4KUDB

Crystal structure of n-terminal acetylated sir3 bah domain d205n mutant in complex with yeast nucleosome core particle
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
88
structure length
88
Chain Sequence
AKRHRKILRDNIQGITKPAIRRLARRGGVKRISGLIYEEVRAVLKSFLESVIRDSVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3
publication title N alpha-acetylated Sir3 stabilizes the conformation of a nucleosome-binding loop in the BAH domain
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein/transcription/dna
total genus 25
structure length 88
sequence length 88
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4kudB00
3AZNB 1P3LD 3MGQD 3C1CC 5AV6A 4XZQC 4WU8C 3VH6T 3WKJA 5B2JA 5C3IB 3WTPA 5BS7C 4KGCB 3AV1A 3AZJC 1KX4B 4QLCB 1P3KD 3W97A 5B0ZD 5AV8C 5CP6D 3X1VD 1EQZD 1ZLAC 1P3FD 5B0YC 3MGSC 1A7WA 3REJC 3UTAA 3MVDA 3A6ND 4CAYB 4NE5A 3WTPE 3LZ0D 3AFAC 5BNVA 3AZLC 3WAAD 3REID 3AV2A 3KWQA 1F66C 3TU4D 4R8PD 2NQBB 3MGQB 3B6GD 3C1CA 3LZ1D 3W98A 3UTBD 4X23B 1R4VA 3UT9C 4YM6A 4JJNC 3AZHC 3AZID 2YFVB 5GXQC 4E45A 5B33D 5DNMC 4H9SA 3AZJA 3X1SB 1P3KB 5GSUB 4HGAC 4H9NA 3O62B 3KUYD 4J8XD 5BO0B 1EQZB 5B32D 1ID3D 5B2IA 3REKB 3C1BC 5DNND 1P3AD 5GT0D 3B6FD 1P34D 5CPKA 2HUEC 1M1AB 4J8WD 5F99A 3AYWB 3AZNA 3REIB 3AZKD 1P3LC 4EO5B 1H3OB 1F66A 3AZED 3X1UD 5B1LD 4XUJB 3LZ1B 5B31G 4J8VD 5B24D 1P3ID 3AZFD 4KGCA 3UT9A 3V9RB 1KX4A 4WU9D 4WNNA 3AZIB 3X1TC 3LJAB 5B33B 5G49A 3MGPB 3AZMC 1HQ3B 3AZGB 5CP6C 3X1VC 1BH8B 2AROB 1BFMA 4ZBJC 1P3FC 2PYOC 3W99A 3KUYB 3NQUB 5CPJC 5CPIB 4Z2MG 5B32B 3A6NC 3KXBD 4CAYA 1WWSA 3LZ0C 4LD9B 3WAAC 5DNNB 1P3AB 4KUDC 5GT0B 3R45B 4UUZB 2CV5D 5AVBB 3TU4C 1KX3B 5JRGB 2BYMB 3B6GC 3MGQA 1TZYD 2RVQC 4H9OA 5AV6C 3UTBC 3AZEB 3MGRD 5B1LB 5AVCD 4J8VB 3WKJC 3AZFB 2LY8A 2FJ7B 4H9RA 3VH5A 1P3BB 1P3KA 3AV1C 4KGCD 3MNNB 5B0ZA 3W97C 4QLCD 5BT1C 1JFIA 5CP6A 3X1VA 2F8NB 1EQZA 1P3FA 5JA4B 1TAFA 5E5AD 1P34C 4Z5TD 3A6NA 3UTAC 3LZ0A 3AZKC 3WAAA 3REIA 3NQJB 4H9QA 3RELB 3WA9B 4DRBA 3TU4A 4R8PA 3X1UC 1P3OB 4AWLC 1B6WA 3B6GA 1TZYB 2HIOB 3LZ1A 2NQBD 2NZDD 5B24C 1P3IC 3MGRB 3UTBA 3W98C 4WU9C 3V9RA 5AVCB 4X23D 4YM6C 3AZIA 5B33A 1U35D 3VH5W 1BH8A 2IO5C 4H9SC 3X1SD 3KUYA 3NQUA 4J8XA 1P3GB 5GSUD 3B0BA 3O62D 5B32A 4WZSB 4Z66D 3KXBC 3REJB 1ID3A 2F8NK 5DNNA 5B2IC 1P3AA 5E5AB 5GT0A 3B6FA 4Z5TB 3REKD 1P34A 5FUGB 3R45A 3W96D 2CV5C 4UUZA 5CPKC 4J8WA 1N1JB 3AZKA 5F99C 1M1AD 2BYMA 3AYWD 4G92C 3AZNC 2YFWB 4J8UD 3AZEA 4G91B 3X1UA 5B1LA 4NE3A 2NZDB 4J8VA 1P3MB 5B24A 1P3IA 4XUJD 5GXQB 3AZFA 5B1MB 3AN2B 1HTAA 4KGCC 4WU9A 2L5AA 1KX4C 4HGAB 1KX5D 4NE6A 2BYKB 1U35B 3LJAD 3VH5T 3MGPD 3REHD 1HQ3D 3AZGD 4CSRB 2AROD 4H9PA 3W99C 5AV9B 4Z66B 3KXBA 5GT3B 5CPID 2HUEB 4LD9D 3W96B 5BNXB 2CV5A 5AVBD 1KX3D 1TZYA 5JRGD 4J8UB 1S32D 3MGQC 3MGRA 5AY8D 4X23C 5B40B 5AVCA 5B31D 4YS3D 2FJ7D 1P3KC 3X1SC 1P3BD 1AOIB 4QLCA 1KX5B 5AV5B 2PYOB 5B0ZC 3MNND 5CPJB 3REHB 3O62C 4ZUXD 1EQZC 2F8ND 1M19D 5E5AA 3REKC 4Z5TA 1P3PD 4KUDB 3LELB 1M1AC 3AYWC 3REIC 4EO5C 3RELD 3WA9D 4R8PC 4NFTA 1S32B 1P3OD 2NQBA 2NZDA 3LZ1C 4WU8D 2HIOD 5AY8B 5B2JB 3WTPB 3B0DB 4X23A 1KU5A 3AZIC 5B31B 2YFVA 5B33C 1U35A 1HQ3C 3AZGC 4YS3B 5AV8D 4CSRA 3X1SA 1BH9B 1M18B 5GSUA 3KUYC 4J8XC 3O62A 1P3GD 5KDMB 4Z66A 5BO0A 1ZLAD 5B0YD 4ZUXB 5B32C 3MGSD 1ID3C 1M19B 3MVDB 3REJD 4LD9C 5DNNC 3REKA 1P3AC 3W96A 1P3PB 5GT0C 3AFAD 3B6FC 3AZLD 5BNXA 4J8WC 3AV2B 5AVBC 3KWQB 3AYWA 1M1AA 1KX3C 5JRGC 4J8UA 3C1CB 4XZQB 1H3OA 1ULYA 3AZEC 3W98B 5B1LC 4XUJA 4WU8B 4E44A 4J8VC 4JJND 3AZHD 1P3MD 1Q9CA 3AZFC 5GXQD 5B1MD 3AN2D 1P3BC 5DNMD 3AZJB 1KX5A 2F8NH 3MNNC 3LJAA 3MGPA 3REHA 1HQ3A 4H9NB 3AZGA 5AV8B 2AROA 1ZLAB 5AV9D 5B0YB 3C1BD 3MGSB 5CPIA 5GT3D 4LD9A 3AFAB 4G92B 3AZLB 3RELC 3WA9C 5AVBA 1KX3A 1P3OC 5JRGA 1F66B 1S32A 1TZYC 2HIOC 5AY8A 3MGRC 3UT9B 4KHAB 5AVCC 5B40D 4JJNB 5B31A 3AZHB 4WNNB 4WV4B 3X1TD 5G49B 5C3IC 4YS3A 2FJ7A 5DNMB 3AZMD 1P3BA 5CHLB 1BH9A 1M18A 4QLCC 3MNNA 3W99B 1AOID 1P3GC 5AV5D 2PYOD 5KDMA 5CPJD 4ZUXA 2F8NA 1M19A 5JA4A 1P3PA 5E5AC 3C1BB 4Z5TC 4KUDD 3LELD 3NQJA 1P3LB 4XZQA 2RVQD 4H9OB 3RELA 3WA9A 4G91C 5AV6D 1P3OA 2NQBC 4WU8A 2HIOA 2NZDC 1P3MC 5B1MC 3AN2C 3WKJD 5BS7A 5B2JD 3WTPD 4H9RB 3AV1D 3X1TB 5B0ZB 1U35C 3W97D 5AV8A 3AZMB 1JFIB 5CP6B 5BT1D 3X1VB 5B32G 4ZBJB 1P3FB 1ZLAA 5AV9C 5GSUC 1P3GA 1M18D 1TAFB 5B0YA 3MGSA 4Z66C 3B0CW 3REJA 5GT3C 3A6NB 3LZ0B 3UTAD 3MVDD 3AFAA 3WAAB 3AZLA 3W96C 5FUGA 4H9QB 1N1JA 3TU4B 4R8PB 3AV2D 1B67A 3KWQD 3B6GB 4J8UC 2YFWA 1WWIA 3VH6A 5AV6B 3C1CD 4XZQD 3UTBB 5B40C 3W98D 4KHAA 4JJNA 3AZHA 4XUJC 1P3MA 4YM6D 5GXQA 5B1MA 3AN2A 3WKJB 5DNMA 2F8NG 3AV1B 1AOIC 1KX5C 4DRAA 5AV5C 3AZJD 3LJAC 3W97B 2BYKA 4J8XB 3MGPC 3REHC 1ID3B 2AROC 5AV9A 3C1BA 5B2ID 3B6FB 1P34B 3B0CT 5CPIC 3LELC 5GT3A 3UTAB 4J8WB 5CPKD 3AZKB 5F99D 5BNVB 1P3LA 3AZND 3KSYA 3X1UB 4AWLB 1S32C 1F66D 3VH6W 5AY8C 5B24B 1P3IB 5B2JC 3WTPC 3B0DC 5B40A 4WU9B 3UT9D 4YM6B 5B31C 3X1TA 1KX4D 4M6BA 3AZMA 4YS3C 1F1EA 2IO5B 2FJ7C 1AOIA 5AV5A 4H9PB 1M18C 2PYOA 3W99D 5CPJA 2JSSA 4ZUXC 3KXBB 1M19C 4Z2MH 3MVDC 5B2IB 1P3PC 4KUDA 3LELA 2CWEA 2CV5B 5CPKB 3AV2C 3KWQC 5F99B
chains in the Genus database with same CATH superfamily
3AZNB 1P3LD 3MGQD 2DQNC 3C1CC 5AV6A 4XZQC 4WU8C 3VH6T 2DF4C 3WKJA 5B2JA 5C3IB 3WTPA 5BS7C 4KGCB 3AV1A 3AZJC 1KX4B 4QLCB 1P3KD 3W97A 5B0ZD 3EPKA 5AV8C 5CP6D 3X1VD 1EQZD 1ZLAC 1P3FD 5B0YC 3MGSC 1A7WA 3REJC 3UTAA 3MVDA 3A6ND 2VQRA 4CAYB 4NE5A 3WTPE 3LZ0D 3AFAC 5BNVA 3AZLC 3WAAD 3REID 3AV2A 3KWQA 1W2EA 1F66C 3TU4D 4R8PD 2NQBB 3MGQB 3EPLA 3B6GD 3C1CA 3LZ1D 3W98A 3UTBD 4X23B 1R4VA 3UT9C 3FDDA 4YM6A 4JJNC 3AZHC 3AZID 2YFVB 5GXQC 4E45A 5B33D 5DNMC 4H9SA 3AZJA 3X1SB 1P3KB 5GSUB 4HGAC 4H9NA 3O62B 3KUYD 4J8XD 5BO0B 1EQZB 5B32D 1ID3D 5B2IA 3REKB 3C1BC 5DNND 1P3AD 5GT0D 2Y2PA 3B6FD 1P34D 5CPKA 2HUEC 1M1AB 4J8WD 5F99A 3AYWB 3AZNA 3REIB 3AZKD 1P3LC 4EO5B 1H3OB 1F66A 3AZED 2JCHA 2Y2LA 2J8PA 3X1UD 2Y2JA 5B1LD 4XUJB 3LZ1B 5B31G 4J8VD 5B24D 1P3ID 4DQYB 3AZFD 4KGCA 3UT9A 3V9RB 1KX4A 4WU9D 4WNNA 3AZIB 3X1TC 3LJAB 5B33B 5G49A 3MGPB 3AZMC 1HQ3B 3AZGB 5CP6C 3X1VC 1BH8B 2AROB 1BFMA 4ZBJC 1P3FC 2PYOC 3W99A 3KUYB 3NQUB 5CPJC 3KFUG 5CPIB 4Z2MG 5B32B 3A6NC 3EG5B 3KXBD 4CAYA 1WWSA 3LZ0C 4LD9B 3WAAC 5DNNB 1P3AB 4KUDC 5GT0B 3R45B 4UUZB 2CV5D 5AVBB 3TU4C 1KX3B 5JRGB 2BYMB 3B6GC 4UPKA 3MGQA 3IP4C 1TZYD 2RVQC 4H9OA 5AV6C 3UTBC 3AZEB 3MGRD 5B1LB 3F6TA 5AVCD 2ZY5A 4J8VB 3WKJC 3AZFB 2LY8A 2FJ7B 4H9RA 3VH5A 1P3BB 1P3KA 3AV1C 4KGCD 3A1IA 3MNNB 5B0ZA 3W97C 4QLCD 5BT1C 1JFIA 5CP6A 3X1VA 2F8NB 1EQZA 1P3FA 5JA4B 1TAFA 5E5AD 1P34C 4Z5TD 3A6NA 3UTAC 3LZ0A 3AZKC 3WAAA 3REIA 3NQJB 4H9QA 3RELB 3WA9B 4DRBA 3TU4A 4R8PA 3X1UC 1P3OB 4AWLC 1B6WA 3B6GA 1TZYB 1T3UA 2HIOB 3LZ1A 2NQBD 5B24C 1P3IC 2NZDD 3MGRB 3UTBA 2ZY2A 3W98C 3P5JB 4WU9C 3V9RA 3AL0C 5AVCB 2ZY3A 3H0RC 4YM6C 4X23D 3AZIA 5B33A 1U35D 3VH5W 1BH8A 2IO5C 4H9SC 3X1SD 3KUYA 3NQUA 4J8XA 1P3GB 5GSUD 3B0BA 3O62D 5B32A 2G5IC 4WZSB 4Z66D 3KXBC 3REJB 1ID3A 2F8NK 5DNNA 5B2IC 2ZM5A 5E5AB 1P3AA 5GT0A 3B6FA 4Z5TB 3REKD 1P34A 5FUGB 3R45A 3W96D 2CV5C 4UUZA 5CPKC 4J8WA 1N1JB 3AZKA 5F99C 1M1AD 2BYMA 3AYWD 4G92C 3AZNC 2FFFB 2YFWB 4J8UD 2XD5A 3AZEA 4G91B 3X1UA 5B1LA 4NE3A 2NZDB 4J8VA 1P3MB 5B24A 1P3IA 4XUJD 5GXQB 3AZFA 5B1MB 3AN2B 1HTAA 4KGCC 4WU9A 2L5AA 1KX4C 4HGAB 1KX5D 4NE6A 2BYKB 1U35B 3LJAD 3VH5T 3MGPD 3REHD 1HQ3D 3AZGD 4CSRB 2AROD 4H9PA 3W99C 5AV9B 4Z66B 3KXBA 5GT3B 5CPID 2HUEB 2BG1A 4LD9D 3W96B 5BNXB 2CV5A 5AVBD 1KX3D 1TZYA 5JRGD 4J8UB 1S32D 3MGQC 2Y2MA 3MGRA 5AY8D 4X23C 5B40B 5AVCA 5B31D 4YS3D 2FJ7D 1P3KC 3X1SC 1P3BD 1AOIB 4QLCA 1KX5B 5AV5B 2PYOB 5B0ZC 3MNND 5CPJB 3REHB 3O62C 4ZUXD 1EQZC 2F8ND 2JE5A 1M19D 5E5AA 3REKC 4Z5TA 1P3PD 4KUDB 3LELB 2UWXA 1M1AC 3AYWC 3REIC 4EO5C 3RELD 2G5HC 4R8PC 3WA9D 4NFTA 1S32B 1P3OD 2NQBA 2NZDA 3LZ1C 4WU8D 2HIOD 5AY8B 2W8SA 5B2JB 3WTPB 3B0DB 4X23A 1KU5A 3AZIC 5B31B 2YFVA 5B33C 1U35A 1HQ3C 3AZGC 4YS3B 5AV8D 4CSRA 3X1SA 1BH9B 1M18B 5GSUA 3KUYC 4J8XC 3O62A 1P3GD 5KDMB 4Z66A 5BO0A 2Y2QA 5B0YD 1ZLAD 4ZUXB 5B32C 3MGSD 1ID3C 1M19B 3MVDB 3REJD 4LD9C 2Y2GA 5DNNC 3REKA 1P3AC 3W96A 1P3PB 5GT0C 3AFAD 3B6FC 3AZLD 5BNXA 4J8WC 3AV2B 5AVBC 3KWQB 3AYWA 1M1AA 1KX3C 5JRGC 4J8UA 3C1CB 4XZQB 1H3OA 1ULYA 3AZEC 1PZRA 3W98B 5B1LC 4XUJA 4WU8B 4E44A 4J8VC 4JJND 3AZHD 1P3MD 1Q9CA 3AZFC 5GXQD 5B1MD 3AN2D 1P3BC 5DNMD 3AZJB 1KX5A 2F8NH 3MNNC 3LJAA 3MGPA 3REHA 2Y2KA 1HQ3A 4H9NB 3AZGA 5AV8B 2AROA 1ZLAB 5AV9D 5B0YB 3C1BD 3MGSB 5CPIA 5GT3D 4LD9A 3AFAB 4G92B 3AZLB 3RELC 3WA9C 5AVBA 1KX3A 1P3OC 5JRGA 1F66B 1S32A 1TZYC 2HIOC 5AY8A 3MGRC 3UT9B 4KHAB 5AVCC 5B40D 4JJNB 5B31A 3AZHB 4WNNB 4WV4B 3X1TD 5G49B 5C3IC 4YS3A 2FJ7A 5DNMB 3AZMD 1P3BA 5CHLB 1BH9A 1M18A 4QLCC 3MNNA 3W99B 1AOID 1P3GC 5AV5D 2PYOD 5KDMA 5CPJD 2RIQA 4ZUXA 2F8NA 1M19A 5JA4A 1P3PA 5E5AC 3C1BB 4Z5TC 2Y2IA 4KUDD 3LELD 3NQJA 1P3LB 4XZQA 2RVQD 4H9OB 3RELA 3WA9A 4G91C 5AV6D 1P3OA 2Y2NA 2NQBC 4WU8A 2HIOA 2NZDC 1P3MC 5B1MC 3AN2C 3WKJD 5BS7A 5B2JD 3WTPD 4H9RB 4WJ3C 3AV1D 3X1TB 5B0ZB 1U35C 3W97D 5AV8A 3AZMB 1JFIB 5CP6B 5BT1D 3X1VB 5B32G 3A1KA 4ZBJB 1P3FB 1ZLAA 5AV9C 5GSUC 1P3GA 1M18D 1TAFB 5B0YA 3MGSA 4Z66C 3B0CW 3REJA 5GT3C 3A6NB 3LZ0B 3UTAD 3MVDD 3AFAA 3WAAB 3AZLA 3W96C 5FUGA 4H9QB 2XD1A 1N1JA 3TU4B 4R8PB 3AV2D 3EPHA 1B67A 3KWQD 3B6GB 4J8UC 2YFWA 3H0LC 1WWIA 3VH6A 5AV6B 3C1CD 4XZQD 3UTBB 5B40C 3W98D 4KHAA 4JJNA 3AZHA 4XUJC 1P3MA 4YM6D 5GXQA 5B1MA 3AN2A 3WKJB 5DNMA 2F8NG 3AV1B 1AOIC 1KX5C 4DRAA 5AV5C 3AZJD 3LJAC 3W97B 2BYKA 4J8XB 3MGPC 3REHC 1ID3B 2AROC 5AV9A 3H0MC 3C1BA 5B2ID 3B6FB 1P34B 3B0CT 5CPIC 3LELC 5GT3A 1Z2CB 3UTAB 4J8WB 5CPKD 3AZKB 5F99D 5BNVB 1P3LA 3AZND 3KSYA 3EPJA 3X1UB 4AWLB 1S32C 1F66D 3VH6W 5AY8C 5B24B 1P3IB 2F2AC 5B2JC 3WTPC 3B0DC 5B40A 4WU9B 3UT9D 2ZY4A 4YM6B 2Y2OA 5B31C 3X1TA 1KX4D 2Y2HA 4M6BA 3AZMA 4YS3C 1F1EA 2IO5B 2FJ7C 1AOIA 5AV5A 4H9PB 1M18C 2PYOA 3W99D 5CPJA 2JSSA 4ZUXC 3KXBB 1M19C 4Z2MH 3MVDC 5B2IB 1P3PC 4KUDA 3LELA 2CWEA 2CV5B 5CPKB 3AV2C 3KWQC 5F99B
chains in the Genus database with same CATH topology
3AZNB 1P3LD 3MGQD 2DQNC 3C1CC 5AV6A 4XZQC 4WU8C 3VH6T 2DF4C 3WKJA 5B2JA 5C3IB 3WTPA 5BS7C 4KGCB 3AV1A 3AZJC 1KX4B 4QLCB 1P3KD 3W97A 5B0ZD 3EPKA 5AV8C 5CP6D 3X1VD 1EQZD 1ZLAC 1P3FD 5B0YC 3MGSC 1A7WA 3REJC 3UTAA 3MVDA 3A6ND 2VQRA 4CAYB 4NE5A 3WTPE 3LZ0D 3AFAC 5BNVA 3AZLC 3WAAD 3REID 3AV2A 3KWQA 1W2EA 1F66C 3TU4D 4R8PD 2NQBB 3MGQB 3EPLA 3B6GD 3C1CA 3LZ1D 3W98A 3UTBD 4X23B 1R4VA 3UT9C 3FDDA 4YM6A 4JJNC 3AZHC 3AZID 2YFVB 5GXQC 4E45A 5B33D 5DNMC 4H9SA 3AZJA 3X1SB 1P3KB 5GSUB 4HGAC 4H9NA 3O62B 3KUYD 4J8XD 5BO0B 1EQZB 5B32D 1ID3D 5B2IA 3REKB 3C1BC 5DNND 1P3AD 5GT0D 2Y2PA 3B6FD 1P34D 5CPKA 2HUEC 1M1AB 4J8WD 5F99A 3AYWB 3AZNA 3REIB 3AZKD 1P3LC 4EO5B 1H3OB 1F66A 3AZED 2JCHA 2Y2LA 2J8PA 3X1UD 2Y2JA 5B1LD 4XUJB 3LZ1B 5B31G 4J8VD 5B24D 1P3ID 4DQYB 3AZFD 4KGCA 3UT9A 3V9RB 1KX4A 4WU9D 4WNNA 3AZIB 3X1TC 3LJAB 5B33B 5G49A 3MGPB 3AZMC 1HQ3B 3AZGB 5CP6C 3X1VC 1BH8B 2AROB 1BFMA 4ZBJC 1P3FC 2PYOC 3W99A 3KUYB 3NQUB 5CPJC 3KFUG 5CPIB 4Z2MG 5B32B 3A6NC 3EG5B 3KXBD 4CAYA 1WWSA 3LZ0C 4LD9B 3WAAC 5DNNB 1P3AB 4KUDC 5GT0B 3R45B 4UUZB 2CV5D 5AVBB 3TU4C 1KX3B 5JRGB 2BYMB 3B6GC 4UPKA 3MGQA 3IP4C 1TZYD 2RVQC 4H9OA 5AV6C 3UTBC 3AZEB 3MGRD 5B1LB 3F6TA 5AVCD 2ZY5A 4J8VB 3WKJC 3AZFB 2LY8A 2FJ7B 4H9RA 3VH5A 1P3BB 1P3KA 3AV1C 4KGCD 3A1IA 3MNNB 5B0ZA 3W97C 4QLCD 5BT1C 1JFIA 5CP6A 3X1VA 2F8NB 1EQZA 1P3FA 5JA4B 1TAFA 5E5AD 1P34C 4Z5TD 3A6NA 3UTAC 3LZ0A 3AZKC 3WAAA 3REIA 3NQJB 4H9QA 3RELB 3WA9B 4DRBA 3TU4A 4R8PA 3X1UC 1P3OB 4AWLC 1B6WA 3B6GA 1TZYB 1T3UA 2HIOB 3LZ1A 2NQBD 5B24C 1P3IC 2NZDD 3MGRB 3UTBA 2ZY2A 3W98C 3P5JB 4WU9C 3V9RA 3AL0C 5AVCB 2ZY3A 3H0RC 4YM6C 4X23D 3AZIA 5B33A 1U35D 3VH5W 1BH8A 2IO5C 4H9SC 3X1SD 3KUYA 3NQUA 4J8XA 1P3GB 5GSUD 3B0BA 3O62D 5B32A 2G5IC 4WZSB 4Z66D 3KXBC 3REJB 1ID3A 2F8NK 5DNNA 5B2IC 2ZM5A 5E5AB 1P3AA 5GT0A 3B6FA 4Z5TB 3REKD 1P34A 5FUGB 3R45A 3W96D 2CV5C 4UUZA 5CPKC 4J8WA 1N1JB 3AZKA 5F99C 1M1AD 2BYMA 3AYWD 4G92C 3AZNC 2FFFB 2YFWB 4J8UD 2XD5A 3AZEA 4G91B 3X1UA 5B1LA 4NE3A 2NZDB 4J8VA 1P3MB 5B24A 1P3IA 4XUJD 5GXQB 3AZFA 5B1MB 3AN2B 1HTAA 4KGCC 4WU9A 2L5AA 1KX4C 4HGAB 1KX5D 4NE6A 2BYKB 1U35B 3LJAD 3VH5T 3MGPD 3REHD 1HQ3D 3AZGD 4CSRB 2AROD 4H9PA 3W99C 5AV9B 4Z66B 3KXBA 5GT3B 5CPID 2HUEB 2BG1A 4LD9D 3W96B 5BNXB 2CV5A 5AVBD 1KX3D 1TZYA 5JRGD 4J8UB 1S32D 3MGQC 2Y2MA 3MGRA 5AY8D 4X23C 5B40B 5AVCA 5B31D 4YS3D 2FJ7D 1P3KC 3X1SC 1P3BD 1AOIB 4QLCA 1KX5B 5AV5B 2PYOB 5B0ZC 3MNND 5CPJB 3REHB 3O62C 4ZUXD 1EQZC 2F8ND 2JE5A 1M19D 5E5AA 3REKC 4Z5TA 1P3PD 4KUDB 3LELB 2UWXA 1M1AC 3AYWC 3REIC 4EO5C 3RELD 2G5HC 4R8PC 3WA9D 4NFTA 1S32B 1P3OD 2NQBA 2NZDA 3LZ1C 4WU8D 2HIOD 5AY8B 2W8SA 5B2JB 3WTPB 3B0DB 4X23A 1KU5A 3AZIC 5B31B 2YFVA 5B33C 1U35A 1HQ3C 3AZGC 4YS3B 5AV8D 4CSRA 3X1SA 1BH9B 1M18B 5GSUA 3KUYC 4J8XC 3O62A 1P3GD 5KDMB 4Z66A 5BO0A 2Y2QA 5B0YD 1ZLAD 4ZUXB 5B32C 3MGSD 1ID3C 1M19B 3MVDB 3REJD 4LD9C 2Y2GA 5DNNC 3REKA 1P3AC 3W96A 1P3PB 5GT0C 3AFAD 3B6FC 3AZLD 5BNXA 4J8WC 3AV2B 5AVBC 3KWQB 3AYWA 1M1AA 1KX3C 5JRGC 4J8UA 3C1CB 4XZQB 1H3OA 1ULYA 3AZEC 1PZRA 3W98B 5B1LC 4XUJA 4WU8B 4E44A 4J8VC 4JJND 3AZHD 1P3MD 1Q9CA 3AZFC 5GXQD 5B1MD 3AN2D 1P3BC 5DNMD 3AZJB 1KX5A 2F8NH 3MNNC 3LJAA 3MGPA 3REHA 2Y2KA 1HQ3A 4H9NB 3AZGA 5AV8B 2AROA 1ZLAB 5AV9D 5B0YB 3C1BD 3MGSB 5CPIA 5GT3D 4LD9A 3AFAB 4G92B 3AZLB 3RELC 3WA9C 5AVBA 1KX3A 1P3OC 5JRGA 1F66B 1S32A 1TZYC 2HIOC 5AY8A 3MGRC 3UT9B 4KHAB 5AVCC 5B40D 4JJNB 5B31A 3AZHB 4WNNB 4WV4B 3X1TD 5G49B 5C3IC 4YS3A 2FJ7A 5DNMB 3AZMD 1P3BA 5CHLB 1BH9A 1M18A 4QLCC 3MNNA 3W99B 1AOID 1P3GC 5AV5D 2PYOD 5KDMA 5CPJD 2RIQA 4ZUXA 2F8NA 1M19A 5JA4A 1P3PA 5E5AC 3C1BB 4Z5TC 2Y2IA 4KUDD 3LELD 3NQJA 1P3LB 4XZQA 2RVQD 4H9OB 3RELA 3WA9A 4G91C 5AV6D 1P3OA 2Y2NA 2NQBC 4WU8A 2HIOA 2NZDC 1P3MC 5B1MC 3AN2C 3WKJD 5BS7A 5B2JD 3WTPD 4H9RB 4WJ3C 3AV1D 3X1TB 5B0ZB 1U35C 3W97D 5AV8A 3AZMB 1JFIB 5CP6B 5BT1D 3X1VB 5B32G 3A1KA 4ZBJB 1P3FB 1ZLAA 5AV9C 5GSUC 1P3GA 1M18D 1TAFB 5B0YA 3MGSA 4Z66C 3B0CW 3REJA 5GT3C 3A6NB 3LZ0B 3UTAD 3MVDD 3AFAA 3WAAB 3AZLA 3W96C 5FUGA 4H9QB 2XD1A 1N1JA 3TU4B 4R8PB 3AV2D 3EPHA 1B67A 3KWQD 3B6GB 4J8UC 2YFWA 3H0LC 1WWIA 3VH6A 5AV6B 3C1CD 4XZQD 3UTBB 5B40C 3W98D 4KHAA 4JJNA 3AZHA 4XUJC 1P3MA 4YM6D 5GXQA 5B1MA 3AN2A 3WKJB 5DNMA 2F8NG 3AV1B 1AOIC 1KX5C 4DRAA 5AV5C 3AZJD 3LJAC 3W97B 2BYKA 4J8XB 3MGPC 3REHC 1ID3B 2AROC 5AV9A 3H0MC 3C1BA 5B2ID 3B6FB 1P34B 3B0CT 5CPIC 3LELC 5GT3A 1Z2CB 3UTAB 4J8WB 5CPKD 3AZKB 5F99D 5BNVB 1P3LA 3AZND 3KSYA 3EPJA 3X1UB 4AWLB 1S32C 1F66D 3VH6W 5AY8C 5B24B 1P3IB 2F2AC 5B2JC 3WTPC 3B0DC 5B40A 4WU9B 3UT9D 2ZY4A 4YM6B 2Y2OA 5B31C 3X1TA 1KX4D 2Y2HA 4M6BA 3AZMA 4YS3C 1F1EA 2IO5B 2FJ7C 1AOIA 5AV5A 4H9PB 1M18C 2PYOA 3W99D 5CPJA 2JSSA 4ZUXC 3KXBB 1M19C 4Z2MH 3MVDC 5B2IB 1P3PC 4KUDA 3LELA 2CWEA 2CV5B 5CPKB 3AV2C 3KWQC 5F99B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZN B;  1P3L D;  3MGQ D;  3C1C C;  5AV6 A;  4XZQ C;  4WU8 C;  3VH6 T;  3WKJ A;  5B2J A;  5C3I B;  3WTP A;  5BS7 C;  4KGC B;  3AV1 A;  3AZJ C;  1KX4 B;  4QLC B;  1P3K D;  3W97 A;  5B0Z D;  5AV8 C;  5CP6 D;  3X1V D;  1EQZ D;  1ZLA C;  1P3F D;  5B0Y C;  3MGS C;  1A7W A;  3REJ C;  3UTA A;  3MVD A;  3A6N D;  4CAY B;  4NE5 A;  3WTP E;  3LZ0 D;  3AFA C;  5BNV A;  3AZL C;  3WAA D;  3REI D;  3AV2 A;  3KWQ A;  1F66 C;  3TU4 D;  4R8P D;  2NQB B;  3MGQ B;  3B6G D;  3C1C A;  3LZ1 D;  3W98 A;  3UTB D;  4X23 B;  1R4V A;  3UT9 C;  4YM6 A;  4JJN C;  3AZH C;  3AZI D;  2YFV B;  5GXQ C;  4E45 A;  5B33 D;  5DNM C;  4H9S A;  3AZJ A;  3X1S B;  1P3K B;  5GSU B;  4HGA C;  4H9N A;  3O62 B;  3KUY D;  4J8X D;  5BO0 B;  1EQZ B;  5B32 D;  1ID3 D;  5B2I A;  3REK B;  3C1B C;  5DNN D;  1P3A D;  5GT0 D;  3B6F D;  1P34 D;  5CPK A;  2HUE C;  1M1A B;  4J8W D;  5F99 A;  3AYW B;  3AZN A;  3REI B;  3AZK D;  1P3L C;  4EO5 B;  1H3O B;  1F66 A;  3AZE D;  3X1U D;  5B1L D;  4XUJ B;  3LZ1 B;  5B31 G;  4J8V D;  5B24 D;  1P3I D;  3AZF D;  4KGC A;  3UT9 A;  3V9R B;  1KX4 A;  4WU9 D;  4WNN A;  3AZI B;  3X1T C;  3LJA B;  5B33 B;  5G49 A;  3MGP B;  3AZM C;  1HQ3 B;  3AZG B;  5CP6 C;  3X1V C;  1BH8 B;  2ARO B;  1BFM A;  4ZBJ C;  1P3F C;  2PYO C;  3W99 A;  3KUY B;  3NQU B;  5CPJ C;  5CPI B;  4Z2M G;  5B32 B;  3A6N C;  3KXB D;  4CAY A;  1WWS A;  3LZ0 C;  4LD9 B;  3WAA C;  5DNN B;  1P3A B;  4KUD C;  5GT0 B;  3R45 B;  4UUZ B;  2CV5 D;  5AVB B;  3TU4 C;  1KX3 B;  5JRG B;  2BYM B;  3B6G C;  3MGQ A;  1TZY D;  2RVQ C;  4H9O A;  5AV6 C;  3UTB C;  3AZE B;  3MGR D;  5B1L B;  5AVC D;  4J8V B;  3WKJ C;  3AZF B;  2LY8 A;  2FJ7 B;  4H9R A;  3VH5 A;  1P3B B;  1P3K A;  3AV1 C;  4KGC D;  3MNN B;  5B0Z A;  3W97 C;  4QLC D;  5BT1 C;  1JFI A;  5CP6 A;  3X1V A;  2F8N B;  1EQZ A;  1P3F A;  5JA4 B;  1TAF A;  5E5A D;  1P34 C;  4Z5T D;  3A6N A;  3UTA C;  3LZ0 A;  3AZK C;  3WAA A;  3REI A;  3NQJ B;  4H9Q A;  3REL B;  3WA9 B;  4DRB A;  3TU4 A;  4R8P A;  3X1U C;  1P3O B;  4AWL C;  1B6W A;  3B6G A;  1TZY B;  2HIO B;  3LZ1 A;  2NQB D;  2NZD D;  5B24 C;  1P3I C;  3MGR B;  3UTB A;  3W98 C;  4WU9 C;  3V9R A;  5AVC B;  4X23 D;  4YM6 C;  3AZI A;  5B33 A;  1U35 D;  3VH5 W;  1BH8 A;  2IO5 C;  4H9S C;  3X1S D;  3KUY A;  3NQU A;  4J8X A;  1P3G B;  5GSU D;  3B0B A;  3O62 D;  5B32 A;  4WZS B;  4Z66 D;  3KXB C;  3REJ B;  1ID3 A;  2F8N K;  5DNN A;  5B2I C;  1P3A A;  5E5A B;  5GT0 A;  3B6F A;  4Z5T B;  3REK D;  1P34 A;  5FUG B;  3R45 A;  3W96 D;  2CV5 C;  4UUZ A;  5CPK C;  4J8W A;  1N1J B;  3AZK A;  5F99 C;  1M1A D;  2BYM A;  3AYW D;  4G92 C;  3AZN C;  2YFW B;  4J8U D;  3AZE A;  4G91 B;  3X1U A;  5B1L A;  4NE3 A;  2NZD B;  4J8V A;  1P3M B;  5B24 A;  1P3I A;  4XUJ D;  5GXQ B;  3AZF A;  5B1M B;  3AN2 B;  1HTA A;  4KGC C;  4WU9 A;  2L5A A;  1KX4 C;  4HGA B;  1KX5 D;  4NE6 A;  2BYK B;  1U35 B;  3LJA D;  3VH5 T;  3MGP D;  3REH D;  1HQ3 D;  3AZG D;  4CSR B;  2ARO D;  4H9P A;  3W99 C;  5AV9 B;  4Z66 B;  3KXB A;  5GT3 B;  5CPI D;  2HUE B;  4LD9 D;  3W96 B;  5BNX B;  2CV5 A;  5AVB D;  1KX3 D;  1TZY A;  5JRG D;  4J8U B;  1S32 D;  3MGQ C;  3MGR A;  5AY8 D;  4X23 C;  5B40 B;  5AVC A;  5B31 D;  4YS3 D;  2FJ7 D;  1P3K C;  3X1S C;  1P3B D;  1AOI B;  4QLC A;  1KX5 B;  5AV5 B;  2PYO B;  5B0Z C;  3MNN D;  5CPJ B;  3REH B;  3O62 C;  4ZUX D;  1EQZ C;  2F8N D;  1M19 D;  5E5A A;  3REK C;  4Z5T A;  1P3P D;  4KUD B;  3LEL B;  1M1A C;  3AYW C;  3REI C;  4EO5 C;  3REL D;  3WA9 D;  4R8P C;  4NFT A;  1S32 B;  1P3O D;  2NQB A;  2NZD A;  3LZ1 C;  4WU8 D;  2HIO D;  5AY8 B;  5B2J B;  3WTP B;  3B0D B;  4X23 A;  1KU5 A;  3AZI C;  5B31 B;  2YFV A;  5B33 C;  1U35 A;  1HQ3 C;  3AZG C;  4YS3 B;  5AV8 D;  4CSR A;  3X1S A;  1BH9 B;  1M18 B;  5GSU A;  3KUY C;  4J8X C;  3O62 A;  1P3G D;  5KDM B;  4Z66 A;  5BO0 A;  1ZLA D;  5B0Y D;  4ZUX B;  5B32 C;  3MGS D;  1ID3 C;  1M19 B;  3MVD B;  3REJ D;  4LD9 C;  5DNN C;  3REK A;  1P3A C;  3W96 A;  1P3P B;  5GT0 C;  3AFA D;  3B6F C;  3AZL D;  5BNX A;  4J8W C;  3AV2 B;  5AVB C;  3KWQ B;  3AYW A;  1M1A A;  1KX3 C;  5JRG C;  4J8U A;  3C1C B;  4XZQ B;  1H3O A;  1ULY A;  3AZE C;  3W98 B;  5B1L C;  4XUJ A;  4WU8 B;  4E44 A;  4J8V C;  4JJN D;  3AZH D;  1P3M D;  1Q9C A;  3AZF C;  5GXQ D;  5B1M D;  3AN2 D;  1P3B C;  5DNM D;  3AZJ B;  1KX5 A;  2F8N H;  3MNN C;  3LJA A;  3MGP A;  3REH A;  1HQ3 A;  4H9N B;  3AZG A;  5AV8 B;  2ARO A;  1ZLA B;  5AV9 D;  5B0Y B;  3C1B D;  3MGS B;  5CPI A;  5GT3 D;  4LD9 A;  3AFA B;  4G92 B;  3AZL B;  3REL C;  3WA9 C;  5AVB A;  1KX3 A;  1P3O C;  5JRG A;  1F66 B;  1S32 A;  1TZY C;  2HIO C;  5AY8 A;  3MGR C;  3UT9 B;  4KHA B;  5AVC C;  5B40 D;  4JJN B;  5B31 A;  3AZH B;  4WNN B;  4WV4 B;  3X1T D;  5G49 B;  5C3I C;  4YS3 A;  2FJ7 A;  5DNM B;  3AZM D;  1P3B A;  5CHL B;  1BH9 A;  1M18 A;  4QLC C;  3MNN A;  3W99 B;  1AOI D;  1P3G C;  5AV5 D;  2PYO D;  5KDM A;  5CPJ D;  4ZUX A;  2F8N A;  1M19 A;  5JA4 A;  1P3P A;  5E5A C;  3C1B B;  4Z5T C;  4KUD D;  3LEL D;  3NQJ A;  1P3L B;  4XZQ A;  2RVQ D;  4H9O B;  3REL A;  3WA9 A;  4G91 C;  5AV6 D;  1P3O A;  2NQB C;  4WU8 A;  2HIO A;  2NZD C;  1P3M C;  5B1M C;  3AN2 C;  3WKJ D;  5BS7 A;  5B2J D;  3WTP D;  4H9R B;  3AV1 D;  3X1T B;  5B0Z B;  1U35 C;  3W97 D;  5AV8 A;  3AZM B;  1JFI B;  5CP6 B;  5BT1 D;  3X1V B;  5B32 G;  4ZBJ B;  1P3F B;  1ZLA A;  5AV9 C;  5GSU C;  1P3G A;  1M18 D;  1TAF B;  5B0Y A;  3MGS A;  4Z66 C;  3B0C W;  3REJ A;  5GT3 C;  3A6N B;  3LZ0 B;  3UTA D;  3MVD D;  3AFA A;  3WAA B;  3AZL A;  3W96 C;  5FUG A;  4H9Q B;  1N1J A;  3TU4 B;  4R8P B;  3AV2 D;  1B67 A;  3KWQ D;  3B6G B;  4J8U C;  2YFW A;  1WWI A;  3VH6 A;  5AV6 B;  3C1C D;  4XZQ D;  3UTB B;  5B40 C;  3W98 D;  4KHA A;  4JJN A;  3AZH A;  4XUJ C;  1P3M A;  4YM6 D;  5GXQ A;  5B1M A;  3AN2 A;  3WKJ B;  5DNM A;  2F8N G;  3AV1 B;  1AOI C;  1KX5 C;  4DRA A;  5AV5 C;  3AZJ D;  3LJA C;  3W97 B;  2BYK A;  4J8X B;  3MGP C;  3REH C;  1ID3 B;  2ARO C;  5AV9 A;  3C1B A;  5B2I D;  3B6F B;  1P34 B;  3B0C T;  5CPI C;  3LEL C;  5GT3 A;  3UTA B;  4J8W B;  5CPK D;  3AZK B;  5F99 D;  5BNV B;  1P3L A;  3AZN D;  3KSY A;  3X1U B;  4AWL B;  1S32 C;  1F66 D;  3VH6 W;  5AY8 C;  5B24 B;  1P3I B;  5B2J C;  3WTP C;  3B0D C;  5B40 A;  4WU9 B;  3UT9 D;  4YM6 B;  5B31 C;  3X1T A;  1KX4 D;  4M6B A;  3AZM A;  4YS3 C;  1F1E A;  2IO5 B;  2FJ7 C;  1AOI A;  5AV5 A;  4H9P B;  1M18 C;  2PYO A;  3W99 D;  5CPJ A;  2JSS A;  4ZUX C;  3KXB B;  1M19 C;  4Z2M H;  3MVD C;  5B2I B;  1P3P C;  4KUD A;  3LEL A;  2CWE A;  2CV5 B;  5CPK B;  3AV2 C;  3KWQ C;  5F99 B; 
#chains in the Genus database with same CATH topology
 3AZN B;  1P3L D;  3MGQ D;  2DQN C;  3C1C C;  5AV6 A;  4XZQ C;  4WU8 C;  3VH6 T;  2DF4 C;  3WKJ A;  5B2J A;  5C3I B;  3WTP A;  5BS7 C;  4KGC B;  3AV1 A;  3AZJ C;  1KX4 B;  4QLC B;  1P3K D;  3W97 A;  5B0Z D;  3EPK A;  5AV8 C;  5CP6 D;  3X1V D;  1EQZ D;  1ZLA C;  1P3F D;  5B0Y C;  3MGS C;  1A7W A;  3REJ C;  3UTA A;  3MVD A;  3A6N D;  2VQR A;  4CAY B;  4NE5 A;  3WTP E;  3LZ0 D;  3AFA C;  5BNV A;  3AZL C;  3WAA D;  3REI D;  3AV2 A;  3KWQ A;  1W2E A;  1F66 C;  3TU4 D;  4R8P D;  2NQB B;  3MGQ B;  3EPL A;  3B6G D;  3C1C A;  3LZ1 D;  3W98 A;  3UTB D;  4X23 B;  1R4V A;  3UT9 C;  3FDD A;  4YM6 A;  4JJN C;  3AZH C;  3AZI D;  2YFV B;  5GXQ C;  4E45 A;  5B33 D;  5DNM C;  4H9S A;  3AZJ A;  3X1S B;  1P3K B;  5GSU B;  4HGA C;  4H9N A;  3O62 B;  3KUY D;  4J8X D;  5BO0 B;  1EQZ B;  5B32 D;  1ID3 D;  5B2I A;  3REK B;  3C1B C;  5DNN D;  1P3A D;  5GT0 D;  2Y2P A;  3B6F D;  1P34 D;  5CPK A;  2HUE C;  1M1A B;  4J8W D;  5F99 A;  3AYW B;  3AZN A;  3REI B;  3AZK D;  1P3L C;  4EO5 B;  1H3O B;  1F66 A;  3AZE D;  2JCH A;  2Y2L A;  2J8P A;  3X1U D;  2Y2J A;  5B1L D;  4XUJ B;  3LZ1 B;  5B31 G;  4J8V D;  5B24 D;  1P3I D;  4DQY B;  3AZF D;  4KGC A;  3UT9 A;  3V9R B;  1KX4 A;  4WU9 D;  4WNN A;  3AZI B;  3X1T C;  3LJA B;  5B33 B;  5G49 A;  3MGP B;  3AZM C;  1HQ3 B;  3AZG B;  5CP6 C;  3X1V C;  1BH8 B;  2ARO B;  1BFM A;  4ZBJ C;  1P3F C;  2PYO C;  3W99 A;  3KUY B;  3NQU B;  5CPJ C;  3KFU G;  5CPI B;  4Z2M G;  5B32 B;  3A6N C;  3EG5 B;  3KXB D;  4CAY A;  1WWS A;  3LZ0 C;  4LD9 B;  3WAA C;  5DNN B;  1P3A B;  4KUD C;  5GT0 B;  3R45 B;  4UUZ B;  2CV5 D;  5AVB B;  3TU4 C;  1KX3 B;  5JRG B;  2BYM B;  3B6G C;  4UPK A;  3MGQ A;  3IP4 C;  1TZY D;  2RVQ C;  4H9O A;  5AV6 C;  3UTB C;  3AZE B;  3MGR D;  5B1L B;  3F6T A;  5AVC D;  2ZY5 A;  4J8V B;  3WKJ C;  3AZF B;  2LY8 A;  2FJ7 B;  4H9R A;  3VH5 A;  1P3B B;  1P3K A;  3AV1 C;  4KGC D;  3A1I A;  3MNN B;  5B0Z A;  3W97 C;  4QLC D;  5BT1 C;  1JFI A;  5CP6 A;  3X1V A;  2F8N B;  1EQZ A;  1P3F A;  5JA4 B;  1TAF A;  5E5A D;  1P34 C;  4Z5T D;  3A6N A;  3UTA C;  3LZ0 A;  3AZK C;  3WAA A;  3REI A;  3NQJ B;  4H9Q A;  3REL B;  3WA9 B;  4DRB A;  3TU4 A;  4R8P A;  3X1U C;  1P3O B;  4AWL C;  1B6W A;  3B6G A;  1TZY B;  1T3U A;  2HIO B;  3LZ1 A;  2NQB D;  5B24 C;  1P3I C;  2NZD D;  3MGR B;  3UTB A;  2ZY2 A;  3W98 C;  3P5J B;  4WU9 C;  3V9R A;  3AL0 C;  5AVC B;  2ZY3 A;  3H0R C;  4YM6 C;  4X23 D;  3AZI A;  5B33 A;  1U35 D;  3VH5 W;  1BH8 A;  2IO5 C;  4H9S C;  3X1S D;  3KUY A;  3NQU A;  4J8X A;  1P3G B;  5GSU D;  3B0B A;  3O62 D;  5B32 A;  2G5I C;  4WZS B;  4Z66 D;  3KXB C;  3REJ B;  1ID3 A;  2F8N K;  5DNN A;  5B2I C;  2ZM5 A;  5E5A B;  1P3A A;  5GT0 A;  3B6F A;  4Z5T B;  3REK D;  1P34 A;  5FUG B;  3R45 A;  3W96 D;  2CV5 C;  4UUZ A;  5CPK C;  4J8W A;  1N1J B;  3AZK A;  5F99 C;  1M1A D;  2BYM A;  3AYW D;  4G92 C;  3AZN C;  2FFF B;  2YFW B;  4J8U D;  2XD5 A;  3AZE A;  4G91 B;  3X1U A;  5B1L A;  4NE3 A;  2NZD B;  4J8V A;  1P3M B;  5B24 A;  1P3I A;  4XUJ D;  5GXQ B;  3AZF A;  5B1M B;  3AN2 B;  1HTA A;  4KGC C;  4WU9 A;  2L5A A;  1KX4 C;  4HGA B;  1KX5 D;  4NE6 A;  2BYK B;  1U35 B;  3LJA D;  3VH5 T;  3MGP D;  3REH D;  1HQ3 D;  3AZG D;  4CSR B;  2ARO D;  4H9P A;  3W99 C;  5AV9 B;  4Z66 B;  3KXB A;  5GT3 B;  5CPI D;  2HUE B;  2BG1 A;  4LD9 D;  3W96 B;  5BNX B;  2CV5 A;  5AVB D;  1KX3 D;  1TZY A;  5JRG D;  4J8U B;  1S32 D;  3MGQ C;  2Y2M A;  3MGR A;  5AY8 D;  4X23 C;  5B40 B;  5AVC A;  5B31 D;  4YS3 D;  2FJ7 D;  1P3K C;  3X1S C;  1P3B D;  1AOI B;  4QLC A;  1KX5 B;  5AV5 B;  2PYO B;  5B0Z C;  3MNN D;  5CPJ B;  3REH B;  3O62 C;  4ZUX D;  1EQZ C;  2F8N D;  2JE5 A;  1M19 D;  5E5A A;  3REK C;  4Z5T A;  1P3P D;  4KUD B;  3LEL B;  2UWX A;  1M1A C;  3AYW C;  3REI C;  4EO5 C;  3REL D;  2G5H C;  4R8P C;  3WA9 D;  4NFT A;  1S32 B;  1P3O D;  2NQB A;  2NZD A;  3LZ1 C;  4WU8 D;  2HIO D;  5AY8 B;  2W8S A;  5B2J B;  3WTP B;  3B0D B;  4X23 A;  1KU5 A;  3AZI C;  5B31 B;  2YFV A;  5B33 C;  1U35 A;  1HQ3 C;  3AZG C;  4YS3 B;  5AV8 D;  4CSR A;  3X1S A;  1BH9 B;  1M18 B;  5GSU A;  3KUY C;  4J8X C;  3O62 A;  1P3G D;  5KDM B;  4Z66 A;  5BO0 A;  2Y2Q A;  5B0Y D;  1ZLA D;  4ZUX B;  5B32 C;  3MGS D;  1ID3 C;  1M19 B;  3MVD B;  3REJ D;  4LD9 C;  2Y2G A;  5DNN C;  3REK A;  1P3A C;  3W96 A;  1P3P B;  5GT0 C;  3AFA D;  3B6F C;  3AZL D;  5BNX A;  4J8W C;  3AV2 B;  5AVB C;  3KWQ B;  3AYW A;  1M1A A;  1KX3 C;  5JRG C;  4J8U A;  3C1C B;  4XZQ B;  1H3O A;  1ULY A;  3AZE C;  1PZR A;  3W98 B;  5B1L C;  4XUJ A;  4WU8 B;  4E44 A;  4J8V C;  4JJN D;  3AZH D;  1P3M D;  1Q9C A;  3AZF C;  5GXQ D;  5B1M D;  3AN2 D;  1P3B C;  5DNM D;  3AZJ B;  1KX5 A;  2F8N H;  3MNN C;  3LJA A;  3MGP A;  3REH A;  2Y2K A;  1HQ3 A;  4H9N B;  3AZG A;  5AV8 B;  2ARO A;  1ZLA B;  5AV9 D;  5B0Y B;  3C1B D;  3MGS B;  5CPI A;  5GT3 D;  4LD9 A;  3AFA B;  4G92 B;  3AZL B;  3REL C;  3WA9 C;  5AVB A;  1KX3 A;  1P3O C;  5JRG A;  1F66 B;  1S32 A;  1TZY C;  2HIO C;  5AY8 A;  3MGR C;  3UT9 B;  4KHA B;  5AVC C;  5B40 D;  4JJN B;  5B31 A;  3AZH B;  4WNN B;  4WV4 B;  3X1T D;  5G49 B;  5C3I C;  4YS3 A;  2FJ7 A;  5DNM B;  3AZM D;  1P3B A;  5CHL B;  1BH9 A;  1M18 A;  4QLC C;  3MNN A;  3W99 B;  1AOI D;  1P3G C;  5AV5 D;  2PYO D;  5KDM A;  5CPJ D;  2RIQ A;  4ZUX A;  2F8N A;  1M19 A;  5JA4 A;  1P3P A;  5E5A C;  3C1B B;  4Z5T C;  2Y2I A;  4KUD D;  3LEL D;  3NQJ A;  1P3L B;  4XZQ A;  2RVQ D;  4H9O B;  3REL A;  3WA9 A;  4G91 C;  5AV6 D;  1P3O A;  2Y2N A;  2NQB C;  4WU8 A;  2HIO A;  2NZD C;  1P3M C;  5B1M C;  3AN2 C;  3WKJ D;  5BS7 A;  5B2J D;  3WTP D;  4H9R B;  4WJ3 C;  3AV1 D;  3X1T B;  5B0Z B;  1U35 C;  3W97 D;  5AV8 A;  3AZM B;  1JFI B;  5CP6 B;  5BT1 D;  3X1V B;  5B32 G;  3A1K A;  4ZBJ B;  1P3F B;  1ZLA A;  5AV9 C;  5GSU C;  1P3G A;  1M18 D;  1TAF B;  5B0Y A;  3MGS A;  4Z66 C;  3B0C W;  3REJ A;  5GT3 C;  3A6N B;  3LZ0 B;  3UTA D;  3MVD D;  3AFA A;  3WAA B;  3AZL A;  3W96 C;  5FUG A;  4H9Q B;  2XD1 A;  1N1J A;  3TU4 B;  4R8P B;  3AV2 D;  3EPH A;  1B67 A;  3KWQ D;  3B6G B;  4J8U C;  2YFW A;  3H0L C;  1WWI A;  3VH6 A;  5AV6 B;  3C1C D;  4XZQ D;  3UTB B;  5B40 C;  3W98 D;  4KHA A;  4JJN A;  3AZH A;  4XUJ C;  1P3M A;  4YM6 D;  5GXQ A;  5B1M A;  3AN2 A;  3WKJ B;  5DNM A;  2F8N G;  3AV1 B;  1AOI C;  1KX5 C;  4DRA A;  5AV5 C;  3AZJ D;  3LJA C;  3W97 B;  2BYK A;  4J8X B;  3MGP C;  3REH C;  1ID3 B;  2ARO C;  5AV9 A;  3H0M C;  3C1B A;  5B2I D;  3B6F B;  1P34 B;  3B0C T;  5CPI C;  3LEL C;  5GT3 A;  1Z2C B;  3UTA B;  4J8W B;  5CPK D;  3AZK B;  5F99 D;  5BNV B;  1P3L A;  3AZN D;  3KSY A;  3EPJ A;  3X1U B;  4AWL B;  1S32 C;  1F66 D;  3VH6 W;  5AY8 C;  5B24 B;  1P3I B;  2F2A C;  5B2J C;  3WTP C;  3B0D C;  5B40 A;  4WU9 B;  3UT9 D;  2ZY4 A;  4YM6 B;  2Y2O A;  5B31 C;  3X1T A;  1KX4 D;  2Y2H A;  4M6B A;  3AZM A;  4YS3 C;  1F1E A;  2IO5 B;  2FJ7 C;  1AOI A;  5AV5 A;  4H9P B;  1M18 C;  2PYO A;  3W99 D;  5CPJ A;  2JSS A;  4ZUX C;  3KXB B;  1M19 C;  4Z2M H;  3MVD C;  5B2I B;  1P3P C;  4KUD A;  3LEL A;  2CWE A;  2CV5 B;  5CPK B;  3AV2 C;  3KWQ C;  5F99 B; 
#chains in the Genus database with same CATH homology
 3AZN B;  1P3L D;  3MGQ D;  2DQN C;  3C1C C;  5AV6 A;  4XZQ C;  4WU8 C;  3VH6 T;  2DF4 C;  3WKJ A;  5B2J A;  5C3I B;  3WTP A;  5BS7 C;  4KGC B;  3AV1 A;  3AZJ C;  1KX4 B;  4QLC B;  1P3K D;  3W97 A;  5B0Z D;  3EPK A;  5AV8 C;  5CP6 D;  3X1V D;  1EQZ D;  1ZLA C;  1P3F D;  5B0Y C;  3MGS C;  1A7W A;  3REJ C;  3UTA A;  3MVD A;  3A6N D;  2VQR A;  4CAY B;  4NE5 A;  3WTP E;  3LZ0 D;  3AFA C;  5BNV A;  3AZL C;  3WAA D;  3REI D;  3AV2 A;  3KWQ A;  1W2E A;  1F66 C;  3TU4 D;  4R8P D;  2NQB B;  3MGQ B;  3EPL A;  3B6G D;  3C1C A;  3LZ1 D;  3W98 A;  3UTB D;  4X23 B;  1R4V A;  3UT9 C;  3FDD A;  4YM6 A;  4JJN C;  3AZH C;  3AZI D;  2YFV B;  5GXQ C;  4E45 A;  5B33 D;  5DNM C;  4H9S A;  3AZJ A;  3X1S B;  1P3K B;  5GSU B;  4HGA C;  4H9N A;  3O62 B;  3KUY D;  4J8X D;  5BO0 B;  1EQZ B;  5B32 D;  1ID3 D;  5B2I A;  3REK B;  3C1B C;  5DNN D;  1P3A D;  5GT0 D;  2Y2P A;  3B6F D;  1P34 D;  5CPK A;  2HUE C;  1M1A B;  4J8W D;  5F99 A;  3AYW B;  3AZN A;  3REI B;  3AZK D;  1P3L C;  4EO5 B;  1H3O B;  1F66 A;  3AZE D;  2JCH A;  2Y2L A;  2J8P A;  3X1U D;  2Y2J A;  5B1L D;  4XUJ B;  3LZ1 B;  5B31 G;  4J8V D;  5B24 D;  1P3I D;  4DQY B;  3AZF D;  4KGC A;  3UT9 A;  3V9R B;  1KX4 A;  4WU9 D;  4WNN A;  3AZI B;  3X1T C;  3LJA B;  5B33 B;  5G49 A;  3MGP B;  3AZM C;  1HQ3 B;  3AZG B;  5CP6 C;  3X1V C;  1BH8 B;  2ARO B;  1BFM A;  4ZBJ C;  1P3F C;  2PYO C;  3W99 A;  3KUY B;  3NQU B;  5CPJ C;  3KFU G;  5CPI B;  4Z2M G;  5B32 B;  3A6N C;  3EG5 B;  3KXB D;  4CAY A;  1WWS A;  3LZ0 C;  4LD9 B;  3WAA C;  5DNN B;  1P3A B;  4KUD C;  5GT0 B;  3R45 B;  4UUZ B;  2CV5 D;  5AVB B;  3TU4 C;  1KX3 B;  5JRG B;  2BYM B;  3B6G C;  4UPK A;  3MGQ A;  3IP4 C;  1TZY D;  2RVQ C;  4H9O A;  5AV6 C;  3UTB C;  3AZE B;  3MGR D;  5B1L B;  3F6T A;  5AVC D;  2ZY5 A;  4J8V B;  3WKJ C;  3AZF B;  2LY8 A;  2FJ7 B;  4H9R A;  3VH5 A;  1P3B B;  1P3K A;  3AV1 C;  4KGC D;  3A1I A;  3MNN B;  5B0Z A;  3W97 C;  4QLC D;  5BT1 C;  1JFI A;  5CP6 A;  3X1V A;  2F8N B;  1EQZ A;  1P3F A;  5JA4 B;  1TAF A;  5E5A D;  1P34 C;  4Z5T D;  3A6N A;  3UTA C;  3LZ0 A;  3AZK C;  3WAA A;  3REI A;  3NQJ B;  4H9Q A;  3REL B;  3WA9 B;  4DRB A;  3TU4 A;  4R8P A;  3X1U C;  1P3O B;  4AWL C;  1B6W A;  3B6G A;  1TZY B;  1T3U A;  2HIO B;  3LZ1 A;  2NQB D;  5B24 C;  1P3I C;  2NZD D;  3MGR B;  3UTB A;  2ZY2 A;  3W98 C;  3P5J B;  4WU9 C;  3V9R A;  3AL0 C;  5AVC B;  2ZY3 A;  3H0R C;  4YM6 C;  4X23 D;  3AZI A;  5B33 A;  1U35 D;  3VH5 W;  1BH8 A;  2IO5 C;  4H9S C;  3X1S D;  3KUY A;  3NQU A;  4J8X A;  1P3G B;  5GSU D;  3B0B A;  3O62 D;  5B32 A;  2G5I C;  4WZS B;  4Z66 D;  3KXB C;  3REJ B;  1ID3 A;  2F8N K;  5DNN A;  5B2I C;  2ZM5 A;  5E5A B;  1P3A A;  5GT0 A;  3B6F A;  4Z5T B;  3REK D;  1P34 A;  5FUG B;  3R45 A;  3W96 D;  2CV5 C;  4UUZ A;  5CPK C;  4J8W A;  1N1J B;  3AZK A;  5F99 C;  1M1A D;  2BYM A;  3AYW D;  4G92 C;  3AZN C;  2FFF B;  2YFW B;  4J8U D;  2XD5 A;  3AZE A;  4G91 B;  3X1U A;  5B1L A;  4NE3 A;  2NZD B;  4J8V A;  1P3M B;  5B24 A;  1P3I A;  4XUJ D;  5GXQ B;  3AZF A;  5B1M B;  3AN2 B;  1HTA A;  4KGC C;  4WU9 A;  2L5A A;  1KX4 C;  4HGA B;  1KX5 D;  4NE6 A;  2BYK B;  1U35 B;  3LJA D;  3VH5 T;  3MGP D;  3REH D;  1HQ3 D;  3AZG D;  4CSR B;  2ARO D;  4H9P A;  3W99 C;  5AV9 B;  4Z66 B;  3KXB A;  5GT3 B;  5CPI D;  2HUE B;  2BG1 A;  4LD9 D;  3W96 B;  5BNX B;  2CV5 A;  5AVB D;  1KX3 D;  1TZY A;  5JRG D;  4J8U B;  1S32 D;  3MGQ C;  2Y2M A;  3MGR A;  5AY8 D;  4X23 C;  5B40 B;  5AVC A;  5B31 D;  4YS3 D;  2FJ7 D;  1P3K C;  3X1S C;  1P3B D;  1AOI B;  4QLC A;  1KX5 B;  5AV5 B;  2PYO B;  5B0Z C;  3MNN D;  5CPJ B;  3REH B;  3O62 C;  4ZUX D;  1EQZ C;  2F8N D;  2JE5 A;  1M19 D;  5E5A A;  3REK C;  4Z5T A;  1P3P D;  4KUD B;  3LEL B;  2UWX A;  1M1A C;  3AYW C;  3REI C;  4EO5 C;  3REL D;  2G5H C;  4R8P C;  3WA9 D;  4NFT A;  1S32 B;  1P3O D;  2NQB A;  2NZD A;  3LZ1 C;  4WU8 D;  2HIO D;  5AY8 B;  2W8S A;  5B2J B;  3WTP B;  3B0D B;  4X23 A;  1KU5 A;  3AZI C;  5B31 B;  2YFV A;  5B33 C;  1U35 A;  1HQ3 C;  3AZG C;  4YS3 B;  5AV8 D;  4CSR A;  3X1S A;  1BH9 B;  1M18 B;  5GSU A;  3KUY C;  4J8X C;  3O62 A;  1P3G D;  5KDM B;  4Z66 A;  5BO0 A;  2Y2Q A;  5B0Y D;  1ZLA D;  4ZUX B;  5B32 C;  3MGS D;  1ID3 C;  1M19 B;  3MVD B;  3REJ D;  4LD9 C;  2Y2G A;  5DNN C;  3REK A;  1P3A C;  3W96 A;  1P3P B;  5GT0 C;  3AFA D;  3B6F C;  3AZL D;  5BNX A;  4J8W C;  3AV2 B;  5AVB C;  3KWQ B;  3AYW A;  1M1A A;  1KX3 C;  5JRG C;  4J8U A;  3C1C B;  4XZQ B;  1H3O A;  1ULY A;  3AZE C;  1PZR A;  3W98 B;  5B1L C;  4XUJ A;  4WU8 B;  4E44 A;  4J8V C;  4JJN D;  3AZH D;  1P3M D;  1Q9C A;  3AZF C;  5GXQ D;  5B1M D;  3AN2 D;  1P3B C;  5DNM D;  3AZJ B;  1KX5 A;  2F8N H;  3MNN C;  3LJA A;  3MGP A;  3REH A;  2Y2K A;  1HQ3 A;  4H9N B;  3AZG A;  5AV8 B;  2ARO A;  1ZLA B;  5AV9 D;  5B0Y B;  3C1B D;  3MGS B;  5CPI A;  5GT3 D;  4LD9 A;  3AFA B;  4G92 B;  3AZL B;  3REL C;  3WA9 C;  5AVB A;  1KX3 A;  1P3O C;  5JRG A;  1F66 B;  1S32 A;  1TZY C;  2HIO C;  5AY8 A;  3MGR C;  3UT9 B;  4KHA B;  5AVC C;  5B40 D;  4JJN B;  5B31 A;  3AZH B;  4WNN B;  4WV4 B;  3X1T D;  5G49 B;  5C3I C;  4YS3 A;  2FJ7 A;  5DNM B;  3AZM D;  1P3B A;  5CHL B;  1BH9 A;  1M18 A;  4QLC C;  3MNN A;  3W99 B;  1AOI D;  1P3G C;  5AV5 D;  2PYO D;  5KDM A;  5CPJ D;  2RIQ A;  4ZUX A;  2F8N A;  1M19 A;  5JA4 A;  1P3P A;  5E5A C;  3C1B B;  4Z5T C;  2Y2I A;  4KUD D;  3LEL D;  3NQJ A;  1P3L B;  4XZQ A;  2RVQ D;  4H9O B;  3REL A;  3WA9 A;  4G91 C;  5AV6 D;  1P3O A;  2Y2N A;  2NQB C;  4WU8 A;  2HIO A;  2NZD C;  1P3M C;  5B1M C;  3AN2 C;  3WKJ D;  5BS7 A;  5B2J D;  3WTP D;  4H9R B;  4WJ3 C;  3AV1 D;  3X1T B;  5B0Z B;  1U35 C;  3W97 D;  5AV8 A;  3AZM B;  1JFI B;  5CP6 B;  5BT1 D;  3X1V B;  5B32 G;  3A1K A;  4ZBJ B;  1P3F B;  1ZLA A;  5AV9 C;  5GSU C;  1P3G A;  1M18 D;  1TAF B;  5B0Y A;  3MGS A;  4Z66 C;  3B0C W;  3REJ A;  5GT3 C;  3A6N B;  3LZ0 B;  3UTA D;  3MVD D;  3AFA A;  3WAA B;  3AZL A;  3W96 C;  5FUG A;  4H9Q B;  2XD1 A;  1N1J A;  3TU4 B;  4R8P B;  3AV2 D;  3EPH A;  1B67 A;  3KWQ D;  3B6G B;  4J8U C;  2YFW A;  3H0L C;  1WWI A;  3VH6 A;  5AV6 B;  3C1C D;  4XZQ D;  3UTB B;  5B40 C;  3W98 D;  4KHA A;  4JJN A;  3AZH A;  4XUJ C;  1P3M A;  4YM6 D;  5GXQ A;  5B1M A;  3AN2 A;  3WKJ B;  5DNM A;  2F8N G;  3AV1 B;  1AOI C;  1KX5 C;  4DRA A;  5AV5 C;  3AZJ D;  3LJA C;  3W97 B;  2BYK A;  4J8X B;  3MGP C;  3REH C;  1ID3 B;  2ARO C;  5AV9 A;  3H0M C;  3C1B A;  5B2I D;  3B6F B;  1P34 B;  3B0C T;  5CPI C;  3LEL C;  5GT3 A;  1Z2C B;  3UTA B;  4J8W B;  5CPK D;  3AZK B;  5F99 D;  5BNV B;  1P3L A;  3AZN D;  3KSY A;  3EPJ A;  3X1U B;  4AWL B;  1S32 C;  1F66 D;  3VH6 W;  5AY8 C;  5B24 B;  1P3I B;  2F2A C;  5B2J C;  3WTP C;  3B0D C;  5B40 A;  4WU9 B;  3UT9 D;  2ZY4 A;  4YM6 B;  2Y2O A;  5B31 C;  3X1T A;  1KX4 D;  2Y2H A;  4M6B A;  3AZM A;  4YS3 C;  1F1E A;  2IO5 B;  2FJ7 C;  1AOI A;  5AV5 A;  4H9P B;  1M18 C;  2PYO A;  3W99 D;  5CPJ A;  2JSS A;  4ZUX C;  3KXB B;  1M19 C;  4Z2M H;  3MVD C;  5B2I B;  1P3P C;  4KUD A;  3LEL A;  2CWE A;  2CV5 B;  5CPK B;  3AV2 C;  3KWQ C;  5F99 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...