4KUDB

Crystal structure of n-terminal acetylated sir3 bah domain d205n mutant in complex with yeast nucleosome core particle
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
88
structure length
88
Chain Sequence
AKRHRKILRDNIQGITKPAIRRLARRGGVKRISGLIYEEVRAVLKSFLESVIRDSVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/transcription/dna
molecule keywords Histone H3
publication title N alpha-acetylated Sir3 stabilizes the conformation of a nucleosome-binding loop in the BAH domain
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 25
structure length 88
sequence length 88
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4kudB00
2YFWB 4WU9A 3AZEB 4CSRB 3B6FB 3AV1A 4J8WD 4Z66B 1P3PB 5BO0B 1P3FB 1P3BA 4YS3A 4XZQB 5AV8A 3UTBC 1JFIA 3KWQB 5B2JB 3REKB 2HUEC 5BNVB 5C3IC 1ID3D 5CPJC 3UT9A 5DNMA 2NZDB 3X1VB 3AZIC 5AVCD 3AYWA 3KSYA 5B0ZD 2CV5C 2FJ7A 3W97A 1P3LA 3O62C 5BNXB 3REJD 5B0YB 5G49B 3B0DB 4AWLC 4R8PA 1P3KD 5GT3A 3AZED 4HGAB 3B6FD 2HIOC 5B24B 4Z66D 3AFAC 3AN2C 3WTPE 1TZYD 1HTAA 1P3FD 4H9QB 3MGRA 5DNNC 3KWQD 3AZJC 1EQZB 4QLCA 5CPKB 4KGCC 2YFVB 1R4VA 5CPIC 5JA4B 1P3GC 3WKJC 4JJNC 4J8XB 4LD9C 3AZLC 3W99B 4CAYA 3MNND 3X1VD 5AVBB 4WZSB 5B31A 4Z2MH 5JRGC 1ZLAA 2F8NG 3REHC 3X1SA 3X1TC 5B40B 2AROB 4KHAA 3W96B 1P3MA 5E5AD 5AV6B 5B24D 1M18C 1P3OB 1N1JA 3KUYD 3C1CA 5AV5C 3AZGC 3MGPA 3AV2B 1S32C 3TU4A 3WA9D 4EO5B 1KX5D 1EQZD 3MGQD 4J8UC 4NE5A 3REIC 4J8XD 3W99D 3AV1B 3LELC 2PYOC 3AZMC 4YS3B 5BS7C 5AV8B 3A6ND 1JFIB 2NQBC 4M6BA 3RELB 4ZUXA 4J8VA 1KX4A 3AZHA 5GXQD 3LJAA 3MGSB 5B40D 3UT9B 5DNMB 3LZ0A 3AYWB 3W96D 5F99C 2FJ7B 5B2IA 3W97B 3AZFA 5AV6D 1F1EA 3AV2D 1U35C 4X23B 4Z5TA 3W98A 4J8WC 2BYKA 4R8PB 4H9OA 5GT3B 3AV1D 3LZ1D 4YS3D 5AV8D 3MGRB 3B6GA 4QLCB 3RELD 5AVCC 5B0ZC 1AOIA 3WAAB 3MGSD 2F8NA 3REJC 4CAYB 3NQUA 3AYWD 2FJ7D 5BT1C 5GSUB 5B31B 1BH9A 2L5AA 5B1LD 1P3KC 4WU8B 4X23D 1KU5A 3AZKD 1ZLAB 3WTPC 3X1SB 5GT0C 3B6FC 3UTBA 5CP6C 4R8PD 1TZYC 4XUJD 1P3FC 3VH6A 1P3MB 3KWQC 3VH6W 5CPJA 3C1CB 3MGPB 3MGRD 2CV5A 3MNNC 3O62A 4QLCD 2CWEA 3WAAD 1M1AC 1F66D 1Q9CA 5GSUD 5B32G 3C1BD 4G92B 2HIOA 4ZUXB 5B33C 4WU8D 4J8VB 1KX4B 3AZHB 3X1SD 5E5AC 5DNNA 5B24C 4YM6B 3UTAD 4ZBJB 3LZ0B 3KUYC 3AZJA 5CPIA 1P3GA 3WA9C 4JJNA 3WKJA 4LD9A 2IO5C 1KX5C 3MGQC 1P34D 3C1CD 4Z5TB 4J8XC 3W98B 3W99C 1B67A 2BYKB 5JRGA 4H9OB 3A6NC 3REHA 3X1TA 3R45A 4H9PA 1H3OB 5GXQC 1P3PD 5KDMA 3B6GB 3KXBA 3MVDA 4XZQD 4ZUXD 3W96C 4UUZB 4J8VD 1M18A 3AZGA 1KX4D 5AV5A 3AZHD 5B2JD 3REKD 1S32A 1AOIB 2F8NB 4YM6D 3NQUB 4J8UA 2NZDD 3REIA 4EO5C 3LELA 2PYOA 4Z5TD 3AZMA 3W98D 5BS7A 4G91C 5AY8C 3UTBB 2NQBA 5B0YD 3LZ1C 4KUDA 1M19C 4YS3C 5C3IB 1P3IB 3VH5W 3RELC 5CPJB 3X1UB 3AZNA 3MGSC 1KX3B 1U35A 1AOID 5FUGA 5CPKD 4NFTA 4WNNA 5B1LC 4WU9B 4AWLB 4X23C 3AZKC 1P3BB 5AVBD 2HIOB 4XUJC 1P3AC 2JSSA 5DNNB 5B1MC 3AZJB 5AVCA 2AROD 5CPIB 1P3ID 1P3GB 5AV9A 4JJNB 3V9RA 3REJA 3VH6T 3X1UD 1P3LB 5B32C 3WAAC 1P3OD 1F66C 5JRGB 1P3KA 1KX3D 5CHLB 2YFWA 5GSUC 3REHB 3WTPA 5GT0A 3C1BC 3R45B 4H9PB 4WU9D 4WU8C 5CP6A 1TZYA 1P3FA 4WV4B 5KDMB 3KXBB 3UTAC 3MVDB 1P3BD 1M18B 1ID3C 3AZGB 4H9NA 1S32B 5DNND 4DRBA 3MNNA 1P34C 3C1CC 3UT9D 5DNMD 3REIB 1M1AA 1HQ3A 3LELB 1P3LD 2PYOB 3W97D 3AZMB 2NQBB 3AZEC 4KUDB 4E44A 5B33A 4Z66C 1P3PC 4NE3A 4KHAB 5E5AA 5GT3D 4XZQC 2RVQD 4J8VC 3KUYA 1KX4C 2BYMA 3AZHC 5B2JC 3REKC 3AZNB 1N1JB 4YM6C 3KXBD 3AZIA 3MVDD 3WA9A 1KX5A 3MGQA 3TU4B 2YFVA 2NZDC 3X1VC 1U35B 5FUGB 4J8XA 1WWIA 4WNNB 3B0BA 4Z5TC 3B0CW 3A6NA 5B0YC 3LELD 1B6WA 5B31D 3B0DC 3AZMD 3AFAA 5GXQA 3AN2A 2NQBD 1ZLAD 4KUDD 4HGAC 3LJAB 3W96A 5AVCB 1ULYA 5AV9B 1P3MD 4KGCA 3V9RB 5B2IB 3AZFB 1EQZC 3AZLA 1AOIC 5CPKC 3AZND 3MGPD 3TU4D 1P3KB 1U35D 3WTPB 5GT0B 5AY8A 5AVBC 5CP6B 3LZ1A 1TZYB 1M19A 2F8NK 3RELA 5B40C 2AROC 1P3IC 4H9NB 3MGSA 3MNNB 3LJAD 3X1UC 5AV6C 1TAFA 1P3OC 3LZ0D 5AV9D 3AV2C 4H9SC 1HQ3B 1M1AB 5B2ID 5B1LA 3AZFD 1KX3C 1BH9B 4X23A 3AZKA 5BT1D 4WU9C 4XUJA 3AV1C 5B33B 1P3AA 3VH5A 3WTPD 5E5AB 5GT0D 1P3BC 2HUEB 5AV8C 5B1MA 5CP6D 3KUYB 2BYMB 3WA9B 3AZIB 2IO5B 5F99A 1KX5B 2CV5B 3MGQB 3B6GD 3UT9C 5DNMC 2LY8A 5B32A 3O62B 3WAAA 3AYWC 2FJ7C 1BFMA 1F66A 1P3LC 3W97C 2F8ND 4J8WA 3A6NB 5GSUA 1M1AD 1HQ3D 3C1BA 4WU8A 4R8PC 3AFAB 5GXQB 3AN2B 5GT3C 3NQJA 3UTAA 2RVQC 5B33D 3UTBD 1ID3A 3KXBC 3MVDC 4KGCB 1A7WA 1BH8A 5B0ZA 3MGRC 1P34A 3WKJB 4LD9B 3AZLB 4QLCC 5CPJD 3AZID 4H9RA 2CV5D 1WWSA 3O62D 4G91B 5AY8B 5B31C 3AZEA 4CSRA 3LZ1B 3X1TB 1M19B 3B6FA 4Z66A 1P3PA 5BO0A 3B0CT 1ZLAC 4KUDC 3X1SC 4XZQA 3KWQA 2HIOD 3AFAD 5B2JA 3REKA 3AN2D 1P3MC 5BNVA 5AV5B 4YM6A 1TAFB 3AZNC 2NZDA 3AZJD 3X1VA 3MGPC 4J8UB 4KGCD 5CPID 1P3GD 3TU4C 5B1LB 4E45A 4JJND 3WKJD 4LD9D 3AZLD 3AZKB 5BNXA 5B0YA 5G49A 4XUJB 1P3AB 5JRGD 5AY8D 4DRAA 5B1MB 3REHD 3X1TD 4G92C 1M19D 1H3OA 5B24A 4ZUXC 4H9QA 3LJAC 5F99B 4Z2MG 4UUZA 4ZBJC 5B32B 5AV9C 3LZ0C 5CPKA 1M18D 1EQZA 3AZGD 5AV5D 5JA4A 5B2IC 1S32D 1F66B 3AZFC 3W99A 4J8WB 4J8UD 3W98C 3C1BB 5AVBA 3REID 2PYOD 3NQJB 3UTAB 1P3AD 1ID3B 5B40A 2AROA 1P3IA 1BH8B 5B1MD 5B31G 5B0ZB 1P34B 3B6GC 3VH5T 3X1UA 5AV6A 3REJB 4NE6A 1P3OA 2F8NH 3AV2A 4H9SA 5F99D 4H9RB 1KX3A 5B32D 1HQ3C
chains in the Genus database with same CATH superfamily
2YFWB 4WU9A 3AZEB 4CSRB 3B6FB 3AV1A 4J8WD 4Z66B 2G5HC 1P3PB 5BO0B 1P3FB 1P3BA 4YS3A 4XZQB 5AV8A 3UTBC 1JFIA 3KWQB 2F2AC 5B2JB 3REKB 2HUEC 5BNVB 5C3IC 1ID3D 5CPJC 3UT9A 5DNMA 2NZDB 3X1VB 3AZIC 5AVCD 3AYWA 3KSYA 5B0ZD 2Y2MA 2CV5C 2FJ7A 3W97A 1P3LA 3O62C 5BNXB 3REJD 5B0YB 5G49B 3B0DB 4AWLC 4R8PA 1P3KD 5GT3A 3AZED 4HGAB 3B6FD 2HIOC 5B24B 4Z66D 3AFAC 3AN2C 3WTPE 1TZYD 1HTAA 1P3FD 4H9QB 3MGRA 5DNNC 3KWQD 3AZJC 1EQZB 4QLCA 5CPKB 4KGCC 2YFVB 1R4VA 5CPIC 5JA4B 1P3GC 3WKJC 4JJNC 4J8XB 4LD9C 3AZLC 3W99B 4CAYA 3MNND 3X1VD 5AVBB 4WZSB 5B31A 4Z2MH 5JRGC 1ZLAA 2F8NG 3REHC 3X1SA 3X1TC 5B40B 2AROB 4KHAA 3W96B 1P3MA 5E5AD 5AV6B 5B24D 2BG1A 1M18C 1P3OB 1N1JA 3KUYD 3C1CA 5AV5C 3AZGC 3MGPA 3AV2B 1S32C 2DQNC 3TU4A 3WA9D 4EO5B 1KX5D 1EQZD 3MGQD 4J8UC 4NE5A 3REIC 4J8XD 3W99D 3AV1B 3LELC 2PYOC 3EPKA 3AZMC 4YS3B 5BS7C 5AV8B 3A6ND 1JFIB 2NQBC 4M6BA 3RELB 4ZUXA 4J8VA 1KX4A 3AZHA 5GXQD 3LJAA 3FDDA 3MGSB 2JCHA 3A1KA 5B40D 3UT9B 5DNMB 3LZ0A 3AYWB 3W96D 5F99C 2FJ7B 5B2IA 3W97B 3AZFA 5AV6D 1F1EA 3AV2D 1U35C 4X23B 4Z5TA 3W98A 4J8WC 2BYKA 4R8PB 4H9OA 5GT3B 3AV1D 3LZ1D 4YS3D 5AV8D 3MGRB 3B6GA 4QLCB 3RELD 2Y2IA 5AVCC 5B0ZC 1AOIA 3WAAB 3MGSD 2F8NA 3REJC 4CAYB 3NQUA 3AYWD 2FJ7D 5BT1C 5GSUB 5B31B 1BH9A 2L5AA 5B1LD 1P3KC 4WU8B 4X23D 1KU5A 3AZKD 1ZLAB 3WTPC 3X1SB 5GT0C 3B6FC 3UTBA 5CP6C 2Y2OA 1TZYC 4XUJD 4R8PD 1P3FC 3VH6A 1P3MB 3KWQC 3VH6W 5CPJA 3C1CB 2FFFB 3MGPB 3MGRD 2CV5A 3MNNC 3O62A 4QLCD 2CWEA 3WAAD 1M1AC 1F66D 1Q9CA 5GSUD 5B32G 3C1BD 4G92B 2HIOA 4ZUXB 5B33C 4WU8D 4J8VB 1KX4B 3AZHB 3X1SD 5E5AC 5DNNA 5B24C 4YM6B 3UTAD 4ZBJB 3LZ0B 3KUYC 3AZJA 5CPIA 3F6TA 1P3GA 3WA9C 4JJNA 2Y2KA 3WKJA 4LD9A 2IO5C 1KX5C 3MGQC 1P34D 3C1CD 4Z5TB 4J8XC 3W98B 3W99C 1B67A 2BYKB 5JRGA 4H9OB 3A6NC 3REHA 3X1TA 3R45A 4H9PA 1H3OB 5GXQC 1P3PD 5KDMA 3B6GB 3KXBA 3MVDA 4XZQD 4ZUXD 3W96C 4UUZB 4J8VD 1M18A 3AZGA 1KX4D 5AV5A 3AZHD 5B2JD 3REKD 1S32A 1AOIB 2F8NB 4YM6D 3NQUB 4J8UA 2NZDD 3REIA 4EO5C 3LELA 2PYOA 4Z5TD 3AZMA 3H0MC 3W98D 5BS7A 1W2EA 4G91C 5AY8C 3UTBB 2NQBA 5B0YD 3LZ1C 4KUDA 1M19C 4YS3C 5C3IB 1P3IB 3VH5W 3RELC 5CPJB 3X1UB 3AZNA 2ZY2A 3MGSC 2ZY3A 1KX3B 1U35A 1AOID 5FUGA 5CPKD 4NFTA 4WNNA 5B1LC 4WU9B 2VQRA 4AWLB 4X23C 3AZKC 1P3BB 5AVBD 2HIOB 4XUJC 1P3AC 2JSSA 5DNNB 5B1MC 3AZJB 5AVCA 2AROD 5CPIB 1P3ID 1P3GB 5AV9A 4JJNB 2Y2LA 3V9RA 3REJA 3VH6T 3X1UD 1P3LB 2JE5A 5B32C 3WAAC 1P3OD 1F66C 5JRGB 2Y2JA 1P3KA 1KX3D 5CHLB 3KFUG 2YFWA 5GSUC 3REHB 3WTPA 5GT0A 3C1BC 3R45B 4H9PB 4WU9D 4WU8C 5CP6A 1TZYA 1P3FA 3H0LC 3EPHA 4WV4B 5KDMB 3KXBB 3UTAC 3MVDB 1P3BD 1M18B 1ID3C 2Y2HA 3AZGB 4H9NA 1S32B 2ZY5A 5DNND 3A1IA 4DRBA 3MNNA 1P34C 3C1CC 3UT9D 5DNMD 3REIB 2Y2PA 1M1AA 1HQ3A 3LELB 1P3LD 2PYOB 3W97D 3AZMB 2NQBB 3AZEC 4KUDB 4E44A 5B33A 4Z66C 1P3PC 4NE3A 4KHAB 5E5AA 5GT3D 4XZQC 2RVQD 4J8VC 3KUYA 1KX4C 2BYMA 3AZHC 5B2JC 3REKC 3AZNB 1N1JB 4YM6C 3KXBD 3AZIA 3MVDD 3WA9A 1KX5A 3MGQA 3TU4B 2YFVA 2NZDC 3X1VC 1U35B 5FUGB 4J8XA 1WWIA 4WNNB 3B0BA 4Z5TC 3B0CW 3A6NA 3H0RC 5B0YC 3LELD 1B6WA 5B31D 3B0DC 3AZMD 3AFAA 5GXQA 3AN2A 2NQBD 1ZLAD 4KUDD 4HGAC 3LJAB 3W96A 5AVCB 1ULYA 5AV9B 1P3MD 4KGCA 3V9RB 2ZY4A 5B2IB 3AZFB 1EQZC 3AZLA 1AOIC 5CPKC 3AZND 2DF4C 3MGPD 3TU4D 1P3KB 1U35D 4DQYB 3WTPB 5GT0B 5AY8A 5AVBC 5CP6B 3LZ1A 1TZYB 1M19A 2F8NK 2W8SA 3RELA 5B40C 2AROC 1P3IC 4H9NB 3MGSA 2XD5A 3MNNB 3LJAD 3X1UC 5AV6C 1TAFA 4WJ3C 1P3OC 3LZ0D 5AV9D 3AV2C 4H9SC 1HQ3B 1M1AB 5B2ID 5B1LA 3AZFD 1KX3C 1BH9B 4X23A 3AZKA 5BT1D 2RIQA 4WU9C 4XUJA 3AV1C 5B33B 1P3AA 3VH5A 3WTPD 5E5AB 5GT0D 1P3BC 2HUEB 5AV8C 5B1MA 5CP6D 3KUYB 2BYMB 3WA9B 3AZIB 3EPLA 2IO5B 5F99A 1KX5B 2CV5B 3MGQB 3B6GD 3UT9C 5DNMC 2LY8A 5B32A 3O62B 3WAAA 3AYWC 2FJ7C 1BFMA 1F66A 1P3LC 3W97C 2F8ND 4J8WA 3A6NB 5GSUA 1M1AD 1HQ3D 3EG5B 3C1BA 4WU8A 4R8PC 3AFAB 5GXQB 3AN2B 5GT3C 2Y2GA 3NQJA 3UTAA 2RVQC 5B33D 3UTBD 1ID3A 3KXBC 3MVDC 4KGCB 1A7WA 1BH8A 5B0ZA 3MGRC 1P34A 3WKJB 4LD9B 3AZLB 4UPKA 5CPJD 2Y2QA 4QLCC 3AZID 1PZRA 4H9RA 2CV5D 3AL0C 1WWSA 3O62D 4G91B 5AY8B 5B31C 3AZEA 4CSRA 3LZ1B 3X1TB 3EPJA 1M19B 3B6FA 4Z66A 1P3PA 1T3UA 3B0CT 3IP4C 5BO0A 1ZLAC 4KUDC 3X1SC 4XZQA 3KWQA 2HIOD 3AFAD 5B2JA 3REKA 3AN2D 1P3MC 5BNVA 5AV5B 4YM6A 2XD1A 1TAFB 2ZM5A 3AZNC 2NZDA 3AZJD 3X1VA 3MGPC 4J8UB 4KGCD 5CPID 1P3GD 3TU4C 5B1LB 4E45A 4JJND 3WKJD 4LD9D 3AZLD 3AZKB 5BNXA 5B0YA 5G49A 4XUJB 1P3AB 5JRGD 3P5JB 5AY8D 4DRAA 5B1MB 3REHD 3X1TD 4G92C 1M19D 1H3OA 5B24A 4ZUXC 4H9QA 3LJAC 5F99B 4Z2MG 4UUZA 2J8PA 4ZBJC 5B32B 5AV9C 3LZ0C 5CPKA 1M18D 1EQZA 3AZGD 5AV5D 5JA4A 5B2IC 1S32D 1F66B 3AZFC 3W99A 4J8WB 4J8UD 3W98C 3C1BB 5AVBA 3REID 2PYOD 1Z2CB 3NQJB 3UTAB 1P3AD 1ID3B 5B40A 2AROA 1P3IA 1BH8B 5B1MD 5B31G 5B0ZB 1P34B 3B6GC 3VH5T 3X1UA 2Y2NA 5AV6A 3REJB 4NE6A 1P3OA 2F8NH 3AV2A 4H9SA 5F99D 4H9RB 2UWXA 1KX3A 2G5IC 5B32D 1HQ3C
chains in the Genus database with same CATH topology
2YFWB 4WU9A 3AZEB 4CSRB 3B6FB 3AV1A 4J8WD 4Z66B 2G5HC 1P3PB 5BO0B 1P3FB 1P3BA 4YS3A 4XZQB 5AV8A 3UTBC 1JFIA 3KWQB 2F2AC 5B2JB 3REKB 2HUEC 5BNVB 5C3IC 1ID3D 5CPJC 3UT9A 5DNMA 2NZDB 3X1VB 3AZIC 5AVCD 3AYWA 3KSYA 5B0ZD 2Y2MA 2CV5C 2FJ7A 3W97A 1P3LA 3O62C 5BNXB 3REJD 5B0YB 5G49B 3B0DB 4AWLC 4R8PA 1P3KD 5GT3A 3AZED 4HGAB 3B6FD 2HIOC 5B24B 4Z66D 3AFAC 3AN2C 3WTPE 1TZYD 1HTAA 1P3FD 4H9QB 3MGRA 5DNNC 3KWQD 3AZJC 1EQZB 4QLCA 5CPKB 4KGCC 2YFVB 1R4VA 5CPIC 5JA4B 1P3GC 3WKJC 4JJNC 4J8XB 4LD9C 3AZLC 3W99B 4CAYA 3MNND 3X1VD 5AVBB 4WZSB 5B31A 4Z2MH 5JRGC 1ZLAA 2F8NG 3REHC 3X1SA 3X1TC 5B40B 2AROB 4KHAA 3W96B 1P3MA 5E5AD 5AV6B 5B24D 2BG1A 1M18C 1P3OB 1N1JA 3KUYD 3C1CA 5AV5C 3AZGC 3MGPA 3AV2B 1S32C 2DQNC 3TU4A 3WA9D 4EO5B 1KX5D 1EQZD 3MGQD 4J8UC 4NE5A 3REIC 4J8XD 3W99D 3AV1B 3LELC 2PYOC 3EPKA 3AZMC 4YS3B 5BS7C 5AV8B 3A6ND 1JFIB 2NQBC 4M6BA 3RELB 4ZUXA 4J8VA 1KX4A 3AZHA 5GXQD 3LJAA 3FDDA 3MGSB 2JCHA 3A1KA 5B40D 3UT9B 5DNMB 3LZ0A 3AYWB 3W96D 5F99C 2FJ7B 5B2IA 3W97B 3AZFA 5AV6D 1F1EA 3AV2D 1U35C 4X23B 4Z5TA 3W98A 4J8WC 2BYKA 4R8PB 4H9OA 5GT3B 3AV1D 3LZ1D 4YS3D 5AV8D 3MGRB 3B6GA 4QLCB 3RELD 2Y2IA 5AVCC 5B0ZC 1AOIA 3WAAB 3MGSD 2F8NA 3REJC 4CAYB 3NQUA 3AYWD 2FJ7D 5BT1C 5GSUB 5B31B 1BH9A 2L5AA 5B1LD 1P3KC 4WU8B 4X23D 1KU5A 3AZKD 1ZLAB 3WTPC 3X1SB 5GT0C 3B6FC 3UTBA 5CP6C 2Y2OA 1TZYC 4XUJD 4R8PD 1P3FC 3VH6A 1P3MB 3KWQC 3VH6W 5CPJA 3C1CB 2FFFB 3MGPB 3MGRD 2CV5A 3MNNC 3O62A 4QLCD 2CWEA 3WAAD 1M1AC 1F66D 1Q9CA 5GSUD 5B32G 3C1BD 4G92B 2HIOA 4ZUXB 5B33C 4WU8D 4J8VB 1KX4B 3AZHB 3X1SD 5E5AC 5DNNA 5B24C 4YM6B 3UTAD 4ZBJB 3LZ0B 3KUYC 3AZJA 5CPIA 3F6TA 1P3GA 3WA9C 4JJNA 2Y2KA 3WKJA 4LD9A 2IO5C 1KX5C 3MGQC 1P34D 3C1CD 4Z5TB 4J8XC 3W98B 3W99C 1B67A 2BYKB 5JRGA 4H9OB 3A6NC 3REHA 3X1TA 3R45A 4H9PA 1H3OB 5GXQC 1P3PD 5KDMA 3B6GB 3KXBA 3MVDA 4XZQD 4ZUXD 3W96C 4UUZB 4J8VD 1M18A 3AZGA 1KX4D 5AV5A 3AZHD 5B2JD 3REKD 1S32A 1AOIB 2F8NB 4YM6D 3NQUB 4J8UA 2NZDD 3REIA 4EO5C 3LELA 2PYOA 4Z5TD 3AZMA 3H0MC 3W98D 5BS7A 1W2EA 4G91C 5AY8C 3UTBB 2NQBA 5B0YD 3LZ1C 4KUDA 1M19C 4YS3C 5C3IB 1P3IB 3VH5W 3RELC 5CPJB 3X1UB 3AZNA 2ZY2A 3MGSC 2ZY3A 1KX3B 1U35A 1AOID 5FUGA 5CPKD 4NFTA 4WNNA 5B1LC 4WU9B 2VQRA 4AWLB 4X23C 3AZKC 1P3BB 5AVBD 2HIOB 4XUJC 1P3AC 2JSSA 5DNNB 5B1MC 3AZJB 5AVCA 2AROD 5CPIB 1P3ID 1P3GB 5AV9A 4JJNB 2Y2LA 3V9RA 3REJA 3VH6T 3X1UD 1P3LB 2JE5A 5B32C 3WAAC 1P3OD 1F66C 5JRGB 2Y2JA 1P3KA 1KX3D 5CHLB 3KFUG 2YFWA 5GSUC 3REHB 3WTPA 5GT0A 3C1BC 3R45B 4H9PB 4WU9D 4WU8C 5CP6A 1TZYA 1P3FA 3H0LC 3EPHA 4WV4B 5KDMB 3KXBB 3UTAC 3MVDB 1P3BD 1M18B 1ID3C 2Y2HA 3AZGB 4H9NA 1S32B 2ZY5A 5DNND 3A1IA 4DRBA 3MNNA 1P34C 3C1CC 3UT9D 5DNMD 3REIB 2Y2PA 1M1AA 1HQ3A 3LELB 1P3LD 2PYOB 3W97D 3AZMB 2NQBB 3AZEC 4KUDB 4E44A 5B33A 4Z66C 1P3PC 4NE3A 4KHAB 5E5AA 5GT3D 4XZQC 2RVQD 4J8VC 3KUYA 1KX4C 2BYMA 3AZHC 5B2JC 3REKC 3AZNB 1N1JB 4YM6C 3KXBD 3AZIA 3MVDD 3WA9A 1KX5A 3MGQA 3TU4B 2YFVA 2NZDC 3X1VC 1U35B 5FUGB 4J8XA 1WWIA 4WNNB 3B0BA 4Z5TC 3B0CW 3A6NA 3H0RC 5B0YC 3LELD 1B6WA 5B31D 3B0DC 3AZMD 3AFAA 5GXQA 3AN2A 2NQBD 1ZLAD 4KUDD 4HGAC 3LJAB 3W96A 5AVCB 1ULYA 5AV9B 1P3MD 4KGCA 3V9RB 2ZY4A 5B2IB 3AZFB 1EQZC 3AZLA 1AOIC 5CPKC 3AZND 2DF4C 3MGPD 3TU4D 1P3KB 1U35D 4DQYB 3WTPB 5GT0B 5AY8A 5AVBC 5CP6B 3LZ1A 1TZYB 1M19A 2F8NK 2W8SA 3RELA 5B40C 2AROC 1P3IC 4H9NB 3MGSA 2XD5A 3MNNB 3LJAD 3X1UC 5AV6C 1TAFA 4WJ3C 1P3OC 3LZ0D 5AV9D 3AV2C 4H9SC 1HQ3B 1M1AB 5B2ID 5B1LA 3AZFD 1KX3C 1BH9B 4X23A 3AZKA 5BT1D 2RIQA 4WU9C 4XUJA 3AV1C 5B33B 1P3AA 3VH5A 3WTPD 5E5AB 5GT0D 1P3BC 2HUEB 5AV8C 5B1MA 5CP6D 3KUYB 2BYMB 3WA9B 3AZIB 3EPLA 2IO5B 5F99A 1KX5B 2CV5B 3MGQB 3B6GD 3UT9C 5DNMC 2LY8A 5B32A 3O62B 3WAAA 3AYWC 2FJ7C 1BFMA 1F66A 1P3LC 3W97C 2F8ND 4J8WA 3A6NB 5GSUA 1M1AD 1HQ3D 3EG5B 3C1BA 4WU8A 4R8PC 3AFAB 5GXQB 3AN2B 5GT3C 2Y2GA 3NQJA 3UTAA 2RVQC 5B33D 3UTBD 1ID3A 3KXBC 3MVDC 4KGCB 1A7WA 1BH8A 5B0ZA 3MGRC 1P34A 3WKJB 4LD9B 3AZLB 4UPKA 5CPJD 2Y2QA 4QLCC 3AZID 1PZRA 4H9RA 2CV5D 3AL0C 1WWSA 3O62D 4G91B 5AY8B 5B31C 3AZEA 4CSRA 3LZ1B 3X1TB 3EPJA 1M19B 3B6FA 4Z66A 1P3PA 1T3UA 3B0CT 3IP4C 5BO0A 1ZLAC 4KUDC 3X1SC 4XZQA 3KWQA 2HIOD 3AFAD 5B2JA 3REKA 3AN2D 1P3MC 5BNVA 5AV5B 4YM6A 2XD1A 1TAFB 2ZM5A 3AZNC 2NZDA 3AZJD 3X1VA 3MGPC 4J8UB 4KGCD 5CPID 1P3GD 3TU4C 5B1LB 4E45A 4JJND 3WKJD 4LD9D 3AZLD 3AZKB 5BNXA 5B0YA 5G49A 4XUJB 1P3AB 5JRGD 3P5JB 5AY8D 4DRAA 5B1MB 3REHD 3X1TD 4G92C 1M19D 1H3OA 5B24A 4ZUXC 4H9QA 3LJAC 5F99B 4Z2MG 4UUZA 2J8PA 4ZBJC 5B32B 5AV9C 3LZ0C 5CPKA 1M18D 1EQZA 3AZGD 5AV5D 5JA4A 5B2IC 1S32D 1F66B 3AZFC 3W99A 4J8WB 4J8UD 3W98C 3C1BB 5AVBA 3REID 2PYOD 1Z2CB 3NQJB 3UTAB 1P3AD 1ID3B 5B40A 2AROA 1P3IA 1BH8B 5B1MD 5B31G 5B0ZB 1P34B 3B6GC 3VH5T 3X1UA 2Y2NA 5AV6A 3REJB 4NE6A 1P3OA 2F8NH 3AV2A 4H9SA 5F99D 4H9RB 2UWXA 1KX3A 2G5IC 5B32D 1HQ3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YFW B;  4WU9 A;  3AZE B;  4CSR B;  3B6F B;  3AV1 A;  4J8W D;  4Z66 B;  1P3P B;  5BO0 B;  1P3F B;  1P3B A;  4YS3 A;  4XZQ B;  5AV8 A;  3UTB C;  1JFI A;  3KWQ B;  5B2J B;  3REK B;  2HUE C;  5BNV B;  5C3I C;  1ID3 D;  5CPJ C;  3UT9 A;  5DNM A;  2NZD B;  3X1V B;  3AZI C;  5AVC D;  3AYW A;  3KSY A;  5B0Z D;  2CV5 C;  2FJ7 A;  3W97 A;  1P3L A;  3O62 C;  5BNX B;  3REJ D;  5B0Y B;  5G49 B;  3B0D B;  4AWL C;  4R8P A;  1P3K D;  5GT3 A;  3AZE D;  4HGA B;  3B6F D;  2HIO C;  5B24 B;  4Z66 D;  3AFA C;  3AN2 C;  3WTP E;  1TZY D;  1HTA A;  1P3F D;  4H9Q B;  3MGR A;  5DNN C;  3KWQ D;  3AZJ C;  1EQZ B;  4QLC A;  5CPK B;  4KGC C;  2YFV B;  1R4V A;  5CPI C;  5JA4 B;  1P3G C;  3WKJ C;  4JJN C;  4J8X B;  4LD9 C;  3AZL C;  3W99 B;  4CAY A;  3MNN D;  3X1V D;  5AVB B;  4WZS B;  5B31 A;  4Z2M H;  5JRG C;  1ZLA A;  2F8N G;  3REH C;  3X1S A;  3X1T C;  5B40 B;  2ARO B;  4KHA A;  3W96 B;  1P3M A;  5E5A D;  5AV6 B;  5B24 D;  1M18 C;  1P3O B;  1N1J A;  3KUY D;  3C1C A;  5AV5 C;  3AZG C;  3MGP A;  3AV2 B;  1S32 C;  3TU4 A;  3WA9 D;  4EO5 B;  1KX5 D;  1EQZ D;  3MGQ D;  4J8U C;  4NE5 A;  3REI C;  4J8X D;  3W99 D;  3AV1 B;  3LEL C;  2PYO C;  3AZM C;  4YS3 B;  5BS7 C;  5AV8 B;  3A6N D;  1JFI B;  2NQB C;  4M6B A;  3REL B;  4ZUX A;  4J8V A;  1KX4 A;  3AZH A;  5GXQ D;  3LJA A;  3MGS B;  5B40 D;  3UT9 B;  5DNM B;  3LZ0 A;  3AYW B;  3W96 D;  5F99 C;  2FJ7 B;  5B2I A;  3W97 B;  3AZF A;  5AV6 D;  1F1E A;  3AV2 D;  1U35 C;  4X23 B;  4Z5T A;  3W98 A;  4J8W C;  2BYK A;  4R8P B;  4H9O A;  5GT3 B;  3AV1 D;  3LZ1 D;  4YS3 D;  5AV8 D;  3MGR B;  3B6G A;  4QLC B;  3REL D;  5AVC C;  5B0Z C;  1AOI A;  3WAA B;  3MGS D;  2F8N A;  3REJ C;  4CAY B;  3NQU A;  3AYW D;  2FJ7 D;  5BT1 C;  5GSU B;  5B31 B;  1BH9 A;  2L5A A;  5B1L D;  1P3K C;  4WU8 B;  4X23 D;  1KU5 A;  3AZK D;  1ZLA B;  3WTP C;  3X1S B;  5GT0 C;  3B6F C;  3UTB A;  5CP6 C;  4R8P D;  1TZY C;  4XUJ D;  1P3F C;  3VH6 A;  1P3M B;  3KWQ C;  3VH6 W;  5CPJ A;  3C1C B;  3MGP B;  3MGR D;  2CV5 A;  3MNN C;  3O62 A;  4QLC D;  2CWE A;  3WAA D;  1M1A C;  1F66 D;  1Q9C A;  5GSU D;  5B32 G;  3C1B D;  4G92 B;  2HIO A;  4ZUX B;  5B33 C;  4WU8 D;  4J8V B;  1KX4 B;  3AZH B;  3X1S D;  5E5A C;  5DNN A;  5B24 C;  4YM6 B;  3UTA D;  4ZBJ B;  3LZ0 B;  3KUY C;  3AZJ A;  5CPI A;  1P3G A;  3WA9 C;  4JJN A;  3WKJ A;  4LD9 A;  2IO5 C;  1KX5 C;  3MGQ C;  1P34 D;  3C1C D;  4Z5T B;  4J8X C;  3W98 B;  3W99 C;  1B67 A;  2BYK B;  5JRG A;  4H9O B;  3A6N C;  3REH A;  3X1T A;  3R45 A;  4H9P A;  1H3O B;  5GXQ C;  1P3P D;  5KDM A;  3B6G B;  3KXB A;  3MVD A;  4XZQ D;  4ZUX D;  3W96 C;  4UUZ B;  4J8V D;  1M18 A;  3AZG A;  1KX4 D;  5AV5 A;  3AZH D;  5B2J D;  3REK D;  1S32 A;  1AOI B;  2F8N B;  4YM6 D;  3NQU B;  4J8U A;  2NZD D;  3REI A;  4EO5 C;  3LEL A;  2PYO A;  4Z5T D;  3AZM A;  3W98 D;  5BS7 A;  4G91 C;  5AY8 C;  3UTB B;  2NQB A;  5B0Y D;  3LZ1 C;  4KUD A;  1M19 C;  4YS3 C;  5C3I B;  1P3I B;  3VH5 W;  3REL C;  5CPJ B;  3X1U B;  3AZN A;  3MGS C;  1KX3 B;  1U35 A;  1AOI D;  5FUG A;  5CPK D;  4NFT A;  4WNN A;  5B1L C;  4WU9 B;  4AWL B;  4X23 C;  3AZK C;  1P3B B;  5AVB D;  2HIO B;  4XUJ C;  1P3A C;  2JSS A;  5DNN B;  5B1M C;  3AZJ B;  5AVC A;  2ARO D;  5CPI B;  1P3I D;  1P3G B;  5AV9 A;  4JJN B;  3V9R A;  3REJ A;  3VH6 T;  3X1U D;  1P3L B;  5B32 C;  3WAA C;  1P3O D;  1F66 C;  5JRG B;  1P3K A;  1KX3 D;  5CHL B;  2YFW A;  5GSU C;  3REH B;  3WTP A;  5GT0 A;  3C1B C;  3R45 B;  4H9P B;  4WU9 D;  4WU8 C;  5CP6 A;  1TZY A;  1P3F A;  4WV4 B;  5KDM B;  3KXB B;  3UTA C;  3MVD B;  1P3B D;  1M18 B;  1ID3 C;  3AZG B;  4H9N A;  1S32 B;  5DNN D;  4DRB A;  3MNN A;  1P34 C;  3C1C C;  3UT9 D;  5DNM D;  3REI B;  1M1A A;  1HQ3 A;  3LEL B;  1P3L D;  2PYO B;  3W97 D;  3AZM B;  2NQB B;  3AZE C;  4KUD B;  4E44 A;  5B33 A;  4Z66 C;  1P3P C;  4NE3 A;  4KHA B;  5E5A A;  5GT3 D;  4XZQ C;  2RVQ D;  4J8V C;  3KUY A;  1KX4 C;  2BYM A;  3AZH C;  5B2J C;  3REK C;  3AZN B;  1N1J B;  4YM6 C;  3KXB D;  3AZI A;  3MVD D;  3WA9 A;  1KX5 A;  3MGQ A;  3TU4 B;  2YFV A;  2NZD C;  3X1V C;  1U35 B;  5FUG B;  4J8X A;  1WWI A;  4WNN B;  3B0B A;  4Z5T C;  3B0C W;  3A6N A;  5B0Y C;  3LEL D;  1B6W A;  5B31 D;  3B0D C;  3AZM D;  3AFA A;  5GXQ A;  3AN2 A;  2NQB D;  1ZLA D;  4KUD D;  4HGA C;  3LJA B;  3W96 A;  5AVC B;  1ULY A;  5AV9 B;  1P3M D;  4KGC A;  3V9R B;  5B2I B;  3AZF B;  1EQZ C;  3AZL A;  1AOI C;  5CPK C;  3AZN D;  3MGP D;  3TU4 D;  1P3K B;  1U35 D;  3WTP B;  5GT0 B;  5AY8 A;  5AVB C;  5CP6 B;  3LZ1 A;  1TZY B;  1M19 A;  2F8N K;  3REL A;  5B40 C;  2ARO C;  1P3I C;  4H9N B;  3MGS A;  3MNN B;  3LJA D;  3X1U C;  5AV6 C;  1TAF A;  1P3O C;  3LZ0 D;  5AV9 D;  3AV2 C;  4H9S C;  1HQ3 B;  1M1A B;  5B2I D;  5B1L A;  3AZF D;  1KX3 C;  1BH9 B;  4X23 A;  3AZK A;  5BT1 D;  4WU9 C;  4XUJ A;  3AV1 C;  5B33 B;  1P3A A;  3VH5 A;  3WTP D;  5E5A B;  5GT0 D;  1P3B C;  2HUE B;  5AV8 C;  5B1M A;  5CP6 D;  3KUY B;  2BYM B;  3WA9 B;  3AZI B;  2IO5 B;  5F99 A;  1KX5 B;  2CV5 B;  3MGQ B;  3B6G D;  3UT9 C;  5DNM C;  2LY8 A;  5B32 A;  3O62 B;  3WAA A;  3AYW C;  2FJ7 C;  1BFM A;  1F66 A;  1P3L C;  3W97 C;  2F8N D;  4J8W A;  3A6N B;  5GSU A;  1M1A D;  1HQ3 D;  3C1B A;  4WU8 A;  4R8P C;  3AFA B;  5GXQ B;  3AN2 B;  5GT3 C;  3NQJ A;  3UTA A;  2RVQ C;  5B33 D;  3UTB D;  1ID3 A;  3KXB C;  3MVD C;  4KGC B;  1A7W A;  1BH8 A;  5B0Z A;  3MGR C;  1P34 A;  3WKJ B;  4LD9 B;  3AZL B;  4QLC C;  5CPJ D;  3AZI D;  4H9R A;  2CV5 D;  1WWS A;  3O62 D;  4G91 B;  5AY8 B;  5B31 C;  3AZE A;  4CSR A;  3LZ1 B;  3X1T B;  1M19 B;  3B6F A;  4Z66 A;  1P3P A;  5BO0 A;  3B0C T;  1ZLA C;  4KUD C;  3X1S C;  4XZQ A;  3KWQ A;  2HIO D;  3AFA D;  5B2J A;  3REK A;  3AN2 D;  1P3M C;  5BNV A;  5AV5 B;  4YM6 A;  1TAF B;  3AZN C;  2NZD A;  3AZJ D;  3X1V A;  3MGP C;  4J8U B;  4KGC D;  5CPI D;  1P3G D;  3TU4 C;  5B1L B;  4E45 A;  4JJN D;  3WKJ D;  4LD9 D;  3AZL D;  3AZK B;  5BNX A;  5B0Y A;  5G49 A;  4XUJ B;  1P3A B;  5JRG D;  5AY8 D;  4DRA A;  5B1M B;  3REH D;  3X1T D;  4G92 C;  1M19 D;  1H3O A;  5B24 A;  4ZUX C;  4H9Q A;  3LJA C;  5F99 B;  4Z2M G;  4UUZ A;  4ZBJ C;  5B32 B;  5AV9 C;  3LZ0 C;  5CPK A;  1M18 D;  1EQZ A;  3AZG D;  5AV5 D;  5JA4 A;  5B2I C;  1S32 D;  1F66 B;  3AZF C;  3W99 A;  4J8W B;  4J8U D;  3W98 C;  3C1B B;  5AVB A;  3REI D;  2PYO D;  3NQJ B;  3UTA B;  1P3A D;  1ID3 B;  5B40 A;  2ARO A;  1P3I A;  1BH8 B;  5B1M D;  5B31 G;  5B0Z B;  1P34 B;  3B6G C;  3VH5 T;  3X1U A;  5AV6 A;  3REJ B;  4NE6 A;  1P3O A;  2F8N H;  3AV2 A;  4H9S A;  5F99 D;  4H9R B;  1KX3 A;  5B32 D;  1HQ3 C; 
#chains in the Genus database with same CATH topology
 2YFW B;  4WU9 A;  3AZE B;  4CSR B;  3B6F B;  3AV1 A;  4J8W D;  4Z66 B;  2G5H C;  1P3P B;  5BO0 B;  1P3F B;  1P3B A;  4YS3 A;  4XZQ B;  5AV8 A;  3UTB C;  1JFI A;  3KWQ B;  2F2A C;  5B2J B;  3REK B;  2HUE C;  5BNV B;  5C3I C;  1ID3 D;  5CPJ C;  3UT9 A;  5DNM A;  2NZD B;  3X1V B;  3AZI C;  5AVC D;  3AYW A;  3KSY A;  5B0Z D;  2Y2M A;  2CV5 C;  2FJ7 A;  3W97 A;  1P3L A;  3O62 C;  5BNX B;  3REJ D;  5B0Y B;  5G49 B;  3B0D B;  4AWL C;  4R8P A;  1P3K D;  5GT3 A;  3AZE D;  4HGA B;  3B6F D;  2HIO C;  5B24 B;  4Z66 D;  3AFA C;  3AN2 C;  3WTP E;  1TZY D;  1HTA A;  1P3F D;  4H9Q B;  3MGR A;  5DNN C;  3KWQ D;  3AZJ C;  1EQZ B;  4QLC A;  5CPK B;  4KGC C;  2YFV B;  1R4V A;  5CPI C;  5JA4 B;  1P3G C;  3WKJ C;  4JJN C;  4J8X B;  4LD9 C;  3AZL C;  3W99 B;  4CAY A;  3MNN D;  3X1V D;  5AVB B;  4WZS B;  5B31 A;  4Z2M H;  5JRG C;  1ZLA A;  2F8N G;  3REH C;  3X1S A;  3X1T C;  5B40 B;  2ARO B;  4KHA A;  3W96 B;  1P3M A;  5E5A D;  5AV6 B;  5B24 D;  2BG1 A;  1M18 C;  1P3O B;  1N1J A;  3KUY D;  3C1C A;  5AV5 C;  3AZG C;  3MGP A;  3AV2 B;  1S32 C;  2DQN C;  3TU4 A;  3WA9 D;  4EO5 B;  1KX5 D;  1EQZ D;  3MGQ D;  4J8U C;  4NE5 A;  3REI C;  4J8X D;  3W99 D;  3AV1 B;  3LEL C;  2PYO C;  3EPK A;  3AZM C;  4YS3 B;  5BS7 C;  5AV8 B;  3A6N D;  1JFI B;  2NQB C;  4M6B A;  3REL B;  4ZUX A;  4J8V A;  1KX4 A;  3AZH A;  5GXQ D;  3LJA A;  3FDD A;  3MGS B;  2JCH A;  3A1K A;  5B40 D;  3UT9 B;  5DNM B;  3LZ0 A;  3AYW B;  3W96 D;  5F99 C;  2FJ7 B;  5B2I A;  3W97 B;  3AZF A;  5AV6 D;  1F1E A;  3AV2 D;  1U35 C;  4X23 B;  4Z5T A;  3W98 A;  4J8W C;  2BYK A;  4R8P B;  4H9O A;  5GT3 B;  3AV1 D;  3LZ1 D;  4YS3 D;  5AV8 D;  3MGR B;  3B6G A;  4QLC B;  3REL D;  2Y2I A;  5AVC C;  5B0Z C;  1AOI A;  3WAA B;  3MGS D;  2F8N A;  3REJ C;  4CAY B;  3NQU A;  3AYW D;  2FJ7 D;  5BT1 C;  5GSU B;  5B31 B;  1BH9 A;  2L5A A;  5B1L D;  1P3K C;  4WU8 B;  4X23 D;  1KU5 A;  3AZK D;  1ZLA B;  3WTP C;  3X1S B;  5GT0 C;  3B6F C;  3UTB A;  5CP6 C;  2Y2O A;  1TZY C;  4XUJ D;  4R8P D;  1P3F C;  3VH6 A;  1P3M B;  3KWQ C;  3VH6 W;  5CPJ A;  3C1C B;  2FFF B;  3MGP B;  3MGR D;  2CV5 A;  3MNN C;  3O62 A;  4QLC D;  2CWE A;  3WAA D;  1M1A C;  1F66 D;  1Q9C A;  5GSU D;  5B32 G;  3C1B D;  4G92 B;  2HIO A;  4ZUX B;  5B33 C;  4WU8 D;  4J8V B;  1KX4 B;  3AZH B;  3X1S D;  5E5A C;  5DNN A;  5B24 C;  4YM6 B;  3UTA D;  4ZBJ B;  3LZ0 B;  3KUY C;  3AZJ A;  5CPI A;  3F6T A;  1P3G A;  3WA9 C;  4JJN A;  2Y2K A;  3WKJ A;  4LD9 A;  2IO5 C;  1KX5 C;  3MGQ C;  1P34 D;  3C1C D;  4Z5T B;  4J8X C;  3W98 B;  3W99 C;  1B67 A;  2BYK B;  5JRG A;  4H9O B;  3A6N C;  3REH A;  3X1T A;  3R45 A;  4H9P A;  1H3O B;  5GXQ C;  1P3P D;  5KDM A;  3B6G B;  3KXB A;  3MVD A;  4XZQ D;  4ZUX D;  3W96 C;  4UUZ B;  4J8V D;  1M18 A;  3AZG A;  1KX4 D;  5AV5 A;  3AZH D;  5B2J D;  3REK D;  1S32 A;  1AOI B;  2F8N B;  4YM6 D;  3NQU B;  4J8U A;  2NZD D;  3REI A;  4EO5 C;  3LEL A;  2PYO A;  4Z5T D;  3AZM A;  3H0M C;  3W98 D;  5BS7 A;  1W2E A;  4G91 C;  5AY8 C;  3UTB B;  2NQB A;  5B0Y D;  3LZ1 C;  4KUD A;  1M19 C;  4YS3 C;  5C3I B;  1P3I B;  3VH5 W;  3REL C;  5CPJ B;  3X1U B;  3AZN A;  2ZY2 A;  3MGS C;  2ZY3 A;  1KX3 B;  1U35 A;  1AOI D;  5FUG A;  5CPK D;  4NFT A;  4WNN A;  5B1L C;  4WU9 B;  2VQR A;  4AWL B;  4X23 C;  3AZK C;  1P3B B;  5AVB D;  2HIO B;  4XUJ C;  1P3A C;  2JSS A;  5DNN B;  5B1M C;  3AZJ B;  5AVC A;  2ARO D;  5CPI B;  1P3I D;  1P3G B;  5AV9 A;  4JJN B;  2Y2L A;  3V9R A;  3REJ A;  3VH6 T;  3X1U D;  1P3L B;  2JE5 A;  5B32 C;  3WAA C;  1P3O D;  1F66 C;  5JRG B;  2Y2J A;  1P3K A;  1KX3 D;  5CHL B;  3KFU G;  2YFW A;  5GSU C;  3REH B;  3WTP A;  5GT0 A;  3C1B C;  3R45 B;  4H9P B;  4WU9 D;  4WU8 C;  5CP6 A;  1TZY A;  1P3F A;  3H0L C;  3EPH A;  4WV4 B;  5KDM B;  3KXB B;  3UTA C;  3MVD B;  1P3B D;  1M18 B;  1ID3 C;  2Y2H A;  3AZG B;  4H9N A;  1S32 B;  2ZY5 A;  5DNN D;  3A1I A;  4DRB A;  3MNN A;  1P34 C;  3C1C C;  3UT9 D;  5DNM D;  3REI B;  2Y2P A;  1M1A A;  1HQ3 A;  3LEL B;  1P3L D;  2PYO B;  3W97 D;  3AZM B;  2NQB B;  3AZE C;  4KUD B;  4E44 A;  5B33 A;  4Z66 C;  1P3P C;  4NE3 A;  4KHA B;  5E5A A;  5GT3 D;  4XZQ C;  2RVQ D;  4J8V C;  3KUY A;  1KX4 C;  2BYM A;  3AZH C;  5B2J C;  3REK C;  3AZN B;  1N1J B;  4YM6 C;  3KXB D;  3AZI A;  3MVD D;  3WA9 A;  1KX5 A;  3MGQ A;  3TU4 B;  2YFV A;  2NZD C;  3X1V C;  1U35 B;  5FUG B;  4J8X A;  1WWI A;  4WNN B;  3B0B A;  4Z5T C;  3B0C W;  3A6N A;  3H0R C;  5B0Y C;  3LEL D;  1B6W A;  5B31 D;  3B0D C;  3AZM D;  3AFA A;  5GXQ A;  3AN2 A;  2NQB D;  1ZLA D;  4KUD D;  4HGA C;  3LJA B;  3W96 A;  5AVC B;  1ULY A;  5AV9 B;  1P3M D;  4KGC A;  3V9R B;  2ZY4 A;  5B2I B;  3AZF B;  1EQZ C;  3AZL A;  1AOI C;  5CPK C;  3AZN D;  2DF4 C;  3MGP D;  3TU4 D;  1P3K B;  1U35 D;  4DQY B;  3WTP B;  5GT0 B;  5AY8 A;  5AVB C;  5CP6 B;  3LZ1 A;  1TZY B;  1M19 A;  2F8N K;  2W8S A;  3REL A;  5B40 C;  2ARO C;  1P3I C;  4H9N B;  3MGS A;  2XD5 A;  3MNN B;  3LJA D;  3X1U C;  5AV6 C;  1TAF A;  4WJ3 C;  1P3O C;  3LZ0 D;  5AV9 D;  3AV2 C;  4H9S C;  1HQ3 B;  1M1A B;  5B2I D;  5B1L A;  3AZF D;  1KX3 C;  1BH9 B;  4X23 A;  3AZK A;  5BT1 D;  2RIQ A;  4WU9 C;  4XUJ A;  3AV1 C;  5B33 B;  1P3A A;  3VH5 A;  3WTP D;  5E5A B;  5GT0 D;  1P3B C;  2HUE B;  5AV8 C;  5B1M A;  5CP6 D;  3KUY B;  2BYM B;  3WA9 B;  3AZI B;  3EPL A;  2IO5 B;  5F99 A;  1KX5 B;  2CV5 B;  3MGQ B;  3B6G D;  3UT9 C;  5DNM C;  2LY8 A;  5B32 A;  3O62 B;  3WAA A;  3AYW C;  2FJ7 C;  1BFM A;  1F66 A;  1P3L C;  3W97 C;  2F8N D;  4J8W A;  3A6N B;  5GSU A;  1M1A D;  1HQ3 D;  3EG5 B;  3C1B A;  4WU8 A;  4R8P C;  3AFA B;  5GXQ B;  3AN2 B;  5GT3 C;  2Y2G A;  3NQJ A;  3UTA A;  2RVQ C;  5B33 D;  3UTB D;  1ID3 A;  3KXB C;  3MVD C;  4KGC B;  1A7W A;  1BH8 A;  5B0Z A;  3MGR C;  1P34 A;  3WKJ B;  4LD9 B;  3AZL B;  4UPK A;  5CPJ D;  2Y2Q A;  4QLC C;  3AZI D;  1PZR A;  4H9R A;  2CV5 D;  3AL0 C;  1WWS A;  3O62 D;  4G91 B;  5AY8 B;  5B31 C;  3AZE A;  4CSR A;  3LZ1 B;  3X1T B;  3EPJ A;  1M19 B;  3B6F A;  4Z66 A;  1P3P A;  1T3U A;  3B0C T;  3IP4 C;  5BO0 A;  1ZLA C;  4KUD C;  3X1S C;  4XZQ A;  3KWQ A;  2HIO D;  3AFA D;  5B2J A;  3REK A;  3AN2 D;  1P3M C;  5BNV A;  5AV5 B;  4YM6 A;  2XD1 A;  1TAF B;  2ZM5 A;  3AZN C;  2NZD A;  3AZJ D;  3X1V A;  3MGP C;  4J8U B;  4KGC D;  5CPI D;  1P3G D;  3TU4 C;  5B1L B;  4E45 A;  4JJN D;  3WKJ D;  4LD9 D;  3AZL D;  3AZK B;  5BNX A;  5B0Y A;  5G49 A;  4XUJ B;  1P3A B;  5JRG D;  3P5J B;  5AY8 D;  4DRA A;  5B1M B;  3REH D;  3X1T D;  4G92 C;  1M19 D;  1H3O A;  5B24 A;  4ZUX C;  4H9Q A;  3LJA C;  5F99 B;  4Z2M G;  4UUZ A;  2J8P A;  4ZBJ C;  5B32 B;  5AV9 C;  3LZ0 C;  5CPK A;  1M18 D;  1EQZ A;  3AZG D;  5AV5 D;  5JA4 A;  5B2I C;  1S32 D;  1F66 B;  3AZF C;  3W99 A;  4J8W B;  4J8U D;  3W98 C;  3C1B B;  5AVB A;  3REI D;  2PYO D;  1Z2C B;  3NQJ B;  3UTA B;  1P3A D;  1ID3 B;  5B40 A;  2ARO A;  1P3I A;  1BH8 B;  5B1M D;  5B31 G;  5B0Z B;  1P34 B;  3B6G C;  3VH5 T;  3X1U A;  2Y2N A;  5AV6 A;  3REJ B;  4NE6 A;  1P3O A;  2F8N H;  3AV2 A;  4H9S A;  5F99 D;  4H9R B;  2UWX A;  1KX3 A;  2G5I C;  5B32 D;  1HQ3 C; 
#chains in the Genus database with same CATH homology
 2YFW B;  4WU9 A;  3AZE B;  4CSR B;  3B6F B;  3AV1 A;  4J8W D;  4Z66 B;  2G5H C;  1P3P B;  5BO0 B;  1P3F B;  1P3B A;  4YS3 A;  4XZQ B;  5AV8 A;  3UTB C;  1JFI A;  3KWQ B;  2F2A C;  5B2J B;  3REK B;  2HUE C;  5BNV B;  5C3I C;  1ID3 D;  5CPJ C;  3UT9 A;  5DNM A;  2NZD B;  3X1V B;  3AZI C;  5AVC D;  3AYW A;  3KSY A;  5B0Z D;  2Y2M A;  2CV5 C;  2FJ7 A;  3W97 A;  1P3L A;  3O62 C;  5BNX B;  3REJ D;  5B0Y B;  5G49 B;  3B0D B;  4AWL C;  4R8P A;  1P3K D;  5GT3 A;  3AZE D;  4HGA B;  3B6F D;  2HIO C;  5B24 B;  4Z66 D;  3AFA C;  3AN2 C;  3WTP E;  1TZY D;  1HTA A;  1P3F D;  4H9Q B;  3MGR A;  5DNN C;  3KWQ D;  3AZJ C;  1EQZ B;  4QLC A;  5CPK B;  4KGC C;  2YFV B;  1R4V A;  5CPI C;  5JA4 B;  1P3G C;  3WKJ C;  4JJN C;  4J8X B;  4LD9 C;  3AZL C;  3W99 B;  4CAY A;  3MNN D;  3X1V D;  5AVB B;  4WZS B;  5B31 A;  4Z2M H;  5JRG C;  1ZLA A;  2F8N G;  3REH C;  3X1S A;  3X1T C;  5B40 B;  2ARO B;  4KHA A;  3W96 B;  1P3M A;  5E5A D;  5AV6 B;  5B24 D;  2BG1 A;  1M18 C;  1P3O B;  1N1J A;  3KUY D;  3C1C A;  5AV5 C;  3AZG C;  3MGP A;  3AV2 B;  1S32 C;  2DQN C;  3TU4 A;  3WA9 D;  4EO5 B;  1KX5 D;  1EQZ D;  3MGQ D;  4J8U C;  4NE5 A;  3REI C;  4J8X D;  3W99 D;  3AV1 B;  3LEL C;  2PYO C;  3EPK A;  3AZM C;  4YS3 B;  5BS7 C;  5AV8 B;  3A6N D;  1JFI B;  2NQB C;  4M6B A;  3REL B;  4ZUX A;  4J8V A;  1KX4 A;  3AZH A;  5GXQ D;  3LJA A;  3FDD A;  3MGS B;  2JCH A;  3A1K A;  5B40 D;  3UT9 B;  5DNM B;  3LZ0 A;  3AYW B;  3W96 D;  5F99 C;  2FJ7 B;  5B2I A;  3W97 B;  3AZF A;  5AV6 D;  1F1E A;  3AV2 D;  1U35 C;  4X23 B;  4Z5T A;  3W98 A;  4J8W C;  2BYK A;  4R8P B;  4H9O A;  5GT3 B;  3AV1 D;  3LZ1 D;  4YS3 D;  5AV8 D;  3MGR B;  3B6G A;  4QLC B;  3REL D;  2Y2I A;  5AVC C;  5B0Z C;  1AOI A;  3WAA B;  3MGS D;  2F8N A;  3REJ C;  4CAY B;  3NQU A;  3AYW D;  2FJ7 D;  5BT1 C;  5GSU B;  5B31 B;  1BH9 A;  2L5A A;  5B1L D;  1P3K C;  4WU8 B;  4X23 D;  1KU5 A;  3AZK D;  1ZLA B;  3WTP C;  3X1S B;  5GT0 C;  3B6F C;  3UTB A;  5CP6 C;  2Y2O A;  1TZY C;  4XUJ D;  4R8P D;  1P3F C;  3VH6 A;  1P3M B;  3KWQ C;  3VH6 W;  5CPJ A;  3C1C B;  2FFF B;  3MGP B;  3MGR D;  2CV5 A;  3MNN C;  3O62 A;  4QLC D;  2CWE A;  3WAA D;  1M1A C;  1F66 D;  1Q9C A;  5GSU D;  5B32 G;  3C1B D;  4G92 B;  2HIO A;  4ZUX B;  5B33 C;  4WU8 D;  4J8V B;  1KX4 B;  3AZH B;  3X1S D;  5E5A C;  5DNN A;  5B24 C;  4YM6 B;  3UTA D;  4ZBJ B;  3LZ0 B;  3KUY C;  3AZJ A;  5CPI A;  3F6T A;  1P3G A;  3WA9 C;  4JJN A;  2Y2K A;  3WKJ A;  4LD9 A;  2IO5 C;  1KX5 C;  3MGQ C;  1P34 D;  3C1C D;  4Z5T B;  4J8X C;  3W98 B;  3W99 C;  1B67 A;  2BYK B;  5JRG A;  4H9O B;  3A6N C;  3REH A;  3X1T A;  3R45 A;  4H9P A;  1H3O B;  5GXQ C;  1P3P D;  5KDM A;  3B6G B;  3KXB A;  3MVD A;  4XZQ D;  4ZUX D;  3W96 C;  4UUZ B;  4J8V D;  1M18 A;  3AZG A;  1KX4 D;  5AV5 A;  3AZH D;  5B2J D;  3REK D;  1S32 A;  1AOI B;  2F8N B;  4YM6 D;  3NQU B;  4J8U A;  2NZD D;  3REI A;  4EO5 C;  3LEL A;  2PYO A;  4Z5T D;  3AZM A;  3H0M C;  3W98 D;  5BS7 A;  1W2E A;  4G91 C;  5AY8 C;  3UTB B;  2NQB A;  5B0Y D;  3LZ1 C;  4KUD A;  1M19 C;  4YS3 C;  5C3I B;  1P3I B;  3VH5 W;  3REL C;  5CPJ B;  3X1U B;  3AZN A;  2ZY2 A;  3MGS C;  2ZY3 A;  1KX3 B;  1U35 A;  1AOI D;  5FUG A;  5CPK D;  4NFT A;  4WNN A;  5B1L C;  4WU9 B;  2VQR A;  4AWL B;  4X23 C;  3AZK C;  1P3B B;  5AVB D;  2HIO B;  4XUJ C;  1P3A C;  2JSS A;  5DNN B;  5B1M C;  3AZJ B;  5AVC A;  2ARO D;  5CPI B;  1P3I D;  1P3G B;  5AV9 A;  4JJN B;  2Y2L A;  3V9R A;  3REJ A;  3VH6 T;  3X1U D;  1P3L B;  2JE5 A;  5B32 C;  3WAA C;  1P3O D;  1F66 C;  5JRG B;  2Y2J A;  1P3K A;  1KX3 D;  5CHL B;  3KFU G;  2YFW A;  5GSU C;  3REH B;  3WTP A;  5GT0 A;  3C1B C;  3R45 B;  4H9P B;  4WU9 D;  4WU8 C;  5CP6 A;  1TZY A;  1P3F A;  3H0L C;  3EPH A;  4WV4 B;  5KDM B;  3KXB B;  3UTA C;  3MVD B;  1P3B D;  1M18 B;  1ID3 C;  2Y2H A;  3AZG B;  4H9N A;  1S32 B;  2ZY5 A;  5DNN D;  3A1I A;  4DRB A;  3MNN A;  1P34 C;  3C1C C;  3UT9 D;  5DNM D;  3REI B;  2Y2P A;  1M1A A;  1HQ3 A;  3LEL B;  1P3L D;  2PYO B;  3W97 D;  3AZM B;  2NQB B;  3AZE C;  4KUD B;  4E44 A;  5B33 A;  4Z66 C;  1P3P C;  4NE3 A;  4KHA B;  5E5A A;  5GT3 D;  4XZQ C;  2RVQ D;  4J8V C;  3KUY A;  1KX4 C;  2BYM A;  3AZH C;  5B2J C;  3REK C;  3AZN B;  1N1J B;  4YM6 C;  3KXB D;  3AZI A;  3MVD D;  3WA9 A;  1KX5 A;  3MGQ A;  3TU4 B;  2YFV A;  2NZD C;  3X1V C;  1U35 B;  5FUG B;  4J8X A;  1WWI A;  4WNN B;  3B0B A;  4Z5T C;  3B0C W;  3A6N A;  3H0R C;  5B0Y C;  3LEL D;  1B6W A;  5B31 D;  3B0D C;  3AZM D;  3AFA A;  5GXQ A;  3AN2 A;  2NQB D;  1ZLA D;  4KUD D;  4HGA C;  3LJA B;  3W96 A;  5AVC B;  1ULY A;  5AV9 B;  1P3M D;  4KGC A;  3V9R B;  2ZY4 A;  5B2I B;  3AZF B;  1EQZ C;  3AZL A;  1AOI C;  5CPK C;  3AZN D;  2DF4 C;  3MGP D;  3TU4 D;  1P3K B;  1U35 D;  4DQY B;  3WTP B;  5GT0 B;  5AY8 A;  5AVB C;  5CP6 B;  3LZ1 A;  1TZY B;  1M19 A;  2F8N K;  2W8S A;  3REL A;  5B40 C;  2ARO C;  1P3I C;  4H9N B;  3MGS A;  2XD5 A;  3MNN B;  3LJA D;  3X1U C;  5AV6 C;  1TAF A;  4WJ3 C;  1P3O C;  3LZ0 D;  5AV9 D;  3AV2 C;  4H9S C;  1HQ3 B;  1M1A B;  5B2I D;  5B1L A;  3AZF D;  1KX3 C;  1BH9 B;  4X23 A;  3AZK A;  5BT1 D;  2RIQ A;  4WU9 C;  4XUJ A;  3AV1 C;  5B33 B;  1P3A A;  3VH5 A;  3WTP D;  5E5A B;  5GT0 D;  1P3B C;  2HUE B;  5AV8 C;  5B1M A;  5CP6 D;  3KUY B;  2BYM B;  3WA9 B;  3AZI B;  3EPL A;  2IO5 B;  5F99 A;  1KX5 B;  2CV5 B;  3MGQ B;  3B6G D;  3UT9 C;  5DNM C;  2LY8 A;  5B32 A;  3O62 B;  3WAA A;  3AYW C;  2FJ7 C;  1BFM A;  1F66 A;  1P3L C;  3W97 C;  2F8N D;  4J8W A;  3A6N B;  5GSU A;  1M1A D;  1HQ3 D;  3EG5 B;  3C1B A;  4WU8 A;  4R8P C;  3AFA B;  5GXQ B;  3AN2 B;  5GT3 C;  2Y2G A;  3NQJ A;  3UTA A;  2RVQ C;  5B33 D;  3UTB D;  1ID3 A;  3KXB C;  3MVD C;  4KGC B;  1A7W A;  1BH8 A;  5B0Z A;  3MGR C;  1P34 A;  3WKJ B;  4LD9 B;  3AZL B;  4UPK A;  5CPJ D;  2Y2Q A;  4QLC C;  3AZI D;  1PZR A;  4H9R A;  2CV5 D;  3AL0 C;  1WWS A;  3O62 D;  4G91 B;  5AY8 B;  5B31 C;  3AZE A;  4CSR A;  3LZ1 B;  3X1T B;  3EPJ A;  1M19 B;  3B6F A;  4Z66 A;  1P3P A;  1T3U A;  3B0C T;  3IP4 C;  5BO0 A;  1ZLA C;  4KUD C;  3X1S C;  4XZQ A;  3KWQ A;  2HIO D;  3AFA D;  5B2J A;  3REK A;  3AN2 D;  1P3M C;  5BNV A;  5AV5 B;  4YM6 A;  2XD1 A;  1TAF B;  2ZM5 A;  3AZN C;  2NZD A;  3AZJ D;  3X1V A;  3MGP C;  4J8U B;  4KGC D;  5CPI D;  1P3G D;  3TU4 C;  5B1L B;  4E45 A;  4JJN D;  3WKJ D;  4LD9 D;  3AZL D;  3AZK B;  5BNX A;  5B0Y A;  5G49 A;  4XUJ B;  1P3A B;  5JRG D;  3P5J B;  5AY8 D;  4DRA A;  5B1M B;  3REH D;  3X1T D;  4G92 C;  1M19 D;  1H3O A;  5B24 A;  4ZUX C;  4H9Q A;  3LJA C;  5F99 B;  4Z2M G;  4UUZ A;  2J8P A;  4ZBJ C;  5B32 B;  5AV9 C;  3LZ0 C;  5CPK A;  1M18 D;  1EQZ A;  3AZG D;  5AV5 D;  5JA4 A;  5B2I C;  1S32 D;  1F66 B;  3AZF C;  3W99 A;  4J8W B;  4J8U D;  3W98 C;  3C1B B;  5AVB A;  3REI D;  2PYO D;  1Z2C B;  3NQJ B;  3UTA B;  1P3A D;  1ID3 B;  5B40 A;  2ARO A;  1P3I A;  1BH8 B;  5B1M D;  5B31 G;  5B0Z B;  1P34 B;  3B6G C;  3VH5 T;  3X1U A;  2Y2N A;  5AV6 A;  3REJ B;  4NE6 A;  1P3O A;  2F8N H;  3AV2 A;  4H9S A;  5F99 D;  4H9R B;  2UWX A;  1KX3 A;  2G5I C;  5B32 D;  1HQ3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...