  3AV1 B;  5CP6 A;  3B6F D;  5GSU A;  5JRG A;  1H3O B;  3AYW D;  3B6F B;  4DRB A;  5AV9 D;  3AV2 B;  1P3G D;  4WU9 B;  1P3L B;  1ID3 C;  1BH8 B;  2IO5 C;  3X1V A;  2F8N B;  5B40 A;  3AZM B;  5JA4 A;  3AZJ A;  2NZD B;  4Z2M G;  3AZG D;  3A6N D;  4KUD D;  2BYK A;  3X1U C;  2YFW A;  5AY8 D;  1P3I D;  1A7W A;  2HIO A;  3AZL C;  5CP6 C;  1KX4 C;  5GSU C;  5JRG C;  1ZLA B;  5B2I D;  3W99 B;  1JFI A;  5BNV A;  3AFA D;  4EO5 C;  5AY8 A;  5BS7 A;  3V9R A;  1F66 B;  4WU8 C;  1HQ3 A;  4ZUX A;  4J8X B;  3AZF B;  5B24 A;  1AOI D;  5B1L C;  3UTA A;  5B0Z C;  5GT3 A;  4WU8 B;  3MGS D;  1F66 D;  3UTB D;  1KX4 A;  4EO5 B;  1P3M A;  4WU9 A;  4G92 B;  1P3L A;  2BYM B;  3LZ0 B;  1P3G B;  5KDM A;  4R8P D;  3W97 B;  1BH9 B;  4R8P B;  4Z5T B;  5CPJ A;  4ZUX C;  3AV1 D;  3WKJ C;  3NQJ A;  1KX3 B;  5GXQ D;  1M19 C;  5GXQ C;  3AZG B;  4G92 C;  3AZK B;  5B1L A;  5AVB D;  1KX5 B;  2NZD D;  2NZD C;  3MGS B;  5B1M D;  4WU8 D;  5BT1 C;  4J8U C;  3LJA A; 
#chains in the Genus database with same CATH topology
 3AV2 D;  4WU9 C;  1P3L C;  3MVD D;  5B1L D;  3X1U D;  5CP6 D;  5AV8 A;  5CPJ C;  4Z66 A;  3LZ1 D;  3AV2 A;  3WKJ A;  3LEL D;  5B24 B;  1P34 A;  1WWI A;  5GXQ A;  2FJ7 A;  5B2I B;  3P5J B;  3W99 C;  2NZD A;  5GSU B;  5JRG B;  1KX4 B;  3MVD B;  3AZM A;  3A1K A;  3AZJ B;  1TZY B;  4ZBJ C;  3AZI A;  4X23 A;  3B6G B;  2Y2I A;  3WA9 B;  4H9P B;  5G49 A;  3A6N B;  3REK B;  5BNX A;  2F8N A;  4KUD A;  4J8W D;  4YM6 A;  4LD9 B;  5AV8 C;  4X23 B;  4Z66 C;  3B6G A;  4Z66 D;  5B0Y B;  1AOI A;  1M1A B;  2JE5 A;  1N1J B;  4H9N A;  5AVC D;  2FJ7 C;  1ID3 B;  3C1C C;  4KGC B;  1P3F A;  3KUY C;  3X1S D;  5AV6 C;  1M1A C;  5AV6 D;  3EG5 B;  3AZI C;  4X23 C;  5CPI B;  1S32 B;  1HTA A;  4LD9 C;  4YM6 C;  3A6N C;  3MGQ B;  3AV1 A;  1P3B B;  3MGR B;  3B6G C;  3AN2 D;  4H9O B;  4YS3 A;  1H3O A;  1P3F C;  3MGP A;  1EQZ B;  5CPI C;  5CPJ B;  3VH5 A;  5B33 B;  3KUY B;  2PYO C;  5FUG A;  3AZK A;  4YS3 C;  5BT1 D;  3AZM D;  4XZQ C;  1M18 A;  3MGP C;  3NQU B;  5F99 B;  3REK C;  3LJA B;  3WKJ B;  5CPI A;  1P34 B;  3AZJ C;  3C1B D;  5BO0 A;  2ARO A;  1TAF A;  3W96 C;  1U35 B;  3AL0 C;  3C1B A;  2HIO C;  2ARO B;  2Y2J A;  1P3A A;  5DNM D;  1P3K B;  5B31 B;  5CPK B;  3AZH A;  4XZQ A;  1M18 C;  5KDM B;  1M18 D;  1P3M B;  3O62 C;  5BS7 C;  1U35 A;  1B67 A;  2BYM A;  3LZ0 A;  4G91 B;  3AN2 B;  1T3U A;  5AVC A;  4WU8 A;  3NQJ B;  1F66 C;  5B31 D;  5CPK D;  2ARO C;  3AZN B;  4Z5T A;  3X1T C;  3AN2 A;  4XUJ D;  5B0Z A;  3UTA C;  3C1B C;  4UPK A;  3REL D;  1P3A C;  5CHL B;  3V9R B;  1BFM A;  3AZH C;  1P3G C;  1ID3 D;  3LZ0 C;  2DQN C;  5F99 D;  5BNV B;  4J8V D;  3VH6 T;  4J8X A;  3AZF A;  5DNN D;  4YS3 B;  5GT3 D;  3AZN C;  1F66 A;  5AV8 D;  2IO5 B;  1M19 A;  3WAA B;  1P3B A;  4G91 C;  4WZS B;  3AN2 C;  5C3I C;  4NE5 A;  2LY8 A;  4H9S A;  5DNN A;  3AZJ D;  2PYO B;  1P3P D;  4NE6 A;  4J8U A;  5GSU D;  5JRG D;  3KUY D;  3W98 B;  2DF4 C;  5AV9 A;  4WV4 B;  4NFT A;  3W96 B;  4YM6 D;  3AZN A;  1N1J A;  2CV5 B;  4UUZ A;  3X1V B;  1P34 C;  1P34 D;  1P3B C;  4YM6 B;  4H9S C;  5DNN C;  4JJN C;  4J8U D;  3UT9 B;  3KWQ D;  3TU4 B;  1U35 D;  5B32 B;  3VH6 W;  3REH B;  4XUJ C;  3UTA D;  4KUD C;  3C1C D;  3MGQ A;  2FJ7 D;  2CV5 D;  3B6F C;  3REL C;  1P3A D;  2Y2P A;  4Z5T D;  2FJ7 B;  1HQ3 D;  4KGC D;  4ZUX D;  3AZE B;  2JCH A;  3W97 D;  5B0Y C;  4WJ3 C;  5AV8 B;  2RVQ C;  3C1C A;  3LZ0 D;  1P3O B;  2YFV B;  5DNN B;  2ZY3 A;  3KXB B;  3O62 D;  4LD9 A;  5AVB A;  3KXB D;  4XUJ A;  3MGR C;  1W2E A;  3MGQ C;  3KSY A;  4H9P A;  5G49 B;  3X1T D;  3A6N A;  4H9R B;  1P3O D;  5CPJ D;  1P3O C;  4KGC A;  3B0D B;  5B0Y A;  4H9N B;  5B40 D;  4KHA A;  1BH9 A;  3W99 D;  5C3I B;  4HGA B;  1KX5 A;  1M19 D;  3WAA C;  5AV5 B;  3WTP A;  3UT9 D;  5AVB C;  3TU4 D;  4Z66 B;  4AWL B;  3MGR A;  4J8U C;  2NQB B;  4YS3 D;  5B1M B;  3UTB C;  3AZK C;  2CWE A;  2Y2H A;  3AZG C;  4CSR A;  5AV5 D;  3AFA A;  4ZUX B;  3AZE D;  4DRA A;  2ZM5 A;  4R8P C;  2CV5 C;  4H9Q B;  1P3A B;  3MNN D;  3C1B B;  2JSS A;  4Z2M H;  3UTA B;  2XD5 A;  3REK A;  4UUZ B;  3REJ C;  1P3I A;  3REI B;  1P3K A;  3W96 A;  3W97 A;  3O62 B;  3B6G D;  3AZM C;  1M18 B;  4J8X D;  3AZF D;  3KWQ B;  1JFI B;  3MGQ D;  3REI D;  1P3K D;  4JJN D;  5B33 D;  4XZQ D;  3REJ B;  1P3F D;  4J8V B;  3O62 A;  1U35 C;  5AVC C;  2G5I C;  3NQU A;  3X1S B;  1P3I C;  2PYO D;  2Y2O A;  5CP6 B;  4Z5T C;  3AYW C;  3X1T A;  3X1U B;  3B0C W;  3W97 C;  3LEL A;  1BH8 A;  4XZQ B;  3REJ D;  1WWS A;  4J8V C;  4H9Q A;  3X1T B;  1P3P B;  5AVB B;  5B31 A;  5CPK A;  1KX5 D;  1PZR A;  5B33 A;  1S32 D;  1P3G A;  3KWQ C;  2NQB C;  1R4V A;  4HGA C;  4J8X C;  4H9R A;  3AZF C;  4QLC B;  4WNN B;  4NE3 A;  3MNN C;  5B40 B;  2YFW B;  1M1A D;  3LEL C;  3LZ1 C;  3R45 B;  3W98 D;  1B6W A;  4QLC D;  1F1E A;  5F99 A;  5B1M A;  2NQB A;  5GT0 A;  3WA9 D;  5AV9 C;  4DQY B;  3WAA D;  3B0B A;  3AZE A;  2ZY5 A;  4J8W C;  2ARO D;  3AZN D;  5AV6 B;  2YFV A;  4JJN A;  3REL B;  3C1C B;  1TAF B;  3W96 D;  3B0C T;  4XUJ B;  3REH C;  5B32 D;  3AZH D;  5B32 C;  5B2J B;  2RVQ D;  3B6F A;  4JJN B;  3REL A;  3VH5 W;  4CAY A;  4J8W A;  4KHA B;  5JA4 B;  3MGR D;  3MVD C;  2XD1 A;  3KXB C;  2F8N G;  5B2I C;  2ZY4 A;  3LEL B;  5B32 A;  3W98 C;  3WTP E;  2Y2Q A;  5B40 C;  1KX3 D;  3MNN B;  3VH6 A;  4QLC C;  2F8N K;  1P3O A;  4KGC C;  1P3B D;  2BG1 A;  3LJA D;  3EPH A;  4J8U B;  1KU5 A;  3UT9 C;  3MVD A;  3KXB A;  3MGS C;  3TU4 C;  1KX5 C;  3AZL A;  3H0M C;  4WNN A;  2NQB D;  5B2I A;  3REK D;  1M19 B;  3WAA A;  2F8N D;  3WTP C;  1AOI B;  3W98 A;  3R45 A;  5AY8 C;  1ZLA D;  5AV9 B;  3UTB A;  1KX4 D;  3AZL D;  4QLC A;  5DNM B;  1P3I B;  3AZG A;  5AVC B;  2G5H C;  5BNX B;  1HQ3 C;  1ULY A;  3AFA C;  4X23 D;  5B24 D;  5CPI D;  3AZI D;  5B24 C;  4R8P A;  2CV5 A;  1ZLA A;  3UT9 A;  3TU4 A;  5B32 G;  3MGS A;  5GT3 C;  4E44 A;  3X1S A;  1TZY D;  1P3M C;  3REJ A;  1Q9C A;  1P3K C;  5GT3 B;  3REI C;  2Y2L A;  1P3P C;  2J8P A;  5E5A D;  3EPK A;  2F8N H;  3AFA B;  5GXQ B;  1HQ3 B;  1KX3 C;  1ZLA C;  4M6B A;  3AZH B;  3AYW B;  3REH D;  3H0R C;  3X1S C;  3LJA C;  3MGP B;  3A1I A;  3AYW A;  3REI A;  3VH5 T;  4AWL C;  3AZK D;  1P3P A;  5B0Z B;  3X1V D;  5AV5 C;  5B1L B;  3WTP D;  4E45 A;  4WU9 D;  3AV2 C;  1P3L D;  4J8V A;  1KX3 A;  5BO0 B;  5B31 C;  5CPK C;  3W99 A;  5B33 C;  1S32 A;  3KWQ A;  1EQZ C;  2HIO B;  3B0D C;  2HIO D;  3H0L C;  3FDD A;  4CSR B;  3MNN A;  5DNM C;  3AZL B;  3LZ1 A;  3WKJ D;  5AY8 B;  5AV5 A;  3WTP B;  1AOI C;  5F99 C;  5B1M C;  3EPL A;  3UTB B;  2HUE B;  5GT0 C;  5GT0 D;  3WA9 A;  5B31 G;  1S32 C;  2L5A A;  1TZY A;  3KUY A;  3AZI B;  1EQZ A;  5AV6 A;  1M1A A;  3AZE C;  2W8S A;  5E5A A;  5DNM A;  4KUD B;  3KFU G;  5B0Y D;  1EQZ D;  3AV1 C;  5B2J A;  2BYK B;  4LD9 D;  2HUE C;  5FUG B;  5GT0 B;  5E5A B;  4CAY B;  4J8W B;  1P3F B;  3REH A;  3MGP D;  1ID3 A;  3WA9 C;  1P3M D;  3X1V C;  1TZY C;  2VQR A;  4ZBJ B;  5B0Z D;  2PYO A;  5E5A C;  4H9O A;  3EPJ A;  3LZ1 B;  3X1U A;  5B2J C;  5B2J D;  3AV1 B;  5CP6 A;  3B6F D;  5GSU A;  5JRG A;  1H3O B;  3AYW D;  3B6F B;  4DRB A;  5AV9 D;  3AV2 B;  1P3G D;  4WU9 B;  1P3L B;  1ID3 C;  1BH8 B;  2IO5 C;  3X1V A;  2F8N B;  5B40 A;  3AZM B;  5JA4 A;  3AZJ A;  2NZD B;  4Z2M G;  3AZG D;  3A6N D;  4KUD D;  2BYK A;  3X1U C;  2YFW A;  5AY8 D;  1P3I D;  1A7W A;  2HIO A;  3AZL C;  5CP6 C;  2F2A C;  1KX4 C;  5GSU C;  5JRG C;  1ZLA B;  5B2I D;  3W99 B;  1JFI A;  5BNV A;  3AFA D;  2ZY2 A;  4EO5 C;  5AY8 A;  5BS7 A;  3V9R A;  2Y2G A;  2Y2M A;  1F66 B;  4WU8 C;  3IP4 C;  1HQ3 A;  2UWX A;  4ZUX A;  4J8X B;  3AZF B;  5B24 A;  1AOI D;  5B1L C;  2RIQ A;  3UTA A;  5B0Z C;  5GT3 A;  4WU8 B;  3MGS D;  1F66 D;  3UTB D;  1KX4 A;  4EO5 B;  1P3M A;  4WU9 A;  2Y2N A;  4G92 B;  1P3L A;  2BYM B;  3LZ0 B;  1Z2C B;  1P3G B;  5KDM A;  4R8P D;  3W97 B;  1BH9 B;  4R8P B;  4Z5T B;  5CPJ A;  3F6T A;  4ZUX C;  3AV1 D;  3WKJ C;  3NQJ A;  1KX3 B;  5GXQ D;  1M19 C;  5GXQ C;  3AZG B;  2Y2K A;  4G92 C;  3AZK B;  5B1L A;  5AVB D;  1KX5 B;  2NZD D;  2NZD C;  3MGS B;  5B1M D;  4WU8 D;  5BT1 C;  2FFF B;  3LJA A; 
#chains in the Genus database with same CATH homology
 3AV2 D;  4WU9 C;  1P3L C;  3MVD D;  5B1L D;  3X1U D;  5CP6 D;  5AV8 A;  5CPJ C;  4Z66 A;  3LZ1 D;  3AV2 A;  3WKJ A;  3LEL D;  5B24 B;  1P34 A;  1WWI A;  5GXQ A;  2FJ7 A;  5B2I B;  3P5J B;  3W99 C;  2NZD A;  5GSU B;  5JRG B;  1KX4 B;  3MVD B;  3AZM A;  3A1K A;  3AZJ B;  1TZY B;  4ZBJ C;  3AZI A;  4X23 A;  3B6G B;  2Y2I A;  3WA9 B;  4H9P B;  5G49 A;  3A6N B;  3REK B;  5BNX A;  2F8N A;  4KUD A;  4J8W D;  4YM6 A;  4LD9 B;  5AV8 C;  4X23 B;  4Z66 C;  3B6G A;  4Z66 D;  5B0Y B;  1AOI A;  1M1A B;  2JE5 A;  1N1J B;  4H9N A;  5AVC D;  2FJ7 C;  1ID3 B;  3C1C C;  4KGC B;  1P3F A;  3KUY C;  3X1S D;  5AV6 C;  1M1A C;  5AV6 D;  3EG5 B;  3AZI C;  4X23 C;  5CPI B;  1S32 B;  1HTA A;  4LD9 C;  4YM6 C;  3A6N C;  3MGQ B;  3AV1 A;  1P3B B;  3MGR B;  3B6G C;  3AN2 D;  4H9O B;  4YS3 A;  1H3O A;  1P3F C;  3MGP A;  1EQZ B;  5CPI C;  5CPJ B;  3VH5 A;  5B33 B;  3KUY B;  2PYO C;  5FUG A;  3AZK A;  4YS3 C;  5BT1 D;  3AZM D;  4XZQ C;  1M18 A;  3MGP C;  3NQU B;  5F99 B;  3REK C;  3LJA B;  3WKJ B;  5CPI A;  1P34 B;  3AZJ C;  3C1B D;  5BO0 A;  2ARO A;  1TAF A;  3W96 C;  1U35 B;  3AL0 C;  3C1B A;  2HIO C;  2ARO B;  2Y2J A;  1P3A A;  5DNM D;  1P3K B;  5B31 B;  5CPK B;  3AZH A;  4XZQ A;  1M18 C;  5KDM B;  1M18 D;  1P3M B;  3O62 C;  5BS7 C;  1U35 A;  1B67 A;  2BYM A;  3LZ0 A;  4G91 B;  3AN2 B;  1T3U A;  5AVC A;  4WU8 A;  3NQJ B;  1F66 C;  5B31 D;  5CPK D;  2ARO C;  3AZN B;  4Z5T A;  3X1T C;  3AN2 A;  4XUJ D;  5B0Z A;  3UTA C;  3C1B C;  4UPK A;  3REL D;  1P3A C;  5CHL B;  3V9R B;  1BFM A;  3AZH C;  1P3G C;  1ID3 D;  3LZ0 C;  2DQN C;  5F99 D;  5BNV B;  4J8V D;  3VH6 T;  4J8X A;  3AZF A;  5DNN D;  4YS3 B;  5GT3 D;  3AZN C;  1F66 A;  5AV8 D;  2IO5 B;  1M19 A;  3WAA B;  1P3B A;  4G91 C;  4WZS B;  3AN2 C;  5C3I C;  4NE5 A;  2LY8 A;  4H9S A;  5DNN A;  3AZJ D;  2PYO B;  1P3P D;  4NE6 A;  4J8U A;  5GSU D;  5JRG D;  3KUY D;  3W98 B;  2DF4 C;  5AV9 A;  4WV4 B;  4NFT A;  3W96 B;  4YM6 D;  3AZN A;  1N1J A;  2CV5 B;  4UUZ A;  3X1V B;  1P34 C;  1P34 D;  1P3B C;  4YM6 B;  4H9S C;  5DNN C;  4JJN C;  4J8U D;  3UT9 B;  3KWQ D;  3TU4 B;  1U35 D;  5B32 B;  3VH6 W;  3REH B;  4XUJ C;  3UTA D;  4KUD C;  3C1C D;  3MGQ A;  2FJ7 D;  2CV5 D;  3B6F C;  3REL C;  1P3A D;  2Y2P A;  4Z5T D;  2FJ7 B;  1HQ3 D;  4KGC D;  4ZUX D;  3AZE B;  2JCH A;  3W97 D;  5B0Y C;  4WJ3 C;  5AV8 B;  2RVQ C;  3C1C A;  3LZ0 D;  1P3O B;  2YFV B;  5DNN B;  2ZY3 A;  3KXB B;  3O62 D;  4LD9 A;  5AVB A;  3KXB D;  4XUJ A;  3MGR C;  1W2E A;  3MGQ C;  3KSY A;  4H9P A;  5G49 B;  3X1T D;  3A6N A;  4H9R B;  1P3O D;  5CPJ D;  1P3O C;  4KGC A;  3B0D B;  5B0Y A;  4H9N B;  5B40 D;  4KHA A;  1BH9 A;  3W99 D;  5C3I B;  4HGA B;  1KX5 A;  1M19 D;  3WAA C;  5AV5 B;  3WTP A;  3UT9 D;  5AVB C;  3TU4 D;  4Z66 B;  4AWL B;  3MGR A;  4J8U C;  2NQB B;  4YS3 D;  5B1M B;  3UTB C;  3AZK C;  2CWE A;  2Y2H A;  3AZG C;  4CSR A;  5AV5 D;  3AFA A;  4ZUX B;  3AZE D;  4DRA A;  2ZM5 A;  4R8P C;  2CV5 C;  4H9Q B;  1P3A B;  3MNN D;  3C1B B;  2JSS A;  4Z2M H;  3UTA B;  2XD5 A;  3REK A;  4UUZ B;  3REJ C;  1P3I A;  3REI B;  1P3K A;  3W96 A;  3W97 A;  3O62 B;  3B6G D;  3AZM C;  1M18 B;  4J8X D;  3AZF D;  3KWQ B;  1JFI B;  3MGQ D;  3REI D;  1P3K D;  4JJN D;  5B33 D;  4XZQ D;  3REJ B;  1P3F D;  4J8V B;  3O62 A;  1U35 C;  5AVC C;  2G5I C;  3NQU A;  3X1S B;  1P3I C;  2PYO D;  2Y2O A;  5CP6 B;  4Z5T C;  3AYW C;  3X1T A;  3X1U B;  3B0C W;  3W97 C;  3LEL A;  1BH8 A;  4XZQ B;  3REJ D;  1WWS A;  4J8V C;  4H9Q A;  3X1T B;  1P3P B;  5AVB B;  5B31 A;  5CPK A;  1KX5 D;  1PZR A;  5B33 A;  1S32 D;  1P3G A;  3KWQ C;  2NQB C;  1R4V A;  4HGA C;  4J8X C;  4H9R A;  3AZF C;  4QLC B;  4WNN B;  4NE3 A;  3MNN C;  5B40 B;  2YFW B;  1M1A D;  3LEL C;  3LZ1 C;  3R45 B;  3W98 D;  1B6W A;  4QLC D;  1F1E A;  5F99 A;  5B1M A;  2NQB A;  5GT0 A;  3WA9 D;  5AV9 C;  4DQY B;  3WAA D;  3B0B A;  3AZE A;  2ZY5 A;  4J8W C;  2ARO D;  3AZN D;  5AV6 B;  2YFV A;  4JJN A;  3REL B;  3C1C B;  1TAF B;  3W96 D;  3B0C T;  4XUJ B;  3REH C;  5B32 D;  3AZH D;  5B32 C;  5B2J B;  2RVQ D;  3B6F A;  4JJN B;  3REL A;  3VH5 W;  4CAY A;  4J8W A;  4KHA B;  5JA4 B;  3MGR D;  3MVD C;  2XD1 A;  3KXB C;  2F8N G;  5B2I C;  2ZY4 A;  3LEL B;  5B32 A;  3W98 C;  3WTP E;  2Y2Q A;  5B40 C;  1KX3 D;  3MNN B;  3VH6 A;  4QLC C;  2F8N K;  1P3O A;  4KGC C;  1P3B D;  2BG1 A;  3LJA D;  3EPH A;  4J8U B;  1KU5 A;  3UT9 C;  3MVD A;  3KXB A;  3MGS C;  3TU4 C;  1KX5 C;  3AZL A;  3H0M C;  4WNN A;  2NQB D;  5B2I A;  3REK D;  1M19 B;  3WAA A;  2F8N D;  3WTP C;  1AOI B;  3W98 A;  3R45 A;  5AY8 C;  1ZLA D;  5AV9 B;  3UTB A;  1KX4 D;  3AZL D;  4QLC A;  5DNM B;  1P3I B;  3AZG A;  5AVC B;  2G5H C;  5BNX B;  1HQ3 C;  1ULY A;  3AFA C;  4X23 D;  5B24 D;  5CPI D;  3AZI D;  5B24 C;  4R8P A;  2CV5 A;  1ZLA A;  3UT9 A;  3TU4 A;  5B32 G;  3MGS A;  5GT3 C;  4E44 A;  3X1S A;  1TZY D;  1P3M C;  3REJ A;  1Q9C A;  1P3K C;  5GT3 B;  3REI C;  2Y2L A;  1P3P C;  2J8P A;  5E5A D;  3EPK A;  2F8N H;  3AFA B;  5GXQ B;  1HQ3 B;  1KX3 C;  1ZLA C;  4M6B A;  3AZH B;  3AYW B;  3REH D;  3H0R C;  3X1S C;  3LJA C;  3MGP B;  3A1I A;  3AYW A;  3REI A;  3VH5 T;  4AWL C;  3AZK D;  1P3P A;  5B0Z B;  3X1V D;  5AV5 C;  5B1L B;  3WTP D;  4E45 A;  4WU9 D;  3AV2 C;  1P3L D;  4J8V A;  1KX3 A;  5BO0 B;  5B31 C;  5CPK C;  3W99 A;  5B33 C;  1S32 A;  3KWQ A;  1EQZ C;  2HIO B;  3B0D C;  2HIO D;  3H0L C;  3FDD A;  4CSR B;  3MNN A;  5DNM C;  3AZL B;  3LZ1 A;  3WKJ D;  5AY8 B;  5AV5 A;  3WTP B;  1AOI C;  5F99 C;  5B1M C;  3EPL A;  3UTB B;  2HUE B;  5GT0 C;  5GT0 D;  3WA9 A;  5B31 G;  1S32 C;  2L5A A;  1TZY A;  3KUY A;  3AZI B;  1EQZ A;  5AV6 A;  1M1A A;  3AZE C;  2W8S A;  5E5A A;  5DNM A;  4KUD B;  3KFU G;  5B0Y D;  1EQZ D;  3AV1 C;  5B2J A;  2BYK B;  4LD9 D;  2HUE C;  5FUG B;  5GT0 B;  5E5A B;  4CAY B;  4J8W B;  1P3F B;  3REH A;  3MGP D;  1ID3 A;  3WA9 C;  1P3M D;  3X1V C;  1TZY C;  2VQR A;  4ZBJ B;  5B0Z D;  2PYO A;  5E5A C;  4H9O A;  3EPJ A;  3LZ1 B;  3X1U A;  5B2J C;  5B2J D;  3AV1 B;  5CP6 A;  3B6F D;  5GSU A;  5JRG A;  1H3O B;  3AYW D;  3B6F B;  4DRB A;  5AV9 D;  3AV2 B;  1P3G D;  4WU9 B;  1P3L B;  1ID3 C;  1BH8 B;  2IO5 C;  3X1V A;  2F8N B;  5B40 A;  3AZM B;  5JA4 A;  3AZJ A;  2NZD B;  4Z2M G;  3AZG D;  3A6N D;  4KUD D;  2BYK A;  3X1U C;  2YFW A;  5AY8 D;  1P3I D;  1A7W A;  2HIO A;  3AZL C;  5CP6 C;  2F2A C;  1KX4 C;  5GSU C;  5JRG C;  1ZLA B;  5B2I D;  3W99 B;  1JFI A;  5BNV A;  3AFA D;  2ZY2 A;  4EO5 C;  5AY8 A;  5BS7 A;  3V9R A;  2Y2G A;  2Y2M A;  1F66 B;  4WU8 C;  3IP4 C;  1HQ3 A;  2UWX A;  4ZUX A;  4J8X B;  3AZF B;  5B24 A;  1AOI D;  5B1L C;  2RIQ A;  3UTA A;  5B0Z C;  5GT3 A;  4WU8 B;  3MGS D;  1F66 D;  3UTB D;  1KX4 A;  4EO5 B;  1P3M A;  4WU9 A;  2Y2N A;  4G92 B;  1P3L A;  2BYM B;  3LZ0 B;  1Z2C B;  1P3G B;  5KDM A;  4R8P D;  3W97 B;  1BH9 B;  4R8P B;  4Z5T B;  5CPJ A;  3F6T A;  4ZUX C;  3AV1 D;  3WKJ C;  3NQJ A;  1KX3 B;  5GXQ D;  1M19 C;  5GXQ C;  3AZG B;  2Y2K A;  4G92 C;  3AZK B;  5B1L A;  5AVB D;  1KX5 B;  2NZD D;  2NZD C;  3MGS B;  5B1M D;  4WU8 D;  5BT1 C;  2FFF B;  3LJA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...