3AFAD

The human nucleosome structure
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
96
structure length
96
Chain Sequence
KRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Structural basis of instability of the nucleosome containing a testis-specific histone variant, human H3T
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 96
sequence length 96
chains with identical sequence H
ec nomenclature
pdb deposition date 2010-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3afaD00
5B1LC 3O62D 3RELA 3UT9C 4KHAB 3REIB 1M19D 3AV1C 3REJA 4J8VD 1F66D 4ZUXC 1P3BB 5B2IB 1ZLAB 5CPJA 3WKJC 4H9PA 3AZEC 5B0ZD 5AVCA 3MNNC 3LZ1B 2RVQD 3AZFB 1TZYC 4R8PD 4QLCD 4H9QA 5B24C 4DRAA 3KUYD 2PYOA 5AY8C 5DNND 4YM6C 1P3IB 3MGQD 3X1TD 1N1JB 4H9NA 5AV9A 3NQJA 3B6GB 3REJC 1M1AA 4H9OB 3WAAB 3W98B 5CPJC 3AZNB 5B40D 3MGSD 5B31B 1M18B 1KX5D 5AVCC 3X1SA 5CPID 4WU9A 3AZHA 1ID3B 1AOIA 2PYOC 3AZLD 4J8WA 5B32G 3LELB 3AZJB 5AV8B 3KXBA 4WU8D 2F8NB 5AV9C 1M1AC 5B0YD 3W97C 1ZLAD 3W96B 1TAFB 3AZMD 1P34B 1U35A 3A6NC 5GXQB 5CPKC 4KUDA 5AV5A 3X1SC 4WU9C 3UTBB 1AOIC 2HIOA 5AV6D 3AZIA 3VH5W 4J8WC 2CV5A 5AVBD 3X1UB 2IO5C 3KXBC 3VH6T 3AFAC 4KGCA 2NZDB 3W98D 3WA9B 3AZND 4Z5TA 3KWQB 3X1VD 1H3OB 4LD9C 3AV2B 5BNXB 1U35C 5B31D 1M18D 1P3FD 4G91B 4HGAB 4J8UB 3AYWA 2FJ7A 4KUDC 2AROD 3TU4A 1P3PB 5AV5C 3MVDA 4YS3D 5FUGB 3MGRD 1P3GA 5GT0D 5DNMA 5B33B 3AZIC 5JA4A 2CV5C 3UTAD 4CSRB 2YFVA 3AN2B 1P3LD 3REHA 3C1BD 3UT9B 3W96D 1P3AD 1BH9B 4KGCC 4X23A 4Z5TC 4CAYB 5GXQD 5BNVA 3AYWC 2FJ7C 5B2JB 5B1LA 3TU4C 3WKJB 5C3IC 3MVDC 3UTBD 3AV1A 3AZEB 2F8NG 3MNNB 5B32B 1TZYB 3LZ0A 5E5AD 5B24B 4WNNA 3X1UD 1KX4A 3O62A 3RELB 5BT1C 5F99D 4XUJB 1M19A 4H9RA 4ZBJC 2YFWA 3LJAD 3REJB 4J8UD 4J8VA 1F66A 5GT3D 5AY8A 4YM6A 5CPJB 3W99D 3KSYA 5B0ZA 2JSSA 5AVCB 4JJNC 4R8PA 4QLCA 3LZ0C 1KX4C 3REKD 2NQBD 3KUYA 3B6FD 5DNNA 4XZQD 3O62C 3MGQA 3B0DC 1JFIB 1M19C 3X1TA 4H9NB 5AV9B 3NQJB 4G92C 1M1AB 3VH5T 4J8VC 1F66C 4WV4B 5B2JD 3NQUA 5B40A 3MGSA 3AZGD 5B32D 5B0ZC 1KX5A 1EQZD 4EO5C 2RVQC 5JRGD 3X1SB 4R8PC 5CPIA 4QLCC 3W97A 4WU9B 1KX3B 3AZHB 3KUYC 5B1MB 4KHAA 4XUJD 5DNNC 3AZLA 3A6NA 4J8WB 3MGQC 5CPKA 4AWLC 3AZGC 3X1TC 1P3MD 1P3OD 4WU8A 3KXBB 5BS7A 3C1CB 2BYMB 1S32B 5B0YA 1ZLAA 3R45B 3AZMA 3REID 5CP6B 3MGSC 5B40C 4KUDB 1KX5C 3AFAA 5AV5B 4UUZA 5G49B 5CPIC 4NFTA 1P3BD 5B2ID 4LD9A 1P3KB 5AV6A 2HIOB 3AZLC 3WTPB 2CV5B 5AVBA 1N1JA 3LZ1D 3AZFD 4WU8C 5BS7C 4NE3A 4H9OA 5B0YC 1ZLAC 4KGCB 3AZNA 1P3ID 4Z5TB 3X1VA 3AZMC 4M6BA 5B31A 1M18A 1P3FA 3B6GD 3AYWB 2FJ7B 5KDMA 2AROA 3TU4B 1KX3D 5C3IB 2HUEB 4YS3A 5BO0A 3AZHD 4Z66B 3WAAD 5B1MD 3MGRA 5GT0A 1P3GB 5DNMB 5AV6C 5JA4B 3UTAA 5AVBC 3C1CD 1P3LA 3AZKB 1S32D 5GSUB 3REHB 3C1BA 4J8XB 1HQ3B 1ID3D 3W96A 1P3AA 4E45A 3W98C 5CP6D 3AZNC 4ZBJB 4X23B 3X1VC 3LELD 5GXQA 3AZJD 4Z2MH 5AV8D 5B31C 3MGPB 2F8ND 1M18C 5BNVB 1P3FC 5B1LB 2AROC 1WWIA 3UTBA 4YS3C 4WZSB 3AV1B 1P34D 1P3KD 1BH8A 3MGRC 5GT0C 3WTPD 2BYKA 3LZ0B 5E5AA 4ZUXB 4WNNB 3UTAC 1KX4B 1P3LC 3C1BC 5F99A 3W96C 3VH6A 1P3AC 1M19B 4H9RB 1H3OA 5BNXA 1F1EA 2YFWB 4JJNA 5GXQC 3LJAA 4J8UA 1F66B 3B0CW 5GT3A 5AY8B 4YM6B 5FUGA 3W99A 4Z66D 1HTAA 2NZDD 1B6WA 3UTBC 3WA9D 3KWQD 5DNMD 3AV2D 4EO5B 4R8PB 4QLCB 5E5AC 3X1UC 3AZKD 3REKA 5GSUD 2NQBA 3REHD 4J8XD 1P3PD 3KUYB 3B6FA 1HQ3D 4XZQA 3MGQB 5F99C 4H9PB 5B33D 4X23D 4CAYA 3MGPD 3LJAC 4H9QB 4J8UC 3AN2D 5B2JA 5B1LD 3UT9D 2PYOB 5GT3C 3W99C 3NQUB 3AZGA 1EQZA 1KX5B 5JRGA 4ZUXD 1ULYA 3V9RA 3W97B 2NQBC 3REKC 3WKJD 3B6FC 4XUJA 4XZQC 3AZLB 3A6NB 3AZED 5CPKB 3MNND 1P3MA 1P3OA 1TZYD 4WU8B 1Q9CA 5B24D 5B0YB 5AY8D 5B2JC 3RELD 4YM6D 1AOIB 3AZMB 5CHLB 3REIA 4H9SA 3REJD 2IO5B 5B32C 1EQZC 3AFAB 5JRGC 4UUZB 1P3BA 5B2IA 5CPJD 3RELC 4LD9B 4XUJC 5AV6B 1U35B 1JFIA 5AVBB 5AVCD 3LZ1A 4NE6A 3AZFA 1P3MC 1P3OC 2PYOD 1A7WA 1P3IA 3VH5A 3X1VB 3REIC 3AZIB 4H9SC 5AV9D 3B6GA 1P3FB 1M1AD 5KDMB 2AROB 3W97D 1KX3A 4YS3B 5BO0B 1P3BC 5B1MA 5B2IC 3W98A 3MGRB 3WAAA 3B0CT 5GT0B 3A6ND 5CPKD 2LY8A 3UTAB 3C1CA 3LZ1C 3AZFC 3X1SD 2BYMA 1S32A 1P3LB 4WU9D 3C1BB 3MVDB 1ID3A 1P3AB 3R45A 1AOID 5CP6A 4J8WD 1P3IC 3LELA 3AZJA 5AV8A 2F8NA 3KXBD 3AFAD 3B6GC 2YFVB 4Z2MG 5G49A 2L5AA 1KX3C 1TAFA 3AZHC 3WAAC 5B1MC 1P34A 1P3KA 1BH8B 1U35D 4LD9D 3WTPA 4KUDD 2BYKB 5E5AB 1BFMA 3C1CC 5AV5D 1S32C 5F99B 1ID3C 2HIOD 3AZID 5CP6C 3LELC 4JJNB 3LJAB 3AZJC 2CV5D 3X1UA 1R4VA 4NE5A 5AV8C 1KU5A 5GT3B 3O62B 4Z66A 3W99B 4KGCD 4E44A 3WTPE 3WA9A 3B0DB 2NZDA 3KWQA 4Z5TD 1P3KC 3AV2A 1P34C 2HIOC 1B67A 3WTPC 4G92B 3AYWD 4J8VB 2FJ7D 3AZKA 2NQBB 5GSUA 3REKB 3TU4D 4J8XA 1P3PA 3MVDD 3B6FB 1HQ3A 4DRBA 4XZQB 1P3GD 5B31G 3B0BA 5B33A 5B0ZB 2F8NK 3MGPA 4CSRA 3AN2A 5BT1D 3UT9A 5DNNB 2HUEC 1BH9A 4Z66C 2NZDC 2CWEA 3WA9C 1P3GC 3KWQC 5DNMC 4AWLB 3AZGB 3X1TB 3AV2C 1EQZB 5JRGB 4ZUXA 4G91C 4HGAC 3V9RB 3AZKC 5GSUC 3REHC 4J8XC 1P3PC 3WKJA 1HQ3C 2F8NH 3AV1D 3AZEA 5B40B 3MGSB 3VH6W 4X23C 3MNNA 5B33C 4JJND 5B32A 1TZYA 1P3MB 1P3OB 3LZ0D 5B24A 3MGPC 1KX4D 5CPIB 1WWSA 3AN2C
chains in the Genus database with same CATH superfamily
5B1LC 3O62D 3RELA 3UT9C 4KHAB 3REIB 1M19D 3AV1C 3REJA 4J8VD 1F66D 4ZUXC 1P3BB 5B2IB 1ZLAB 5CPJA 3WKJC 4H9PA 3H0RC 2JE5A 3AZEC 5B0ZD 5AVCA 3MNNC 3LZ1B 2RVQD 3AZFB 1TZYC 4R8PD 4QLCD 4H9QA 5B24C 4DRAA 3KUYD 2PYOA 5AY8C 5DNND 4YM6C 1P3IB 2VQRA 3MGQD 3X1TD 1N1JB 4H9NA 5AV9A 3NQJA 3B6GB 3REJC 1M1AA 4H9OB 2F2AC 3WAAB 3W98B 5CPJC 3AZNB 5B40D 3MGSD 5B31B 1M18B 1KX5D 5AVCC 1W2EA 3X1SA 5CPID 4WU9A 3AZHA 1ID3B 1AOIA 2PYOC 3AZLD 4J8WA 5B32G 3LELB 3AZJB 5AV8B 3KXBA 4WU8D 2F8NB 5AV9C 1M1AC 5B0YD 3W97C 1ZLAD 3W96B 1TAFB 3AZMD 1P34B 1U35A 3A6NC 5GXQB 5CPKC 2G5HC 4KUDA 5AV5A 3X1SC 4WU9C 3UTBB 3EG5B 1AOIC 2HIOA 5AV6D 3AZIA 3VH5W 4J8WC 2CV5A 5AVBD 3X1UB 2IO5C 3KXBC 3VH6T 3AFAC 4KGCA 2NZDB 3W98D 3WA9B 3AZND 4Z5TA 3KWQB 3X1VD 1H3OB 4LD9C 3AV2B 5BNXB 1U35C 5B31D 2Y2KA 1M18D 2FFFB 4G91B 4HGAB 4J8UB 3AYWA 1P3FD 2FJ7A 4KUDC 2AROD 3TU4A 1P3PB 2Y2LA 5AV5C 3MVDA 4YS3D 5FUGB 2DQNC 3MGRD 1P3GA 5GT0D 5DNMA 2Y2GA 5B33B 3EPLA 3AZIC 5JA4A 2CV5C 3UTAD 4CSRB 2YFVA 3AN2B 1P3LD 3REHA 3C1BD 3EPHA 3UT9B 3W96D 1P3AD 1BH9B 4KGCC 2Y2NA 4X23A 4Z5TC 4CAYB 5GXQD 2Y2PA 3FDDA 5BNVA 3AYWC 2FJ7C 5B2JB 5B1LA 3TU4C 3WKJB 5C3IC 3MVDC 3UTBD 3AV1A 3AZEB 2F8NG 3MNNB 5B32B 1TZYB 3LZ0A 5E5AD 5B24B 3H0MC 4WNNA 2Y2IA 3X1UD 1KX4A 3EPJA 3O62A 3RELB 5BT1C 5F99D 4XUJB 1M19A 4H9RA 4ZBJC 2YFWA 3LJAD 3REJB 2Y2HA 4J8UD 2ZM5A 4J8VA 1F66A 2ZY5A 5GT3D 5AY8A 4YM6A 5CPJB 3W99D 3KSYA 5B0ZA 2JSSA 5AVCB 4JJNC 4R8PA 4QLCA 3LZ0C 1KX4C 3REKD 2NQBD 3KUYA 3B6FD 5DNNA 4XZQD 3O62C 3MGQA 3B0DC 1JFIB 1M19C 3X1TA 4DQYB 4H9NB 5AV9B 3NQJB 4G92C 1M1AB 3VH5T 4J8VC 1F66C 4WV4B 1Z2CB 5B2JD 3NQUA 5B40A 3MGSA 3AZGD 5B32D 5B0ZC 1KX5A 1EQZD 4EO5C 2RVQC 5JRGD 3X1SB 4R8PC 5CPIA 4QLCC 3W97A 4WU9B 1KX3B 3AZHB 3KUYC 5B1MB 4KHAA 4XUJD 5DNNC 2Y2JA 3AZLA 3A6NA 4J8WB 3MGQC 5CPKA 4AWLC 3AZGC 3X1TC 1P3MD 1P3OD 4WU8A 3KXBB 5BS7A 3C1CB 2W8SA 2BYMB 1S32B 5B0YA 1ZLAA 1T3UA 3R45B 3AZMA 3REID 5CP6B 3MGSC 5B40C 4KUDB 1KX5C 3AFAA 5AV5B 4UUZA 5G49B 5CPIC 4NFTA 1P3BD 5B2ID 2G5IC 4LD9A 1P3KB 5AV6A 2HIOB 3AZLC 3WTPB 2CV5B 5AVBA 1N1JA 3LZ1D 3AZFD 4WU8C 5BS7C 4NE3A 4H9OA 5B0YC 1ZLAC 4KGCB 2BG1A 3AZNA 1P3ID 4Z5TB 3X1VA 3AZMC 4M6BA 5B31A 1M18A 1P3FA 3B6GD 3AYWB 2FJ7B 5KDMA 2AROA 3TU4B 1KX3D 5C3IB 2HUEB 4YS3A 5BO0A 3AZHD 4Z66B 3WAAD 5B1MD 3MGRA 5GT0A 1P3GB 5DNMB 5AV6C 5JA4B 3UTAA 5AVBC 3C1CD 1P3LA 3AZKB 1S32D 5GSUB 3REHB 3C1BA 4J8XB 1HQ3B 1ID3D 3W96A 1P3AA 4E45A 3W98C 5CP6D 3AZNC 4ZBJB 4X23B 3X1VC 3LELD 5GXQA 3AZJD 4Z2MH 5AV8D 5B31C 3MGPB 2F8ND 1M18C 5BNVB 1P3FC 5B1LB 2AROC 1WWIA 3UTBA 3H0LC 4YS3C 4WZSB 3AV1B 1P34D 1P3KD 1BH8A 3MGRC 5GT0C 3WTPD 2BYKA 3LZ0B 5E5AA 4ZUXB 4WNNB 3UTAC 1KX4B 1P3LC 3C1BC 5F99A 3W96C 3VH6A 1P3AC 1M19B 4H9RB 1H3OA 5BNXA 1F1EA 2YFWB 4JJNA 5GXQC 3LJAA 4J8UA 1F66B 3B0CW 5GT3A 5AY8B 4YM6B 5FUGA 3W99A 4Z66D 1HTAA 2NZDD 1B6WA 3UTBC 3WA9D 3KWQD 5DNMD 2ZY3A 3AV2D 4EO5B 4R8PB 4QLCB 5E5AC 3X1UC 3AZKD 3REKA 5GSUD 2NQBA 3REHD 4J8XD 1P3PD 3KUYB 3B6FA 1HQ3D 4XZQA 3MGQB 5F99C 4H9PB 5B33D 4X23D 4CAYA 3MGPD 3LJAC 4H9QB 4J8UC 2XD1A 3AN2D 5B2JA 5B1LD 3UT9D 2PYOB 5GT3C 3W99C 3NQUB 3AZGA 1EQZA 1KX5B 5JRGA 4ZUXD 3P5JB 1ULYA 3V9RA 3W97B 2NQBC 2XD5A 3REKC 3WKJD 3B6FC 4XUJA 4XZQC 3AZLB 3A6NB 3AZED 5CPKB 2JCHA 3MNND 1P3MA 1P3OA 1TZYD 4WU8B 1Q9CA 5B24D 5B0YB 5AY8D 5B2JC 3RELD 4YM6D 1AOIB 3AZMB 5CHLB 3REIA 1PZRA 3AL0C 4H9SA 3REJD 2IO5B 5B32C 1EQZC 3AFAB 5JRGC 4UUZB 1P3BA 2ZY4A 5B2IA 5CPJD 2J8PA 3RELC 4LD9B 4XUJC 5AV6B 1U35B 1JFIA 5AVBB 2Y2MA 5AVCD 3LZ1A 4NE6A 3AZFA 1P3MC 1P3OC 2PYOD 1A7WA 3A1KA 3VH5A 1P3IA 3X1VB 3REIC 3AZIB 4H9SC 5AV9D 3B6GA 1P3FB 3F6TA 1M1AD 5KDMB 2AROB 3W97D 1KX3A 4YS3B 5BO0B 1P3BC 5B1MA 5B2IC 3W98A 3MGRB 3WAAA 3B0CT 5GT0B 3A6ND 4WJ3C 5CPKD 2LY8A 2UWXA 3UTAB 3C1CA 3LZ1C 3AZFC 3X1SD 2BYMA 1S32A 1P3LB 4WU9D 3C1BB 3MVDB 1ID3A 1P3AB 3R45A 1AOID 5CP6A 4J8WD 1P3IC 3LELA 3AZJA 5AV8A 2F8NA 3KXBD 3AFAD 3B6GC 2YFVB 4Z2MG 5G49A 2L5AA 1KX3C 1TAFA 3AZHC 3WAAC 5B1MC 1P34A 1P3KA 1BH8B 1U35D 4LD9D 2Y2OA 3WTPA 2RIQA 2DF4C 2ZY2A 4KUDD 2BYKB 5E5AB 1BFMA 3C1CC 5AV5D 1S32C 5F99B 1ID3C 2HIOD 3AZID 5CP6C 3LELC 4JJNB 3LJAB 3AZJC 2CV5D 5AV8C 1R4VA 4NE5A 3X1UA 3EPKA 1KU5A 5GT3B 3A1IA 3O62B 4Z66A 3W99B 4KGCD 4E44A 3WTPE 3WA9A 3B0DB 3IP4C 3KWQA 4Z5TD 2NZDA 1P3KC 3AV2A 1P34C 2HIOC 1B67A 3WTPC 4G92B 3AYWD 4J8VB 2FJ7D 3AZKA 2NQBB 5GSUA 3REKB 3TU4D 4J8XA 1P3PA 3MVDD 3B6FB 1HQ3A 4DRBA 4XZQB 1P3GD 5B31G 3B0BA 5B33A 4UPKA 5B0ZB 2F8NK 3MGPA 4CSRA 3AN2A 5BT1D 3UT9A 2Y2QA 5DNNB 2HUEC 1BH9A 4Z66C 2NZDC 2CWEA 3WA9C 1P3GC 3KWQC 5DNMC 4AWLB 3AZGB 3X1TB 3KFUG 3AV2C 1EQZB 5JRGB 4ZUXA 4G91C 4HGAC 3V9RB 3AZKC 5GSUC 3REHC 4J8XC 1P3PC 3WKJA 1HQ3C 2F8NH 3AV1D 3AZEA 5B40B 3MGSB 3VH6W 4X23C 3MNNA 5B33C 4JJND 5B32A 1TZYA 1P3MB 1P3OB 3LZ0D 5B24A 3MGPC 1KX4D 5CPIB 1WWSA 3AN2C
chains in the Genus database with same CATH topology
5B1LC 3O62D 3RELA 3UT9C 4KHAB 3REIB 1M19D 3AV1C 3REJA 4J8VD 1F66D 4ZUXC 1P3BB 5B2IB 1ZLAB 5CPJA 3WKJC 4H9PA 3H0RC 2JE5A 3AZEC 5B0ZD 5AVCA 3MNNC 3LZ1B 2RVQD 3AZFB 1TZYC 4R8PD 4QLCD 4H9QA 5B24C 4DRAA 3KUYD 2PYOA 5AY8C 5DNND 4YM6C 1P3IB 2VQRA 3MGQD 3X1TD 1N1JB 4H9NA 5AV9A 3NQJA 3B6GB 3REJC 1M1AA 4H9OB 2F2AC 3WAAB 3W98B 5CPJC 3AZNB 5B40D 3MGSD 5B31B 1M18B 1KX5D 5AVCC 1W2EA 3X1SA 5CPID 4WU9A 3AZHA 1ID3B 1AOIA 2PYOC 3AZLD 4J8WA 5B32G 3LELB 3AZJB 5AV8B 3KXBA 4WU8D 2F8NB 5AV9C 1M1AC 5B0YD 3W97C 1ZLAD 3W96B 1TAFB 3AZMD 1P34B 1U35A 3A6NC 5GXQB 5CPKC 2G5HC 4KUDA 5AV5A 3X1SC 4WU9C 3UTBB 3EG5B 1AOIC 2HIOA 5AV6D 3AZIA 3VH5W 4J8WC 2CV5A 5AVBD 3X1UB 2IO5C 3KXBC 3VH6T 3AFAC 4KGCA 2NZDB 3W98D 3WA9B 3AZND 4Z5TA 3KWQB 3X1VD 1H3OB 4LD9C 3AV2B 5BNXB 1U35C 5B31D 2Y2KA 1M18D 2FFFB 4G91B 4HGAB 4J8UB 3AYWA 1P3FD 2FJ7A 4KUDC 2AROD 3TU4A 1P3PB 2Y2LA 5AV5C 3MVDA 4YS3D 5FUGB 2DQNC 3MGRD 1P3GA 5GT0D 5DNMA 2Y2GA 5B33B 3EPLA 3AZIC 5JA4A 2CV5C 3UTAD 4CSRB 2YFVA 3AN2B 1P3LD 3REHA 3C1BD 3EPHA 3UT9B 3W96D 1P3AD 1BH9B 4KGCC 2Y2NA 4X23A 4Z5TC 4CAYB 5GXQD 2Y2PA 3FDDA 5BNVA 3AYWC 2FJ7C 5B2JB 5B1LA 3TU4C 3WKJB 5C3IC 3MVDC 3UTBD 3AV1A 3AZEB 2F8NG 3MNNB 5B32B 1TZYB 3LZ0A 5E5AD 5B24B 3H0MC 4WNNA 2Y2IA 3X1UD 1KX4A 3EPJA 3O62A 3RELB 5BT1C 5F99D 4XUJB 1M19A 4H9RA 4ZBJC 2YFWA 3LJAD 3REJB 2Y2HA 4J8UD 2ZM5A 4J8VA 1F66A 2ZY5A 5GT3D 5AY8A 4YM6A 5CPJB 3W99D 3KSYA 5B0ZA 2JSSA 5AVCB 4JJNC 4R8PA 4QLCA 3LZ0C 1KX4C 3REKD 2NQBD 3KUYA 3B6FD 5DNNA 4XZQD 3O62C 3MGQA 3B0DC 1JFIB 1M19C 3X1TA 4DQYB 4H9NB 5AV9B 3NQJB 4G92C 1M1AB 3VH5T 4J8VC 1F66C 4WV4B 1Z2CB 5B2JD 3NQUA 5B40A 3MGSA 3AZGD 5B32D 5B0ZC 1KX5A 1EQZD 4EO5C 2RVQC 5JRGD 3X1SB 4R8PC 5CPIA 4QLCC 3W97A 4WU9B 1KX3B 3AZHB 3KUYC 5B1MB 4KHAA 4XUJD 5DNNC 2Y2JA 3AZLA 3A6NA 4J8WB 3MGQC 5CPKA 4AWLC 3AZGC 3X1TC 1P3MD 1P3OD 4WU8A 3KXBB 5BS7A 3C1CB 2W8SA 2BYMB 1S32B 5B0YA 1ZLAA 1T3UA 3R45B 3AZMA 3REID 5CP6B 3MGSC 5B40C 4KUDB 1KX5C 3AFAA 5AV5B 4UUZA 5G49B 5CPIC 4NFTA 1P3BD 5B2ID 2G5IC 4LD9A 1P3KB 5AV6A 2HIOB 3AZLC 3WTPB 2CV5B 5AVBA 1N1JA 3LZ1D 3AZFD 4WU8C 5BS7C 4NE3A 4H9OA 5B0YC 1ZLAC 4KGCB 2BG1A 3AZNA 1P3ID 4Z5TB 3X1VA 3AZMC 4M6BA 5B31A 1M18A 1P3FA 3B6GD 3AYWB 2FJ7B 5KDMA 2AROA 3TU4B 1KX3D 5C3IB 2HUEB 4YS3A 5BO0A 3AZHD 4Z66B 3WAAD 5B1MD 3MGRA 5GT0A 1P3GB 5DNMB 5AV6C 5JA4B 3UTAA 5AVBC 3C1CD 1P3LA 3AZKB 1S32D 5GSUB 3REHB 3C1BA 4J8XB 1HQ3B 1ID3D 3W96A 1P3AA 4E45A 3W98C 5CP6D 3AZNC 4ZBJB 4X23B 3X1VC 3LELD 5GXQA 3AZJD 4Z2MH 5AV8D 5B31C 3MGPB 2F8ND 1M18C 5BNVB 1P3FC 5B1LB 2AROC 1WWIA 3UTBA 3H0LC 4YS3C 4WZSB 3AV1B 1P34D 1P3KD 1BH8A 3MGRC 5GT0C 3WTPD 2BYKA 3LZ0B 5E5AA 4ZUXB 4WNNB 3UTAC 1KX4B 1P3LC 3C1BC 5F99A 3W96C 3VH6A 1P3AC 1M19B 4H9RB 1H3OA 5BNXA 1F1EA 2YFWB 4JJNA 5GXQC 3LJAA 4J8UA 1F66B 3B0CW 5GT3A 5AY8B 4YM6B 5FUGA 3W99A 4Z66D 1HTAA 2NZDD 1B6WA 3UTBC 3WA9D 3KWQD 5DNMD 2ZY3A 3AV2D 4EO5B 4R8PB 4QLCB 5E5AC 3X1UC 3AZKD 3REKA 5GSUD 2NQBA 3REHD 4J8XD 1P3PD 3KUYB 3B6FA 1HQ3D 4XZQA 3MGQB 5F99C 4H9PB 5B33D 4X23D 4CAYA 3MGPD 3LJAC 4H9QB 4J8UC 2XD1A 3AN2D 5B2JA 5B1LD 3UT9D 2PYOB 5GT3C 3W99C 3NQUB 3AZGA 1EQZA 1KX5B 5JRGA 4ZUXD 3P5JB 1ULYA 3V9RA 3W97B 2NQBC 2XD5A 3REKC 3WKJD 3B6FC 4XUJA 4XZQC 3AZLB 3A6NB 3AZED 5CPKB 2JCHA 3MNND 1P3MA 1P3OA 1TZYD 4WU8B 1Q9CA 5B24D 5B0YB 5AY8D 5B2JC 3RELD 4YM6D 1AOIB 3AZMB 5CHLB 3REIA 1PZRA 3AL0C 4H9SA 3REJD 2IO5B 5B32C 1EQZC 3AFAB 5JRGC 4UUZB 1P3BA 2ZY4A 5B2IA 5CPJD 2J8PA 3RELC 4LD9B 4XUJC 5AV6B 1U35B 1JFIA 5AVBB 2Y2MA 5AVCD 3LZ1A 4NE6A 3AZFA 1P3MC 1P3OC 2PYOD 1A7WA 3A1KA 3VH5A 1P3IA 3X1VB 3REIC 3AZIB 4H9SC 5AV9D 3B6GA 1P3FB 3F6TA 1M1AD 5KDMB 2AROB 3W97D 1KX3A 4YS3B 5BO0B 1P3BC 5B1MA 5B2IC 3W98A 3MGRB 3WAAA 3B0CT 5GT0B 3A6ND 4WJ3C 5CPKD 2LY8A 2UWXA 3UTAB 3C1CA 3LZ1C 3AZFC 3X1SD 2BYMA 1S32A 1P3LB 4WU9D 3C1BB 3MVDB 1ID3A 1P3AB 3R45A 1AOID 5CP6A 4J8WD 1P3IC 3LELA 3AZJA 5AV8A 2F8NA 3KXBD 3AFAD 3B6GC 2YFVB 4Z2MG 5G49A 2L5AA 1KX3C 1TAFA 3AZHC 3WAAC 5B1MC 1P34A 1P3KA 1BH8B 1U35D 4LD9D 2Y2OA 3WTPA 2RIQA 2DF4C 2ZY2A 4KUDD 2BYKB 5E5AB 1BFMA 3C1CC 5AV5D 1S32C 5F99B 1ID3C 2HIOD 3AZID 5CP6C 3LELC 4JJNB 3LJAB 3AZJC 2CV5D 5AV8C 1R4VA 4NE5A 3X1UA 3EPKA 1KU5A 5GT3B 3A1IA 3O62B 4Z66A 3W99B 4KGCD 4E44A 3WTPE 3WA9A 3B0DB 3IP4C 3KWQA 4Z5TD 2NZDA 1P3KC 3AV2A 1P34C 2HIOC 1B67A 3WTPC 4G92B 3AYWD 4J8VB 2FJ7D 3AZKA 2NQBB 5GSUA 3REKB 3TU4D 4J8XA 1P3PA 3MVDD 3B6FB 1HQ3A 4DRBA 4XZQB 1P3GD 5B31G 3B0BA 5B33A 4UPKA 5B0ZB 2F8NK 3MGPA 4CSRA 3AN2A 5BT1D 3UT9A 2Y2QA 5DNNB 2HUEC 1BH9A 4Z66C 2NZDC 2CWEA 3WA9C 1P3GC 3KWQC 5DNMC 4AWLB 3AZGB 3X1TB 3KFUG 3AV2C 1EQZB 5JRGB 4ZUXA 4G91C 4HGAC 3V9RB 3AZKC 5GSUC 3REHC 4J8XC 1P3PC 3WKJA 1HQ3C 2F8NH 3AV1D 3AZEA 5B40B 3MGSB 3VH6W 4X23C 3MNNA 5B33C 4JJND 5B32A 1TZYA 1P3MB 1P3OB 3LZ0D 5B24A 3MGPC 1KX4D 5CPIB 1WWSA 3AN2C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B1L C;  3O62 D;  3REL A;  3UT9 C;  4KHA B;  3REI B;  1M19 D;  3AV1 C;  3REJ A;  4J8V D;  1F66 D;  4ZUX C;  1P3B B;  5B2I B;  1ZLA B;  5CPJ A;  3WKJ C;  4H9P A;  3AZE C;  5B0Z D;  5AVC A;  3MNN C;  3LZ1 B;  2RVQ D;  3AZF B;  1TZY C;  4R8P D;  4QLC D;  4H9Q A;  5B24 C;  4DRA A;  3KUY D;  2PYO A;  5AY8 C;  5DNN D;  4YM6 C;  1P3I B;  3MGQ D;  3X1T D;  1N1J B;  4H9N A;  5AV9 A;  3NQJ A;  3B6G B;  3REJ C;  1M1A A;  4H9O B;  3WAA B;  3W98 B;  5CPJ C;  3AZN B;  5B40 D;  3MGS D;  5B31 B;  1M18 B;  1KX5 D;  5AVC C;  3X1S A;  5CPI D;  4WU9 A;  3AZH A;  1ID3 B;  1AOI A;  2PYO C;  3AZL D;  4J8W A;  5B32 G;  3LEL B;  3AZJ B;  5AV8 B;  3KXB A;  4WU8 D;  2F8N B;  5AV9 C;  1M1A C;  5B0Y D;  3W97 C;  1ZLA D;  3W96 B;  1TAF B;  3AZM D;  1P34 B;  1U35 A;  3A6N C;  5GXQ B;  5CPK C;  4KUD A;  5AV5 A;  3X1S C;  4WU9 C;  3UTB B;  1AOI C;  2HIO A;  5AV6 D;  3AZI A;  3VH5 W;  4J8W C;  2CV5 A;  5AVB D;  3X1U B;  2IO5 C;  3KXB C;  3VH6 T;  3AFA C;  4KGC A;  2NZD B;  3W98 D;  3WA9 B;  3AZN D;  4Z5T A;  3KWQ B;  3X1V D;  1H3O B;  4LD9 C;  3AV2 B;  5BNX B;  1U35 C;  5B31 D;  1M18 D;  1P3F D;  4G91 B;  4HGA B;  4J8U B;  3AYW A;  2FJ7 A;  4KUD C;  2ARO D;  3TU4 A;  1P3P B;  5AV5 C;  3MVD A;  4YS3 D;  5FUG B;  3MGR D;  1P3G A;  5GT0 D;  5DNM A;  5B33 B;  3AZI C;  5JA4 A;  2CV5 C;  3UTA D;  4CSR B;  2YFV A;  3AN2 B;  1P3L D;  3REH A;  3C1B D;  3UT9 B;  3W96 D;  1P3A D;  1BH9 B;  4KGC C;  4X23 A;  4Z5T C;  4CAY B;  5GXQ D;  5BNV A;  3AYW C;  2FJ7 C;  5B2J B;  5B1L A;  3TU4 C;  3WKJ B;  5C3I C;  3MVD C;  3UTB D;  3AV1 A;  3AZE B;  2F8N G;  3MNN B;  5B32 B;  1TZY B;  3LZ0 A;  5E5A D;  5B24 B;  4WNN A;  3X1U D;  1KX4 A;  3O62 A;  3REL B;  5BT1 C;  5F99 D;  4XUJ B;  1M19 A;  4H9R A;  4ZBJ C;  2YFW A;  3LJA D;  3REJ B;  4J8U D;  4J8V A;  1F66 A;  5GT3 D;  5AY8 A;  4YM6 A;  5CPJ B;  3W99 D;  3KSY A;  5B0Z A;  2JSS A;  5AVC B;  4JJN C;  4R8P A;  4QLC A;  3LZ0 C;  1KX4 C;  3REK D;  2NQB D;  3KUY A;  3B6F D;  5DNN A;  4XZQ D;  3O62 C;  3MGQ A;  3B0D C;  1JFI B;  1M19 C;  3X1T A;  4H9N B;  5AV9 B;  3NQJ B;  4G92 C;  1M1A B;  3VH5 T;  4J8V C;  1F66 C;  4WV4 B;  5B2J D;  3NQU A;  5B40 A;  3MGS A;  3AZG D;  5B32 D;  5B0Z C;  1KX5 A;  1EQZ D;  4EO5 C;  2RVQ C;  5JRG D;  3X1S B;  4R8P C;  5CPI A;  4QLC C;  3W97 A;  4WU9 B;  1KX3 B;  3AZH B;  3KUY C;  5B1M B;  4KHA A;  4XUJ D;  5DNN C;  3AZL A;  3A6N A;  4J8W B;  3MGQ C;  5CPK A;  4AWL C;  3AZG C;  3X1T C;  1P3M D;  1P3O D;  4WU8 A;  3KXB B;  5BS7 A;  3C1C B;  2BYM B;  1S32 B;  5B0Y A;  1ZLA A;  3R45 B;  3AZM A;  3REI D;  5CP6 B;  3MGS C;  5B40 C;  4KUD B;  1KX5 C;  3AFA A;  5AV5 B;  4UUZ A;  5G49 B;  5CPI C;  4NFT A;  1P3B D;  5B2I D;  4LD9 A;  1P3K B;  5AV6 A;  2HIO B;  3AZL C;  3WTP B;  2CV5 B;  5AVB A;  1N1J A;  3LZ1 D;  3AZF D;  4WU8 C;  5BS7 C;  4NE3 A;  4H9O A;  5B0Y C;  1ZLA C;  4KGC B;  3AZN A;  1P3I D;  4Z5T B;  3X1V A;  3AZM C;  4M6B A;  5B31 A;  1M18 A;  1P3F A;  3B6G D;  3AYW B;  2FJ7 B;  5KDM A;  2ARO A;  3TU4 B;  1KX3 D;  5C3I B;  2HUE B;  4YS3 A;  5BO0 A;  3AZH D;  4Z66 B;  3WAA D;  5B1M D;  3MGR A;  5GT0 A;  1P3G B;  5DNM B;  5AV6 C;  5JA4 B;  3UTA A;  5AVB C;  3C1C D;  1P3L A;  3AZK B;  1S32 D;  5GSU B;  3REH B;  3C1B A;  4J8X B;  1HQ3 B;  1ID3 D;  3W96 A;  1P3A A;  4E45 A;  3W98 C;  5CP6 D;  3AZN C;  4ZBJ B;  4X23 B;  3X1V C;  3LEL D;  5GXQ A;  3AZJ D;  4Z2M H;  5AV8 D;  5B31 C;  3MGP B;  2F8N D;  1M18 C;  5BNV B;  1P3F C;  5B1L B;  2ARO C;  1WWI A;  3UTB A;  4YS3 C;  4WZS B;  3AV1 B;  1P34 D;  1P3K D;  1BH8 A;  3MGR C;  5GT0 C;  3WTP D;  2BYK A;  3LZ0 B;  5E5A A;  4ZUX B;  4WNN B;  3UTA C;  1KX4 B;  1P3L C;  3C1B C;  5F99 A;  3W96 C;  3VH6 A;  1P3A C;  1M19 B;  4H9R B;  1H3O A;  5BNX A;  1F1E A;  2YFW B;  4JJN A;  5GXQ C;  3LJA A;  4J8U A;  1F66 B;  3B0C W;  5GT3 A;  5AY8 B;  4YM6 B;  5FUG A;  3W99 A;  4Z66 D;  1HTA A;  2NZD D;  1B6W A;  3UTB C;  3WA9 D;  3KWQ D;  5DNM D;  3AV2 D;  4EO5 B;  4R8P B;  4QLC B;  5E5A C;  3X1U C;  3AZK D;  3REK A;  5GSU D;  2NQB A;  3REH D;  4J8X D;  1P3P D;  3KUY B;  3B6F A;  1HQ3 D;  4XZQ A;  3MGQ B;  5F99 C;  4H9P B;  5B33 D;  4X23 D;  4CAY A;  3MGP D;  3LJA C;  4H9Q B;  4J8U C;  3AN2 D;  5B2J A;  5B1L D;  3UT9 D;  2PYO B;  5GT3 C;  3W99 C;  3NQU B;  3AZG A;  1EQZ A;  1KX5 B;  5JRG A;  4ZUX D;  1ULY A;  3V9R A;  3W97 B;  2NQB C;  3REK C;  3WKJ D;  3B6F C;  4XUJ A;  4XZQ C;  3AZL B;  3A6N B;  3AZE D;  5CPK B;  3MNN D;  1P3M A;  1P3O A;  1TZY D;  4WU8 B;  1Q9C A;  5B24 D;  5B0Y B;  5AY8 D;  5B2J C;  3REL D;  4YM6 D;  1AOI B;  3AZM B;  5CHL B;  3REI A;  4H9S A;  3REJ D;  2IO5 B;  5B32 C;  1EQZ C;  3AFA B;  5JRG C;  4UUZ B;  1P3B A;  5B2I A;  5CPJ D;  3REL C;  4LD9 B;  4XUJ C;  5AV6 B;  1U35 B;  1JFI A;  5AVB B;  5AVC D;  3LZ1 A;  4NE6 A;  3AZF A;  1P3M C;  1P3O C;  2PYO D;  1A7W A;  1P3I A;  3VH5 A;  3X1V B;  3REI C;  3AZI B;  4H9S C;  5AV9 D;  3B6G A;  1P3F B;  1M1A D;  5KDM B;  2ARO B;  3W97 D;  1KX3 A;  4YS3 B;  5BO0 B;  1P3B C;  5B1M A;  5B2I C;  3W98 A;  3MGR B;  3WAA A;  3B0C T;  5GT0 B;  3A6N D;  5CPK D;  2LY8 A;  3UTA B;  3C1C A;  3LZ1 C;  3AZF C;  3X1S D;  2BYM A;  1S32 A;  1P3L B;  4WU9 D;  3C1B B;  3MVD B;  1ID3 A;  1P3A B;  3R45 A;  1AOI D;  5CP6 A;  4J8W D;  1P3I C;  3LEL A;  3AZJ A;  5AV8 A;  2F8N A;  3KXB D;  3AFA D;  3B6G C;  2YFV B;  4Z2M G;  5G49 A;  2L5A A;  1KX3 C;  1TAF A;  3AZH C;  3WAA C;  5B1M C;  1P34 A;  1P3K A;  1BH8 B;  1U35 D;  4LD9 D;  3WTP A;  4KUD D;  2BYK B;  5E5A B;  1BFM A;  3C1C C;  5AV5 D;  1S32 C;  5F99 B;  1ID3 C;  2HIO D;  3AZI D;  5CP6 C;  3LEL C;  4JJN B;  3LJA B;  3AZJ C;  2CV5 D;  3X1U A;  1R4V A;  4NE5 A;  5AV8 C;  1KU5 A;  5GT3 B;  3O62 B;  4Z66 A;  3W99 B;  4KGC D;  4E44 A;  3WTP E;  3WA9 A;  3B0D B;  2NZD A;  3KWQ A;  4Z5T D;  1P3K C;  3AV2 A;  1P34 C;  2HIO C;  1B67 A;  3WTP C;  4G92 B;  3AYW D;  4J8V B;  2FJ7 D;  3AZK A;  2NQB B;  5GSU A;  3REK B;  3TU4 D;  4J8X A;  1P3P A;  3MVD D;  3B6F B;  1HQ3 A;  4DRB A;  4XZQ B;  1P3G D;  5B31 G;  3B0B A;  5B33 A;  5B0Z B;  2F8N K;  3MGP A;  4CSR A;  3AN2 A;  5BT1 D;  3UT9 A;  5DNN B;  2HUE C;  1BH9 A;  4Z66 C;  2NZD C;  2CWE A;  3WA9 C;  1P3G C;  3KWQ C;  5DNM C;  4AWL B;  3AZG B;  3X1T B;  3AV2 C;  1EQZ B;  5JRG B;  4ZUX A;  4G91 C;  4HGA C;  3V9R B;  3AZK C;  5GSU C;  3REH C;  4J8X C;  1P3P C;  3WKJ A;  1HQ3 C;  2F8N H;  3AV1 D;  3AZE A;  5B40 B;  3MGS B;  3VH6 W;  4X23 C;  3MNN A;  5B33 C;  4JJN D;  5B32 A;  1TZY A;  1P3M B;  1P3O B;  3LZ0 D;  5B24 A;  3MGP C;  1KX4 D;  5CPI B;  1WWS A;  3AN2 C; 
#chains in the Genus database with same CATH topology
 5B1L C;  3O62 D;  3REL A;  3UT9 C;  4KHA B;  3REI B;  1M19 D;  3AV1 C;  3REJ A;  4J8V D;  1F66 D;  4ZUX C;  1P3B B;  5B2I B;  1ZLA B;  5CPJ A;  3WKJ C;  4H9P A;  3H0R C;  2JE5 A;  3AZE C;  5B0Z D;  5AVC A;  3MNN C;  3LZ1 B;  2RVQ D;  3AZF B;  1TZY C;  4R8P D;  4QLC D;  4H9Q A;  5B24 C;  4DRA A;  3KUY D;  2PYO A;  5AY8 C;  5DNN D;  4YM6 C;  1P3I B;  2VQR A;  3MGQ D;  3X1T D;  1N1J B;  4H9N A;  5AV9 A;  3NQJ A;  3B6G B;  3REJ C;  1M1A A;  4H9O B;  2F2A C;  3WAA B;  3W98 B;  5CPJ C;  3AZN B;  5B40 D;  3MGS D;  5B31 B;  1M18 B;  1KX5 D;  5AVC C;  1W2E A;  3X1S A;  5CPI D;  4WU9 A;  3AZH A;  1ID3 B;  1AOI A;  2PYO C;  3AZL D;  4J8W A;  5B32 G;  3LEL B;  3AZJ B;  5AV8 B;  3KXB A;  4WU8 D;  2F8N B;  5AV9 C;  1M1A C;  5B0Y D;  3W97 C;  1ZLA D;  3W96 B;  1TAF B;  3AZM D;  1P34 B;  1U35 A;  3A6N C;  5GXQ B;  5CPK C;  2G5H C;  4KUD A;  5AV5 A;  3X1S C;  4WU9 C;  3UTB B;  3EG5 B;  1AOI C;  2HIO A;  5AV6 D;  3AZI A;  3VH5 W;  4J8W C;  2CV5 A;  5AVB D;  3X1U B;  2IO5 C;  3KXB C;  3VH6 T;  3AFA C;  4KGC A;  2NZD B;  3W98 D;  3WA9 B;  3AZN D;  4Z5T A;  3KWQ B;  3X1V D;  1H3O B;  4LD9 C;  3AV2 B;  5BNX B;  1U35 C;  5B31 D;  2Y2K A;  1M18 D;  2FFF B;  4G91 B;  4HGA B;  4J8U B;  3AYW A;  1P3F D;  2FJ7 A;  4KUD C;  2ARO D;  3TU4 A;  1P3P B;  2Y2L A;  5AV5 C;  3MVD A;  4YS3 D;  5FUG B;  2DQN C;  3MGR D;  1P3G A;  5GT0 D;  5DNM A;  2Y2G A;  5B33 B;  3EPL A;  3AZI C;  5JA4 A;  2CV5 C;  3UTA D;  4CSR B;  2YFV A;  3AN2 B;  1P3L D;  3REH A;  3C1B D;  3EPH A;  3UT9 B;  3W96 D;  1P3A D;  1BH9 B;  4KGC C;  2Y2N A;  4X23 A;  4Z5T C;  4CAY B;  5GXQ D;  2Y2P A;  3FDD A;  5BNV A;  3AYW C;  2FJ7 C;  5B2J B;  5B1L A;  3TU4 C;  3WKJ B;  5C3I C;  3MVD C;  3UTB D;  3AV1 A;  3AZE B;  2F8N G;  3MNN B;  5B32 B;  1TZY B;  3LZ0 A;  5E5A D;  5B24 B;  3H0M C;  4WNN A;  2Y2I A;  3X1U D;  1KX4 A;  3EPJ A;  3O62 A;  3REL B;  5BT1 C;  5F99 D;  4XUJ B;  1M19 A;  4H9R A;  4ZBJ C;  2YFW A;  3LJA D;  3REJ B;  2Y2H A;  4J8U D;  2ZM5 A;  4J8V A;  1F66 A;  2ZY5 A;  5GT3 D;  5AY8 A;  4YM6 A;  5CPJ B;  3W99 D;  3KSY A;  5B0Z A;  2JSS A;  5AVC B;  4JJN C;  4R8P A;  4QLC A;  3LZ0 C;  1KX4 C;  3REK D;  2NQB D;  3KUY A;  3B6F D;  5DNN A;  4XZQ D;  3O62 C;  3MGQ A;  3B0D C;  1JFI B;  1M19 C;  3X1T A;  4DQY B;  4H9N B;  5AV9 B;  3NQJ B;  4G92 C;  1M1A B;  3VH5 T;  4J8V C;  1F66 C;  4WV4 B;  1Z2C B;  5B2J D;  3NQU A;  5B40 A;  3MGS A;  3AZG D;  5B32 D;  5B0Z C;  1KX5 A;  1EQZ D;  4EO5 C;  2RVQ C;  5JRG D;  3X1S B;  4R8P C;  5CPI A;  4QLC C;  3W97 A;  4WU9 B;  1KX3 B;  3AZH B;  3KUY C;  5B1M B;  4KHA A;  4XUJ D;  5DNN C;  2Y2J A;  3AZL A;  3A6N A;  4J8W B;  3MGQ C;  5CPK A;  4AWL C;  3AZG C;  3X1T C;  1P3M D;  1P3O D;  4WU8 A;  3KXB B;  5BS7 A;  3C1C B;  2W8S A;  2BYM B;  1S32 B;  5B0Y A;  1ZLA A;  1T3U A;  3R45 B;  3AZM A;  3REI D;  5CP6 B;  3MGS C;  5B40 C;  4KUD B;  1KX5 C;  3AFA A;  5AV5 B;  4UUZ A;  5G49 B;  5CPI C;  4NFT A;  1P3B D;  5B2I D;  2G5I C;  4LD9 A;  1P3K B;  5AV6 A;  2HIO B;  3AZL C;  3WTP B;  2CV5 B;  5AVB A;  1N1J A;  3LZ1 D;  3AZF D;  4WU8 C;  5BS7 C;  4NE3 A;  4H9O A;  5B0Y C;  1ZLA C;  4KGC B;  2BG1 A;  3AZN A;  1P3I D;  4Z5T B;  3X1V A;  3AZM C;  4M6B A;  5B31 A;  1M18 A;  1P3F A;  3B6G D;  3AYW B;  2FJ7 B;  5KDM A;  2ARO A;  3TU4 B;  1KX3 D;  5C3I B;  2HUE B;  4YS3 A;  5BO0 A;  3AZH D;  4Z66 B;  3WAA D;  5B1M D;  3MGR A;  5GT0 A;  1P3G B;  5DNM B;  5AV6 C;  5JA4 B;  3UTA A;  5AVB C;  3C1C D;  1P3L A;  3AZK B;  1S32 D;  5GSU B;  3REH B;  3C1B A;  4J8X B;  1HQ3 B;  1ID3 D;  3W96 A;  1P3A A;  4E45 A;  3W98 C;  5CP6 D;  3AZN C;  4ZBJ B;  4X23 B;  3X1V C;  3LEL D;  5GXQ A;  3AZJ D;  4Z2M H;  5AV8 D;  5B31 C;  3MGP B;  2F8N D;  1M18 C;  5BNV B;  1P3F C;  5B1L B;  2ARO C;  1WWI A;  3UTB A;  3H0L C;  4YS3 C;  4WZS B;  3AV1 B;  1P34 D;  1P3K D;  1BH8 A;  3MGR C;  5GT0 C;  3WTP D;  2BYK A;  3LZ0 B;  5E5A A;  4ZUX B;  4WNN B;  3UTA C;  1KX4 B;  1P3L C;  3C1B C;  5F99 A;  3W96 C;  3VH6 A;  1P3A C;  1M19 B;  4H9R B;  1H3O A;  5BNX A;  1F1E A;  2YFW B;  4JJN A;  5GXQ C;  3LJA A;  4J8U A;  1F66 B;  3B0C W;  5GT3 A;  5AY8 B;  4YM6 B;  5FUG A;  3W99 A;  4Z66 D;  1HTA A;  2NZD D;  1B6W A;  3UTB C;  3WA9 D;  3KWQ D;  5DNM D;  2ZY3 A;  3AV2 D;  4EO5 B;  4R8P B;  4QLC B;  5E5A C;  3X1U C;  3AZK D;  3REK A;  5GSU D;  2NQB A;  3REH D;  4J8X D;  1P3P D;  3KUY B;  3B6F A;  1HQ3 D;  4XZQ A;  3MGQ B;  5F99 C;  4H9P B;  5B33 D;  4X23 D;  4CAY A;  3MGP D;  3LJA C;  4H9Q B;  4J8U C;  2XD1 A;  3AN2 D;  5B2J A;  5B1L D;  3UT9 D;  2PYO B;  5GT3 C;  3W99 C;  3NQU B;  3AZG A;  1EQZ A;  1KX5 B;  5JRG A;  4ZUX D;  3P5J B;  1ULY A;  3V9R A;  3W97 B;  2NQB C;  2XD5 A;  3REK C;  3WKJ D;  3B6F C;  4XUJ A;  4XZQ C;  3AZL B;  3A6N B;  3AZE D;  5CPK B;  2JCH A;  3MNN D;  1P3M A;  1P3O A;  1TZY D;  4WU8 B;  1Q9C A;  5B24 D;  5B0Y B;  5AY8 D;  5B2J C;  3REL D;  4YM6 D;  1AOI B;  3AZM B;  5CHL B;  3REI A;  1PZR A;  3AL0 C;  4H9S A;  3REJ D;  2IO5 B;  5B32 C;  1EQZ C;  3AFA B;  5JRG C;  4UUZ B;  1P3B A;  2ZY4 A;  5B2I A;  5CPJ D;  2J8P A;  3REL C;  4LD9 B;  4XUJ C;  5AV6 B;  1U35 B;  1JFI A;  5AVB B;  2Y2M A;  5AVC D;  3LZ1 A;  4NE6 A;  3AZF A;  1P3M C;  1P3O C;  2PYO D;  1A7W A;  3A1K A;  3VH5 A;  1P3I A;  3X1V B;  3REI C;  3AZI B;  4H9S C;  5AV9 D;  3B6G A;  1P3F B;  3F6T A;  1M1A D;  5KDM B;  2ARO B;  3W97 D;  1KX3 A;  4YS3 B;  5BO0 B;  1P3B C;  5B1M A;  5B2I C;  3W98 A;  3MGR B;  3WAA A;  3B0C T;  5GT0 B;  3A6N D;  4WJ3 C;  5CPK D;  2LY8 A;  2UWX A;  3UTA B;  3C1C A;  3LZ1 C;  3AZF C;  3X1S D;  2BYM A;  1S32 A;  1P3L B;  4WU9 D;  3C1B B;  3MVD B;  1ID3 A;  1P3A B;  3R45 A;  1AOI D;  5CP6 A;  4J8W D;  1P3I C;  3LEL A;  3AZJ A;  5AV8 A;  2F8N A;  3KXB D;  3AFA D;  3B6G C;  2YFV B;  4Z2M G;  5G49 A;  2L5A A;  1KX3 C;  1TAF A;  3AZH C;  3WAA C;  5B1M C;  1P34 A;  1P3K A;  1BH8 B;  1U35 D;  4LD9 D;  2Y2O A;  3WTP A;  2RIQ A;  2DF4 C;  2ZY2 A;  4KUD D;  2BYK B;  5E5A B;  1BFM A;  3C1C C;  5AV5 D;  1S32 C;  5F99 B;  1ID3 C;  2HIO D;  3AZI D;  5CP6 C;  3LEL C;  4JJN B;  3LJA B;  3AZJ C;  2CV5 D;  5AV8 C;  1R4V A;  4NE5 A;  3X1U A;  3EPK A;  1KU5 A;  5GT3 B;  3A1I A;  3O62 B;  4Z66 A;  3W99 B;  4KGC D;  4E44 A;  3WTP E;  3WA9 A;  3B0D B;  3IP4 C;  3KWQ A;  4Z5T D;  2NZD A;  1P3K C;  3AV2 A;  1P34 C;  2HIO C;  1B67 A;  3WTP C;  4G92 B;  3AYW D;  4J8V B;  2FJ7 D;  3AZK A;  2NQB B;  5GSU A;  3REK B;  3TU4 D;  4J8X A;  1P3P A;  3MVD D;  3B6F B;  1HQ3 A;  4DRB A;  4XZQ B;  1P3G D;  5B31 G;  3B0B A;  5B33 A;  4UPK A;  5B0Z B;  2F8N K;  3MGP A;  4CSR A;  3AN2 A;  5BT1 D;  3UT9 A;  2Y2Q A;  5DNN B;  2HUE C;  1BH9 A;  4Z66 C;  2NZD C;  2CWE A;  3WA9 C;  1P3G C;  3KWQ C;  5DNM C;  4AWL B;  3AZG B;  3X1T B;  3KFU G;  3AV2 C;  1EQZ B;  5JRG B;  4ZUX A;  4G91 C;  4HGA C;  3V9R B;  3AZK C;  5GSU C;  3REH C;  4J8X C;  1P3P C;  3WKJ A;  1HQ3 C;  2F8N H;  3AV1 D;  3AZE A;  5B40 B;  3MGS B;  3VH6 W;  4X23 C;  3MNN A;  5B33 C;  4JJN D;  5B32 A;  1TZY A;  1P3M B;  1P3O B;  3LZ0 D;  5B24 A;  3MGP C;  1KX4 D;  5CPI B;  1WWS A;  3AN2 C; 
#chains in the Genus database with same CATH homology
 5B1L C;  3O62 D;  3REL A;  3UT9 C;  4KHA B;  3REI B;  1M19 D;  3AV1 C;  3REJ A;  4J8V D;  1F66 D;  4ZUX C;  1P3B B;  5B2I B;  1ZLA B;  5CPJ A;  3WKJ C;  4H9P A;  3H0R C;  2JE5 A;  3AZE C;  5B0Z D;  5AVC A;  3MNN C;  3LZ1 B;  2RVQ D;  3AZF B;  1TZY C;  4R8P D;  4QLC D;  4H9Q A;  5B24 C;  4DRA A;  3KUY D;  2PYO A;  5AY8 C;  5DNN D;  4YM6 C;  1P3I B;  2VQR A;  3MGQ D;  3X1T D;  1N1J B;  4H9N A;  5AV9 A;  3NQJ A;  3B6G B;  3REJ C;  1M1A A;  4H9O B;  2F2A C;  3WAA B;  3W98 B;  5CPJ C;  3AZN B;  5B40 D;  3MGS D;  5B31 B;  1M18 B;  1KX5 D;  5AVC C;  1W2E A;  3X1S A;  5CPI D;  4WU9 A;  3AZH A;  1ID3 B;  1AOI A;  2PYO C;  3AZL D;  4J8W A;  5B32 G;  3LEL B;  3AZJ B;  5AV8 B;  3KXB A;  4WU8 D;  2F8N B;  5AV9 C;  1M1A C;  5B0Y D;  3W97 C;  1ZLA D;  3W96 B;  1TAF B;  3AZM D;  1P34 B;  1U35 A;  3A6N C;  5GXQ B;  5CPK C;  2G5H C;  4KUD A;  5AV5 A;  3X1S C;  4WU9 C;  3UTB B;  3EG5 B;  1AOI C;  2HIO A;  5AV6 D;  3AZI A;  3VH5 W;  4J8W C;  2CV5 A;  5AVB D;  3X1U B;  2IO5 C;  3KXB C;  3VH6 T;  3AFA C;  4KGC A;  2NZD B;  3W98 D;  3WA9 B;  3AZN D;  4Z5T A;  3KWQ B;  3X1V D;  1H3O B;  4LD9 C;  3AV2 B;  5BNX B;  1U35 C;  5B31 D;  2Y2K A;  1M18 D;  2FFF B;  4G91 B;  4HGA B;  4J8U B;  3AYW A;  1P3F D;  2FJ7 A;  4KUD C;  2ARO D;  3TU4 A;  1P3P B;  2Y2L A;  5AV5 C;  3MVD A;  4YS3 D;  5FUG B;  2DQN C;  3MGR D;  1P3G A;  5GT0 D;  5DNM A;  2Y2G A;  5B33 B;  3EPL A;  3AZI C;  5JA4 A;  2CV5 C;  3UTA D;  4CSR B;  2YFV A;  3AN2 B;  1P3L D;  3REH A;  3C1B D;  3EPH A;  3UT9 B;  3W96 D;  1P3A D;  1BH9 B;  4KGC C;  2Y2N A;  4X23 A;  4Z5T C;  4CAY B;  5GXQ D;  2Y2P A;  3FDD A;  5BNV A;  3AYW C;  2FJ7 C;  5B2J B;  5B1L A;  3TU4 C;  3WKJ B;  5C3I C;  3MVD C;  3UTB D;  3AV1 A;  3AZE B;  2F8N G;  3MNN B;  5B32 B;  1TZY B;  3LZ0 A;  5E5A D;  5B24 B;  3H0M C;  4WNN A;  2Y2I A;  3X1U D;  1KX4 A;  3EPJ A;  3O62 A;  3REL B;  5BT1 C;  5F99 D;  4XUJ B;  1M19 A;  4H9R A;  4ZBJ C;  2YFW A;  3LJA D;  3REJ B;  2Y2H A;  4J8U D;  2ZM5 A;  4J8V A;  1F66 A;  2ZY5 A;  5GT3 D;  5AY8 A;  4YM6 A;  5CPJ B;  3W99 D;  3KSY A;  5B0Z A;  2JSS A;  5AVC B;  4JJN C;  4R8P A;  4QLC A;  3LZ0 C;  1KX4 C;  3REK D;  2NQB D;  3KUY A;  3B6F D;  5DNN A;  4XZQ D;  3O62 C;  3MGQ A;  3B0D C;  1JFI B;  1M19 C;  3X1T A;  4DQY B;  4H9N B;  5AV9 B;  3NQJ B;  4G92 C;  1M1A B;  3VH5 T;  4J8V C;  1F66 C;  4WV4 B;  1Z2C B;  5B2J D;  3NQU A;  5B40 A;  3MGS A;  3AZG D;  5B32 D;  5B0Z C;  1KX5 A;  1EQZ D;  4EO5 C;  2RVQ C;  5JRG D;  3X1S B;  4R8P C;  5CPI A;  4QLC C;  3W97 A;  4WU9 B;  1KX3 B;  3AZH B;  3KUY C;  5B1M B;  4KHA A;  4XUJ D;  5DNN C;  2Y2J A;  3AZL A;  3A6N A;  4J8W B;  3MGQ C;  5CPK A;  4AWL C;  3AZG C;  3X1T C;  1P3M D;  1P3O D;  4WU8 A;  3KXB B;  5BS7 A;  3C1C B;  2W8S A;  2BYM B;  1S32 B;  5B0Y A;  1ZLA A;  1T3U A;  3R45 B;  3AZM A;  3REI D;  5CP6 B;  3MGS C;  5B40 C;  4KUD B;  1KX5 C;  3AFA A;  5AV5 B;  4UUZ A;  5G49 B;  5CPI C;  4NFT A;  1P3B D;  5B2I D;  2G5I C;  4LD9 A;  1P3K B;  5AV6 A;  2HIO B;  3AZL C;  3WTP B;  2CV5 B;  5AVB A;  1N1J A;  3LZ1 D;  3AZF D;  4WU8 C;  5BS7 C;  4NE3 A;  4H9O A;  5B0Y C;  1ZLA C;  4KGC B;  2BG1 A;  3AZN A;  1P3I D;  4Z5T B;  3X1V A;  3AZM C;  4M6B A;  5B31 A;  1M18 A;  1P3F A;  3B6G D;  3AYW B;  2FJ7 B;  5KDM A;  2ARO A;  3TU4 B;  1KX3 D;  5C3I B;  2HUE B;  4YS3 A;  5BO0 A;  3AZH D;  4Z66 B;  3WAA D;  5B1M D;  3MGR A;  5GT0 A;  1P3G B;  5DNM B;  5AV6 C;  5JA4 B;  3UTA A;  5AVB C;  3C1C D;  1P3L A;  3AZK B;  1S32 D;  5GSU B;  3REH B;  3C1B A;  4J8X B;  1HQ3 B;  1ID3 D;  3W96 A;  1P3A A;  4E45 A;  3W98 C;  5CP6 D;  3AZN C;  4ZBJ B;  4X23 B;  3X1V C;  3LEL D;  5GXQ A;  3AZJ D;  4Z2M H;  5AV8 D;  5B31 C;  3MGP B;  2F8N D;  1M18 C;  5BNV B;  1P3F C;  5B1L B;  2ARO C;  1WWI A;  3UTB A;  3H0L C;  4YS3 C;  4WZS B;  3AV1 B;  1P34 D;  1P3K D;  1BH8 A;  3MGR C;  5GT0 C;  3WTP D;  2BYK A;  3LZ0 B;  5E5A A;  4ZUX B;  4WNN B;  3UTA C;  1KX4 B;  1P3L C;  3C1B C;  5F99 A;  3W96 C;  3VH6 A;  1P3A C;  1M19 B;  4H9R B;  1H3O A;  5BNX A;  1F1E A;  2YFW B;  4JJN A;  5GXQ C;  3LJA A;  4J8U A;  1F66 B;  3B0C W;  5GT3 A;  5AY8 B;  4YM6 B;  5FUG A;  3W99 A;  4Z66 D;  1HTA A;  2NZD D;  1B6W A;  3UTB C;  3WA9 D;  3KWQ D;  5DNM D;  2ZY3 A;  3AV2 D;  4EO5 B;  4R8P B;  4QLC B;  5E5A C;  3X1U C;  3AZK D;  3REK A;  5GSU D;  2NQB A;  3REH D;  4J8X D;  1P3P D;  3KUY B;  3B6F A;  1HQ3 D;  4XZQ A;  3MGQ B;  5F99 C;  4H9P B;  5B33 D;  4X23 D;  4CAY A;  3MGP D;  3LJA C;  4H9Q B;  4J8U C;  2XD1 A;  3AN2 D;  5B2J A;  5B1L D;  3UT9 D;  2PYO B;  5GT3 C;  3W99 C;  3NQU B;  3AZG A;  1EQZ A;  1KX5 B;  5JRG A;  4ZUX D;  3P5J B;  1ULY A;  3V9R A;  3W97 B;  2NQB C;  2XD5 A;  3REK C;  3WKJ D;  3B6F C;  4XUJ A;  4XZQ C;  3AZL B;  3A6N B;  3AZE D;  5CPK B;  2JCH A;  3MNN D;  1P3M A;  1P3O A;  1TZY D;  4WU8 B;  1Q9C A;  5B24 D;  5B0Y B;  5AY8 D;  5B2J C;  3REL D;  4YM6 D;  1AOI B;  3AZM B;  5CHL B;  3REI A;  1PZR A;  3AL0 C;  4H9S A;  3REJ D;  2IO5 B;  5B32 C;  1EQZ C;  3AFA B;  5JRG C;  4UUZ B;  1P3B A;  2ZY4 A;  5B2I A;  5CPJ D;  2J8P A;  3REL C;  4LD9 B;  4XUJ C;  5AV6 B;  1U35 B;  1JFI A;  5AVB B;  2Y2M A;  5AVC D;  3LZ1 A;  4NE6 A;  3AZF A;  1P3M C;  1P3O C;  2PYO D;  1A7W A;  3A1K A;  3VH5 A;  1P3I A;  3X1V B;  3REI C;  3AZI B;  4H9S C;  5AV9 D;  3B6G A;  1P3F B;  3F6T A;  1M1A D;  5KDM B;  2ARO B;  3W97 D;  1KX3 A;  4YS3 B;  5BO0 B;  1P3B C;  5B1M A;  5B2I C;  3W98 A;  3MGR B;  3WAA A;  3B0C T;  5GT0 B;  3A6N D;  4WJ3 C;  5CPK D;  2LY8 A;  2UWX A;  3UTA B;  3C1C A;  3LZ1 C;  3AZF C;  3X1S D;  2BYM A;  1S32 A;  1P3L B;  4WU9 D;  3C1B B;  3MVD B;  1ID3 A;  1P3A B;  3R45 A;  1AOI D;  5CP6 A;  4J8W D;  1P3I C;  3LEL A;  3AZJ A;  5AV8 A;  2F8N A;  3KXB D;  3AFA D;  3B6G C;  2YFV B;  4Z2M G;  5G49 A;  2L5A A;  1KX3 C;  1TAF A;  3AZH C;  3WAA C;  5B1M C;  1P34 A;  1P3K A;  1BH8 B;  1U35 D;  4LD9 D;  2Y2O A;  3WTP A;  2RIQ A;  2DF4 C;  2ZY2 A;  4KUD D;  2BYK B;  5E5A B;  1BFM A;  3C1C C;  5AV5 D;  1S32 C;  5F99 B;  1ID3 C;  2HIO D;  3AZI D;  5CP6 C;  3LEL C;  4JJN B;  3LJA B;  3AZJ C;  2CV5 D;  5AV8 C;  1R4V A;  4NE5 A;  3X1U A;  3EPK A;  1KU5 A;  5GT3 B;  3A1I A;  3O62 B;  4Z66 A;  3W99 B;  4KGC D;  4E44 A;  3WTP E;  3WA9 A;  3B0D B;  3IP4 C;  3KWQ A;  4Z5T D;  2NZD A;  1P3K C;  3AV2 A;  1P34 C;  2HIO C;  1B67 A;  3WTP C;  4G92 B;  3AYW D;  4J8V B;  2FJ7 D;  3AZK A;  2NQB B;  5GSU A;  3REK B;  3TU4 D;  4J8X A;  1P3P A;  3MVD D;  3B6F B;  1HQ3 A;  4DRB A;  4XZQ B;  1P3G D;  5B31 G;  3B0B A;  5B33 A;  4UPK A;  5B0Z B;  2F8N K;  3MGP A;  4CSR A;  3AN2 A;  5BT1 D;  3UT9 A;  2Y2Q A;  5DNN B;  2HUE C;  1BH9 A;  4Z66 C;  2NZD C;  2CWE A;  3WA9 C;  1P3G C;  3KWQ C;  5DNM C;  4AWL B;  3AZG B;  3X1T B;  3KFU G;  3AV2 C;  1EQZ B;  5JRG B;  4ZUX A;  4G91 C;  4HGA C;  3V9R B;  3AZK C;  5GSU C;  3REH C;  4J8X C;  1P3P C;  3WKJ A;  1HQ3 C;  2F8N H;  3AV1 D;  3AZE A;  5B40 B;  3MGS B;  3VH6 W;  4X23 C;  3MNN A;  5B33 C;  4JJN D;  5B32 A;  1TZY A;  1P3M B;  1P3O B;  3LZ0 D;  5B24 A;  3MGP C;  1KX4 D;  5CPI B;  1WWS A;  3AN2 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...