3VH5T

Crystal structure of the chicken cenp-t histone fold/cenp-w/cenp-s/cenp-x heterotetrameric complex, crystal form i
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
94
structure length
94
Chain Sequence
EPEIASSLIKQIFSHYVKTPVTRDAYKIVEKASERYFKQISSDLEAYSQHAGRKTVEMADVELLMRRQGLVTDKMPLHVLVERHLPLEYRKLLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords CENP-S
publication title CENP-T-W-S-X Forms a Unique Centromeric Chromatin Structure with a Histone-like Fold
pubmed doi rcsb
source organism Gallus gallus
total genus 31
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2011-08-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3vh5T00
1H3OB 3REIB 1BH8B 1EQZA 3KWQB 5CPJB 4KHAA 4J8XA 3LZ1D 5B2ID 4ZUXA 5AV6A 3REKC 5B1MA 4Z66D 2F8NK 3UT9D 4KGCC 5GXQA 4JJNB 1P3BD 1P3ID 5G49B 1ID3C 4YM6C 3UTAD 2F8NA 3A6NB 3AZHD 4Z5TC 1EQZB 4KHAB 4J8XB 5AV6B 4ZUXB 5B1MB 3RELC 2CV5D 5GXQB 1KX3C 1AOIC 3R45A 5CPKC 1P3AA 3UTBA 2AROC 5B1LD 3AYWC 2F8NB 1P3MC 3WA9D 3B0BA 3AZND 5CHLB 1P3OD 4ZBJB 4J8VC 4QLCA 5AV5C 3X1VA 3LJAC 3LELC 2BYKA 5B33D 3R45B 5GSUC 3MGSC 3B0DC 5BS7C 1P3AB 3LZ0C 3UTBB 5E5AC 3NQUA 3AN2A 5B24D 4AWLC 1S32A 4QLCB 1P3FC 1P34D 3X1VB 3AZMC 2BYKB 5B32G 4CSRA 5F99C 3REJD 5AVCD 3B6GD 4KUDD 4WNNA 3WKJD 4H9SA 5DNNA 1TZYD 3NQUB 3AN2B 3X1SC 5B2JA 3W96A 4Z2MH 1S32B 3B6FC 3W97D 4NE6A 3V9RA 4UUZA 3REID 4CSRB 3KWQD 5CPJD 1M1AA 1M19D 3VH6A 4WNNB 5DNNB 4E45A 4JJND 5B2JB 4WZSB 3W96B 3W99D 2NQBA 2HIOA 3V9RB 1F66A 1P3LA 3A6ND 4UUZB 1EQZD 1R4VA 3WAAD 5KDMA 4J8XD 1M1AB 4YS3D 4ZUXD 5B31G 5B1LA 3WTPC 3AZNA 5AV8C 4WU9D 5B1MC 4J8UA 2NQBB 1WWIA 2HIOB 2LY8A 5GXQC 3AV2C 3AZLC 1F66B 5CPIC 1P3LB 2F8ND 3REHC 3C1BC 5JRGA 5B33A 3KXBD 5KDMB 5GT3C 2PYOA 4X23C 5CP6C 5B1LB 4ZBJC 3AZNB 5B24A 1P3AD 4J8UB 3UTBD 2HUEC 3AZEA 4G92C 1P3PA 5JRGB 5B33B 1JFIA 2PYOB 4QLCD 3REJA 3X1VD 3B6GA 5B40C 3C1CC 5B24B 5AY8A 3X1UA 3AZEB 1P3PB 3W97A 3B0CW 3AN2D 1P3KA 3MNNA 3AZGC 4EO5B 2YFWA 1JFIB 3REJB 3AZIC 1M19A 3B6GB 5C3IC 2F8NH 3MGRA 3AV1C 1KU5A 3X1UB 5AY8B 3AZJC 3W98C 3W99A 4WU8A 3W97B 5DNND 4G91C 3KUYA 1P3KB 3MNNB 2NZDC 5DNMC 5B2JD 2YFWB 3TU4A 3W96D 3WAAA 4XUJC 3MGQC 1M19B 4YS3A 3MGRB 5JA4A 3KSYA 3LZ1C 1M1AD 4HGAB 5B2IC 3MGPA 4WU9A 3W99B 4E44A 4WU8B 4Z66C 3O62D 3UT9C 1KX5C 3KUYB 1P3IC 1P3BC 5AV9A 3TU4B 3WAAB 3UTAC 3KXBA 2NQBD 2HIOD 3AZHC 1F66D 1P3LD 4LD9A 4YS3B 3AFAB 3VH6T 5JA4B 2RVQD 3MGPB 3X1TA 4WU9B 3VH5A 1BH9A 2CV5C 1U35A 5AV9B 3KXBB 4J8UD 5B1LC 3WA9C 5BNVA 1ZLAA 4LD9B 1P3OC 5JRGD 1B67A 4R8PC 3MVDD 2PYOD 3X1TB 1BH9B 1U35B 5B32A 5BNXA 1P3GA 3AZKA 1ULYA 3AZED 1P3PD 4NFTA 5BNVB 4J8WA 1ZLAB 1HQ3C 1P34C 2IO5C 5B0YA 5B0ZA 3AZFA 5B32B 5BNXB 4XZQA 1P3GB 3X1UD 5AY8D 5AVBA 3REJC 2FJ7A 5AVCC 3AZKB 4KUDC 4H9PA 3WKJC 1TZYC 4J8WB 1P3KD 3MNND 3W97C 4NE5A 5B0YB 5B0ZB 3WTPE 1TAFA 5GT0A 3REIC 3O62A 3AZFB 3MGRD 3KWQC 5CPJC 4XZQB 5AVBB 2FJ7B 1M19C 4H9PB 4WU8D 5B31A 4JJNC 3KUYD 3W99C 3TU4D 3NQJA 3REKA 3A6NC 4KGCA 1TAFB 5GT0B 3AFAD 3O62B 1EQZC 1ID3A 4YM6A 4J8XC 3MGPD 5AV6C 4ZUXC 4YS3C 4H9RA 3VH6W 5B31B 4Z5TA 5AV9D 4WU9C 3NQJB 3REKB 3MVDA 3RELA 4KGCB 1AOIA 4LD9D 1KX3A 4DRAA 1ID3B 4YM6B 5CPKA 2AROA 3X1TD 3AYWA 4H9RB 1U35D 4Z5TB 4J8VA 1P3AC 3UTBC 5AV5A 3MVDB 3LJAA 3REHD 1KX4D 3LELA 3RELB 1AOIB 1ZLAD 1KX3B 4Z2MG 5GSUA 5GT3D 3VH5T 5BS7A 3MGSA 5CPKB 3LZ0A 4QLCC 2AROB 2BYMA 3X1VC 5E5AA 3AYWB 5B32D 1P3GD 4J8VB 3AZKD 1P3FA 5AV5B 3LJAB 3AZMA 3LELB 4J8WD 3AN2C 5F99A 5GSUB 3MGSB 3B0DB 1S32C 3LZ0B 1N1JA 2BYMB 5E5AB 5B0YD 5B0ZD 1M18D 3X1SA 3AZFD 4XZQD 4AWLB 5AVBD 2FJ7D 3B6FA 1P3FB 2YFVA 4H9SC 5DNNC 3AZMB 5B2JC 5F99B 3AFAA 3W96C 2L5AA 1N1JB 3X1SB 5GT0D 1M1AC 3B6FB 5BT1D 2YFVB 3O62C 5B31D 4XUJD 3MGQD 2NQBC 2HIOC 3REKD 1F66C 1P3LC 4KGCD 3WTPA 5AV8A 1ID3D 4CAYA 4YM6D 2RVQC 4H9QA 1KX5D 3AV2A 3AZLA 5CPIA 4NE3A 1WWSA 3REHA 1KX4A 4Z5TD 3AZNC 3C1BA 5GT3A 4J8UC 4X23A 5CP6A 1A7WA 3RELD 1AOID 3WTPB 1KX3D 4H9NA 5AV8B 5JRGC 5B33C 4CAYB 3MVDC 4H9QB 5CPKD 2PYOC 2AROD 2F8NG 3AV2B 2JSSA 3AZLB 3AYWD 5CPIB 1P3MD 3VH5W 3REHB 1KX4B 5B24C 3C1BB 4DRBA 5GT3B 4J8VD 3AZEC 1P3PC 4X23B 5AV5D 5CP6B 3LJAD 5B40A 3LELD 3C1CA 1M18A 4H9NB 4EO5C 5GSUD 4R8PD 3MGSD 3LZ0D 2HUEB 4G92B 5E5AD 3B6GC 1F1EA 3AZGA 4H9OA 3X1UC 5AY8C 4M6BA 3AZIA 1P3FD 3AZMD 5B40B 1P3KC 3MNNC 3AV1A 3C1CB 1M18B 1HQ3D 5F99D 3AZJA 3W98A 3B0CT 3X1SD 3MGRC 2NZDA 3AZGB 4H9OB 5DNMA 4HGAC 4XUJA 3MGQA 3B6FD 3AZIB 4WU8C 5C3IB 3KUYC 3AV1B 3TU4C 3LZ1A 3WAAC 3AZJB 5B2IA 3W98B 1KX5A 4Z66A 3UT9A 4G91B 3AFAC 1P3IA 1P3BA 2NZDB 5DNMB 1BFMA 3UTAA 4XUJB 3MGPC 3MGQB 3AZHA 5AV9C 3LZ1B 3KXBC 4WV4B 5B2IB 1KX5B 4Z66B 3UT9B 2CV5A 4LD9C 1P3MA 3WTPD 1P3IB 1P3BB 5AV8D 5AV6D 3UTAB 5B1MD 3X1TC 5BO0A 5GXQD 3AV2D 3AZHB 3AZLD 3WA9A 5CPID 1U35C 1P3OA 3C1BD 4R8PA 4X23D 1KX4C 5CP6D 2CV5B 1ZLAC 1P3MB 1Q9CA 5BO0B 3WA9B 5B32C 1P3OB 1P3GC 1HQ3A 4R8PB 3AZKC 1P34A 1HTAA 4J8WC 5B40D 3C1CD 5AVCA 4KUDA 5FUGA 5B0YC 5B0ZC 3WKJA 1M18C 1TZYA 3AZFC 3AZGD 4XZQC 5AVBC 1HQ3B 2FJ7C 1P34B 2IO5B 3AZID 1H3OA 3REIA 1B6WA 1BH8A 3AV1D 3KWQA 5CPJA 1S32D 3AZJD 5AVCB 4KUDB 3W98D 5FUGB 3WKJB 1TZYB 5GT0C 4JJNA 2NZDD 5G49A 5DNMD 5BT1C 2CWEA 3A6NA 5B31C
chains in the Genus database with same CATH superfamily
1H3OB 3REIB 3EPHA 1BH8B 1EQZA 3KWQB 5CPJB 4KHAA 4J8XA 3LZ1D 2DQNC 5B2ID 4ZUXA 5AV6A 3REKC 5B1MA 4Z66D 2F8NK 3UT9D 4KGCC 5GXQA 4JJNB 1P3BD 1P3ID 5G49B 1ID3C 4YM6C 3UTAD 2F8NA 3A6NB 3AZHD 4Z5TC 1EQZB 4KHAB 4J8XB 5AV6B 4ZUXB 5B1MB 3RELC 2CV5D 5GXQB 1KX3C 1AOIC 3R45A 5CPKC 1P3AA 3UTBA 2AROC 5B1LD 3AYWC 2F8NB 1P3MC 3WA9D 3B0BA 3AZND 5CHLB 1P3OD 4ZBJB 4J8VC 4QLCA 5AV5C 3X1VA 3LJAC 3LELC 2BYKA 3A6NA 5B33D 3R45B 5GSUC 3MGSC 3B0DC 5BS7C 1P3AB 3LZ0C 3UTBB 5E5AC 3NQUA 3AN2A 5B24D 4AWLC 1S32A 4QLCB 1P3FC 1P34D 3X1VB 3AZMC 2BYKB 5B32G 4CSRA 5F99C 3REJD 5AVCD 3B6GD 4KUDD 4WNNA 3WKJD 4H9SA 5DNNA 1TZYD 3NQUB 4UPKA 3AN2B 3X1SC 5B2JA 3W96A 4Z2MH 1S32B 3B6FC 3W97D 4NE6A 3V9RA 4UUZA 3REID 4CSRB 3KWQD 5CPJD 1M1AA 1M19D 3VH6A 4WNNB 5DNNB 4E45A 4JJND 5B2JB 4WZSB 3W96B 3W99D 2NQBA 2HIOA 3V9RB 1F66A 1P3LA 3A6ND 4UUZB 1EQZD 1R4VA 3WAAD 5KDMA 4J8XD 1M1AB 4YS3D 4ZUXD 3IP4C 5B31G 5B1LA 3WTPC 3AZNA 5AV8C 4WU9D 5B1MC 4J8UA 2NQBB 1WWIA 2HIOB 2LY8A 5GXQC 2Y2OA 3AZLC 3AV2C 5CPIC 1P3LB 1F66B 2F8ND 3REHC 3C1BC 5JRGA 5B33A 3KXBD 5KDMB 5GT3C 2PYOA 4X23C 5CP6C 5B1LB 4ZBJC 3AZNB 5B24A 2BG1A 1P3AD 4J8UB 3EG5B 2HUEC 3UTBD 4G92C 3AZEA 1P3PA 2JCHA 5JRGB 4WJ3C 5B33B 1JFIA 3AL0C 2PYOB 4QLCD 3REJA 3X1VD 2G5HC 3B6GA 5B40C 2J8PA 3C1CC 5B24B 5AY8A 3X1UA 3AZEB 1P3PB 3W97A 3B0CW 3AN2D 1P3KA 3MNNA 3AZGC 4EO5B 2YFWA 1JFIB 3REJB 3AZIC 1M19A 3B6GB 5C3IC 2Y2PA 2F8NH 3MGRA 3AV1C 1KU5A 3EPJA 3X1UB 5AY8B 3AZJC 3W98C 3W99A 4WU8A 3W97B 5DNND 4G91C 3KUYA 1P3KB 3MNNB 2NZDC 5DNMC 5B2JD 2YFWB 3TU4A 3W96D 3WAAA 4XUJC 3MGQC 2FFFB 2Y2NA 1M19B 4YS3A 2Y2HA 3MGRB 5JA4A 3KSYA 3LZ1C 1M1AD 4HGAB 5B2IC 3MGPA 4WU9A 3W99B 4E44A 4WU8B 4Z66C 3O62D 3FDDA 3UT9C 1KX5C 2Y2MA 3KUYB 2Y2GA 1P3IC 1P3BC 5AV9A 3TU4B 3WAAB 3UTAC 3KXBA 2NQBD 2HIOD 2XD5A 3AZHC 1F66D 1P3LD 4LD9A 4YS3B 3AFAB 3VH6T 5JA4B 2RVQD 3MGPB 3X1TA 4WU9B 3VH5A 1BH9A 2CV5C 1U35A 5AV9B 3KXBB 4J8UD 5B1LC 3WA9C 1Z2CB 5BNVA 1ZLAA 4LD9B 1P3OC 5JRGD 1B67A 4R8PC 3MVDD 2PYOD 3X1TB 1BH9B 2G5IC 1U35B 5B32A 5BNXA 1P3GA 3AZKA 1ULYA 3AZED 1P3PD 4NFTA 5BNVB 4J8WA 1ZLAB 2W8SA 3H0MC 3H0LC 1HQ3C 2UWXA 1P34C 2IO5C 5B0YA 5B0ZA 3AZFA 5B32B 2ZY5A 5BNXB 4XZQA 1P3GB 3X1UD 5AY8D 5AVBA 3REJC 2FJ7A 5AVCC 3AZKB 4KUDC 3KFUG 4H9PA 3WKJC 1TZYC 4J8WB 1P3KD 3MNND 3W97C 4NE5A 5B0YB 5B0ZB 3WTPE 1TAFA 5GT0A 3EPKA 3O62A 3REIC 3AZFB 3MGRD 3KWQC 5CPJC 4XZQB 5AVBB 2FJ7B 1M19C 4H9PB 4WU8D 5B31A 4JJNC 3KUYD 2Y2IA 3W99C 3TU4D 3NQJA 3REKA 3A6NC 4KGCA 1TAFB 5GT0B 3AFAD 3O62B 1EQZC 2ZY4A 1ID3A 4YM6A 4J8XC 3MGPD 5AV6C 4ZUXC 4YS3C 4H9RA 3VH6W 5B31B 4Z5TA 5AV9D 4WU9C 3NQJB 3REKB 3MVDA 3RELA 4KGCB 1AOIA 4LD9D 1KX3A 4DRAA 1ID3B 4YM6B 5CPKA 2AROA 3X1TD 3AYWA 4H9RB 2Y2KA 1U35D 4Z5TB 2ZY3A 4J8VA 1P3AC 3UTBC 5AV5A 3MVDB 3LJAA 3REHD 1KX4D 3H0RC 3LELA 3RELB 1AOIB 3A1KA 1KX3B 4Z2MG 1ZLAD 5GSUA 5GT3D 3VH5T 5BS7A 3MGSA 5CPKB 3LZ0A 4QLCC 2AROB 2BYMA 2F2AC 5E5AA 3X1VC 3AYWB 2Y2QA 5B32D 1P3GD 4J8VB 3AZKD 1P3FA 5AV5B 2XD1A 3LJAB 3AZMA 3LELB 4J8WD 3AN2C 5F99A 5GSUB 3MGSB 3B0DB 1S32C 3LZ0B 1N1JA 2BYMB 5E5AB 5B0YD 5B0ZD 1M18D 3X1SA 3AZFD 3A1IA 4XZQD 4AWLB 5AVBD 2FJ7D 3B6FA 1P3FB 2YFVA 4H9SC 5DNNC 3AZMB 5B2JC 5F99B 3AFAA 3W96C 2L5AA 1N1JB 3X1SB 5GT0D 1M1AC 3B6FB 5BT1D 2YFVB 3O62C 5B31D 4XUJD 3MGQD 2NQBC 2HIOC 3REKD 1F66C 1P3LC 4KGCD 3WTPA 5AV8A 1ID3D 4CAYA 4YM6D 2DF4C 2RVQC 4H9QA 1KX5D 3AV2A 3AZLA 5CPIA 4NE3A 1WWSA 3REHA 1KX4A 3P5JB 4Z5TD 3AZNC 3C1BA 5GT3A 4J8UC 4X23A 5CP6A 1A7WA 1T3UA 3RELD 2Y2JA 1AOID 3WTPB 1KX3D 4H9NA 5AV8B 5JRGC 5B33C 2Y2LA 4CAYB 3MVDC 4H9QB 5CPKD 2PYOC 2AROD 3EPLA 3AV2B 2F8NG 2JSSA 3AZLB 3AYWD 5CPIB 1P3MD 3VH5W 3REHB 1KX4B 5B24C 3C1BB 4DRBA 5GT3B 4J8VD 3AZEC 1P3PC 4X23B 5AV5D 5CP6B 3LJAD 5B40A 3LELD 3C1CA 1M18A 4H9NB 4EO5C 5GSUD 4R8PD 3MGSD 3LZ0D 2HUEB 4G92B 5E5AD 3B6GC 1F1EA 3AZGA 1W2EA 4H9OA 3X1UC 5AY8C 4M6BA 3AZIA 1P3FD 2ZM5A 3AZMD 5B40B 1P3KC 3MNNC 3AV1A 3C1CB 1M18B 1HQ3D 5F99D 3AZJA 3W98A 3B0CT 3X1SD 3MGRC 2NZDA 3AZGB 4H9OB 5DNMA 4HGAC 4XUJA 3MGQA 3B6FD 3AZIB 4WU8C 5C3IB 4DQYB 3KUYC 3AV1B 3TU4C 3LZ1A 3WAAC 3AZJB 5B2IA 3W98B 1KX5A 4Z66A 3UT9A 4G91B 3AFAC 1P3IA 1P3BA 2NZDB 5DNMB 1BFMA 3UTAA 4XUJB 3MGPC 3MGQB 3AZHA 5AV9C 3LZ1B 3KXBC 4WV4B 5B2IB 1KX5B 4Z66B 3UT9B 2CV5A 4LD9C 2ZY2A 1P3MA 3WTPD 1P3IB 1P3BB 5AV8D 5AV6D 3UTAB 5B1MD 3X1TC 5BO0A 5GXQD 3AV2D 3AZHB 3AZLD 3WA9A 5CPID 1U35C 1P3OA 3C1BD 4R8PA 4X23D 1KX4C 5CP6D 2CV5B 1ZLAC 3F6TA 1P3MB 1Q9CA 5BO0B 3WA9B 5B32C 1P3OB 1P3GC 1HQ3A 4R8PB 3AZKC 1P34A 1HTAA 4J8WC 5B40D 3C1CD 5AVCA 4KUDA 5FUGA 5B0YC 5B0ZC 3WKJA 1M18C 1TZYA 3AZFC 3AZGD 4XZQC 5AVBC 1HQ3B 2JE5A 2FJ7C 1P34B 2IO5B 3AZID 1H3OA 3REIA 1B6WA 1BH8A 3AV1D 3KWQA 1PZRA 5CPJA 1S32D 3AZJD 5AVCB 4KUDB 3W98D 5FUGB 3WKJB 1TZYB 5GT0C 4JJNA 2NZDD 5G49A 5DNMD 2RIQA 5BT1C 2CWEA 2VQRA 5B31C
chains in the Genus database with same CATH topology
1H3OB 3REIB 3EPHA 1BH8B 1EQZA 3KWQB 5CPJB 4KHAA 4J8XA 3LZ1D 2DQNC 5B2ID 4ZUXA 5AV6A 3REKC 5B1MA 4Z66D 2F8NK 3UT9D 4KGCC 5GXQA 4JJNB 1P3BD 1P3ID 5G49B 1ID3C 4YM6C 3UTAD 2F8NA 3A6NB 3AZHD 4Z5TC 1EQZB 4KHAB 4J8XB 5AV6B 4ZUXB 5B1MB 3RELC 2CV5D 5GXQB 1KX3C 1AOIC 3R45A 5CPKC 1P3AA 3UTBA 2AROC 5B1LD 3AYWC 2F8NB 1P3MC 3WA9D 3B0BA 3AZND 5CHLB 1P3OD 4ZBJB 4J8VC 4QLCA 5AV5C 3X1VA 3LJAC 3LELC 2BYKA 3A6NA 5B33D 3R45B 5GSUC 3MGSC 3B0DC 5BS7C 1P3AB 3LZ0C 3UTBB 5E5AC 3NQUA 3AN2A 5B24D 4AWLC 1S32A 4QLCB 1P3FC 1P34D 3X1VB 3AZMC 2BYKB 5B32G 4CSRA 5F99C 3REJD 5AVCD 3B6GD 4KUDD 4WNNA 3WKJD 4H9SA 5DNNA 1TZYD 3NQUB 4UPKA 3AN2B 3X1SC 5B2JA 3W96A 4Z2MH 1S32B 3B6FC 3W97D 4NE6A 3V9RA 4UUZA 3REID 4CSRB 3KWQD 5CPJD 1M1AA 1M19D 3VH6A 4WNNB 5DNNB 4E45A 4JJND 5B2JB 4WZSB 3W96B 3W99D 2NQBA 2HIOA 3V9RB 1F66A 1P3LA 3A6ND 4UUZB 1EQZD 1R4VA 3WAAD 5KDMA 4J8XD 1M1AB 4YS3D 4ZUXD 3IP4C 5B31G 5B1LA 3WTPC 3AZNA 5AV8C 4WU9D 5B1MC 4J8UA 2NQBB 1WWIA 2HIOB 2LY8A 5GXQC 2Y2OA 3AZLC 3AV2C 5CPIC 1P3LB 1F66B 2F8ND 3REHC 3C1BC 5JRGA 5B33A 3KXBD 5KDMB 5GT3C 2PYOA 4X23C 5CP6C 5B1LB 4ZBJC 3AZNB 5B24A 2BG1A 1P3AD 4J8UB 3EG5B 2HUEC 3UTBD 4G92C 3AZEA 1P3PA 2JCHA 5JRGB 4WJ3C 5B33B 1JFIA 3AL0C 2PYOB 4QLCD 3REJA 3X1VD 2G5HC 3B6GA 5B40C 2J8PA 3C1CC 5B24B 5AY8A 3X1UA 3AZEB 1P3PB 3W97A 3B0CW 3AN2D 1P3KA 3MNNA 3AZGC 4EO5B 2YFWA 1JFIB 3REJB 3AZIC 1M19A 3B6GB 5C3IC 2Y2PA 2F8NH 3MGRA 3AV1C 1KU5A 3EPJA 3X1UB 5AY8B 3AZJC 3W98C 3W99A 4WU8A 3W97B 5DNND 4G91C 3KUYA 1P3KB 3MNNB 2NZDC 5DNMC 5B2JD 2YFWB 3TU4A 3W96D 3WAAA 4XUJC 3MGQC 2FFFB 2Y2NA 1M19B 4YS3A 2Y2HA 3MGRB 5JA4A 3KSYA 3LZ1C 1M1AD 4HGAB 5B2IC 3MGPA 4WU9A 3W99B 4E44A 4WU8B 4Z66C 3O62D 3FDDA 3UT9C 1KX5C 2Y2MA 3KUYB 2Y2GA 1P3IC 1P3BC 5AV9A 3TU4B 3WAAB 3UTAC 3KXBA 2NQBD 2HIOD 2XD5A 3AZHC 1F66D 1P3LD 4LD9A 4YS3B 3AFAB 3VH6T 5JA4B 2RVQD 3MGPB 3X1TA 4WU9B 3VH5A 1BH9A 2CV5C 1U35A 5AV9B 3KXBB 4J8UD 5B1LC 3WA9C 1Z2CB 5BNVA 1ZLAA 4LD9B 1P3OC 5JRGD 1B67A 4R8PC 3MVDD 2PYOD 3X1TB 1BH9B 2G5IC 1U35B 5B32A 5BNXA 1P3GA 3AZKA 1ULYA 3AZED 1P3PD 4NFTA 5BNVB 4J8WA 1ZLAB 2W8SA 3H0MC 3H0LC 1HQ3C 2UWXA 1P34C 2IO5C 5B0YA 5B0ZA 3AZFA 5B32B 2ZY5A 5BNXB 4XZQA 1P3GB 3X1UD 5AY8D 5AVBA 3REJC 2FJ7A 5AVCC 3AZKB 4KUDC 3KFUG 4H9PA 3WKJC 1TZYC 4J8WB 1P3KD 3MNND 3W97C 4NE5A 5B0YB 5B0ZB 3WTPE 1TAFA 5GT0A 3EPKA 3O62A 3REIC 3AZFB 3MGRD 3KWQC 5CPJC 4XZQB 5AVBB 2FJ7B 1M19C 4H9PB 4WU8D 5B31A 4JJNC 3KUYD 2Y2IA 3W99C 3TU4D 3NQJA 3REKA 3A6NC 4KGCA 1TAFB 5GT0B 3AFAD 3O62B 1EQZC 2ZY4A 1ID3A 4YM6A 4J8XC 3MGPD 5AV6C 4ZUXC 4YS3C 4H9RA 3VH6W 5B31B 4Z5TA 5AV9D 4WU9C 3NQJB 3REKB 3MVDA 3RELA 4KGCB 1AOIA 4LD9D 1KX3A 4DRAA 1ID3B 4YM6B 5CPKA 2AROA 3X1TD 3AYWA 4H9RB 2Y2KA 1U35D 4Z5TB 2ZY3A 4J8VA 1P3AC 3UTBC 5AV5A 3MVDB 3LJAA 3REHD 1KX4D 3H0RC 3LELA 3RELB 1AOIB 3A1KA 1KX3B 4Z2MG 1ZLAD 5GSUA 5GT3D 3VH5T 5BS7A 3MGSA 5CPKB 3LZ0A 4QLCC 2AROB 2BYMA 2F2AC 5E5AA 3X1VC 3AYWB 2Y2QA 5B32D 1P3GD 4J8VB 3AZKD 1P3FA 5AV5B 2XD1A 3LJAB 3AZMA 3LELB 4J8WD 3AN2C 5F99A 5GSUB 3MGSB 3B0DB 1S32C 3LZ0B 1N1JA 2BYMB 5E5AB 5B0YD 5B0ZD 1M18D 3X1SA 3AZFD 3A1IA 4XZQD 4AWLB 5AVBD 2FJ7D 3B6FA 1P3FB 2YFVA 4H9SC 5DNNC 3AZMB 5B2JC 5F99B 3AFAA 3W96C 2L5AA 1N1JB 3X1SB 5GT0D 1M1AC 3B6FB 5BT1D 2YFVB 3O62C 5B31D 4XUJD 3MGQD 2NQBC 2HIOC 3REKD 1F66C 1P3LC 4KGCD 3WTPA 5AV8A 1ID3D 4CAYA 4YM6D 2DF4C 2RVQC 4H9QA 1KX5D 3AV2A 3AZLA 5CPIA 4NE3A 1WWSA 3REHA 1KX4A 3P5JB 4Z5TD 3AZNC 3C1BA 5GT3A 4J8UC 4X23A 5CP6A 1A7WA 1T3UA 3RELD 2Y2JA 1AOID 3WTPB 1KX3D 4H9NA 5AV8B 5JRGC 5B33C 2Y2LA 4CAYB 3MVDC 4H9QB 5CPKD 2PYOC 2AROD 3EPLA 3AV2B 2F8NG 2JSSA 3AZLB 3AYWD 5CPIB 1P3MD 3VH5W 3REHB 1KX4B 5B24C 3C1BB 4DRBA 5GT3B 4J8VD 3AZEC 1P3PC 4X23B 5AV5D 5CP6B 3LJAD 5B40A 3LELD 3C1CA 1M18A 4H9NB 4EO5C 5GSUD 4R8PD 3MGSD 3LZ0D 2HUEB 4G92B 5E5AD 3B6GC 1F1EA 3AZGA 1W2EA 4H9OA 3X1UC 5AY8C 4M6BA 3AZIA 1P3FD 2ZM5A 3AZMD 5B40B 1P3KC 3MNNC 3AV1A 3C1CB 1M18B 1HQ3D 5F99D 3AZJA 3W98A 3B0CT 3X1SD 3MGRC 2NZDA 3AZGB 4H9OB 5DNMA 4HGAC 4XUJA 3MGQA 3B6FD 3AZIB 4WU8C 5C3IB 4DQYB 3KUYC 3AV1B 3TU4C 3LZ1A 3WAAC 3AZJB 5B2IA 3W98B 1KX5A 4Z66A 3UT9A 4G91B 3AFAC 1P3IA 1P3BA 2NZDB 5DNMB 1BFMA 3UTAA 4XUJB 3MGPC 3MGQB 3AZHA 5AV9C 3LZ1B 3KXBC 4WV4B 5B2IB 1KX5B 4Z66B 3UT9B 2CV5A 4LD9C 2ZY2A 1P3MA 3WTPD 1P3IB 1P3BB 5AV8D 5AV6D 3UTAB 5B1MD 3X1TC 5BO0A 5GXQD 3AV2D 3AZHB 3AZLD 3WA9A 5CPID 1U35C 1P3OA 3C1BD 4R8PA 4X23D 1KX4C 5CP6D 2CV5B 1ZLAC 3F6TA 1P3MB 1Q9CA 5BO0B 3WA9B 5B32C 1P3OB 1P3GC 1HQ3A 4R8PB 3AZKC 1P34A 1HTAA 4J8WC 5B40D 3C1CD 5AVCA 4KUDA 5FUGA 5B0YC 5B0ZC 3WKJA 1M18C 1TZYA 3AZFC 3AZGD 4XZQC 5AVBC 1HQ3B 2JE5A 2FJ7C 1P34B 2IO5B 3AZID 1H3OA 3REIA 1B6WA 1BH8A 3AV1D 3KWQA 1PZRA 5CPJA 1S32D 3AZJD 5AVCB 4KUDB 3W98D 5FUGB 3WKJB 1TZYB 5GT0C 4JJNA 2NZDD 5G49A 5DNMD 2RIQA 5BT1C 2CWEA 2VQRA 5B31C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H3O B;  3REI B;  1BH8 B;  1EQZ A;  3KWQ B;  5CPJ B;  4KHA A;  4J8X A;  3LZ1 D;  5B2I D;  4ZUX A;  5AV6 A;  3REK C;  5B1M A;  4Z66 D;  2F8N K;  3UT9 D;  4KGC C;  5GXQ A;  4JJN B;  1P3B D;  1P3I D;  5G49 B;  1ID3 C;  4YM6 C;  3UTA D;  2F8N A;  3A6N B;  3AZH D;  4Z5T C;  1EQZ B;  4KHA B;  4J8X B;  5AV6 B;  4ZUX B;  5B1M B;  3REL C;  2CV5 D;  5GXQ B;  1KX3 C;  1AOI C;  3R45 A;  5CPK C;  1P3A A;  3UTB A;  2ARO C;  5B1L D;  3AYW C;  2F8N B;  1P3M C;  3WA9 D;  3B0B A;  3AZN D;  5CHL B;  1P3O D;  4ZBJ B;  4J8V C;  4QLC A;  5AV5 C;  3X1V A;  3LJA C;  3LEL C;  2BYK A;  5B33 D;  3R45 B;  5GSU C;  3MGS C;  3B0D C;  5BS7 C;  1P3A B;  3LZ0 C;  3UTB B;  5E5A C;  3NQU A;  3AN2 A;  5B24 D;  4AWL C;  1S32 A;  4QLC B;  1P3F C;  1P34 D;  3X1V B;  3AZM C;  2BYK B;  5B32 G;  4CSR A;  5F99 C;  3REJ D;  5AVC D;  3B6G D;  4KUD D;  4WNN A;  3WKJ D;  4H9S A;  5DNN A;  1TZY D;  3NQU B;  3AN2 B;  3X1S C;  5B2J A;  3W96 A;  4Z2M H;  1S32 B;  3B6F C;  3W97 D;  4NE6 A;  3V9R A;  4UUZ A;  3REI D;  4CSR B;  3KWQ D;  5CPJ D;  1M1A A;  1M19 D;  3VH6 A;  4WNN B;  5DNN B;  4E45 A;  4JJN D;  5B2J B;  4WZS B;  3W96 B;  3W99 D;  2NQB A;  2HIO A;  3V9R B;  1F66 A;  1P3L A;  3A6N D;  4UUZ B;  1EQZ D;  1R4V A;  3WAA D;  5KDM A;  4J8X D;  1M1A B;  4YS3 D;  4ZUX D;  5B31 G;  5B1L A;  3WTP C;  3AZN A;  5AV8 C;  4WU9 D;  5B1M C;  4J8U A;  2NQB B;  1WWI A;  2HIO B;  2LY8 A;  5GXQ C;  3AV2 C;  3AZL C;  1F66 B;  5CPI C;  1P3L B;  2F8N D;  3REH C;  3C1B C;  5JRG A;  5B33 A;  3KXB D;  5KDM B;  5GT3 C;  2PYO A;  4X23 C;  5CP6 C;  5B1L B;  4ZBJ C;  3AZN B;  5B24 A;  1P3A D;  4J8U B;  3UTB D;  2HUE C;  3AZE A;  4G92 C;  1P3P A;  5JRG B;  5B33 B;  1JFI A;  2PYO B;  4QLC D;  3REJ A;  3X1V D;  3B6G A;  5B40 C;  3C1C C;  5B24 B;  5AY8 A;  3X1U A;  3AZE B;  1P3P B;  3W97 A;  3B0C W;  3AN2 D;  1P3K A;  3MNN A;  3AZG C;  4EO5 B;  2YFW A;  1JFI B;  3REJ B;  3AZI C;  1M19 A;  3B6G B;  5C3I C;  2F8N H;  3MGR A;  3AV1 C;  1KU5 A;  3X1U B;  5AY8 B;  3AZJ C;  3W98 C;  3W99 A;  4WU8 A;  3W97 B;  5DNN D;  4G91 C;  3KUY A;  1P3K B;  3MNN B;  2NZD C;  5DNM C;  5B2J D;  2YFW B;  3TU4 A;  3W96 D;  3WAA A;  4XUJ C;  3MGQ C;  1M19 B;  4YS3 A;  3MGR B;  5JA4 A;  3KSY A;  3LZ1 C;  1M1A D;  4HGA B;  5B2I C;  3MGP A;  4WU9 A;  3W99 B;  4E44 A;  4WU8 B;  4Z66 C;  3O62 D;  3UT9 C;  1KX5 C;  3KUY B;  1P3I C;  1P3B C;  5AV9 A;  3TU4 B;  3WAA B;  3UTA C;  3KXB A;  2NQB D;  2HIO D;  3AZH C;  1F66 D;  1P3L D;  4LD9 A;  4YS3 B;  3AFA B;  3VH6 T;  5JA4 B;  2RVQ D;  3MGP B;  3X1T A;  4WU9 B;  3VH5 A;  1BH9 A;  2CV5 C;  1U35 A;  5AV9 B;  3KXB B;  4J8U D;  5B1L C;  3WA9 C;  5BNV A;  1ZLA A;  4LD9 B;  1P3O C;  5JRG D;  1B67 A;  4R8P C;  3MVD D;  2PYO D;  3X1T B;  1BH9 B;  1U35 B;  5B32 A;  5BNX A;  1P3G A;  3AZK A;  1ULY A;  3AZE D;  1P3P D;  4NFT A;  5BNV B;  4J8W A;  1ZLA B;  1HQ3 C;  1P34 C;  2IO5 C;  5B0Y A;  5B0Z A;  3AZF A;  5B32 B;  5BNX B;  4XZQ A;  1P3G B;  3X1U D;  5AY8 D;  5AVB A;  3REJ C;  2FJ7 A;  5AVC C;  3AZK B;  4KUD C;  4H9P A;  3WKJ C;  1TZY C;  4J8W B;  1P3K D;  3MNN D;  3W97 C;  4NE5 A;  5B0Y B;  5B0Z B;  3WTP E;  1TAF A;  5GT0 A;  3REI C;  3O62 A;  3AZF B;  3MGR D;  3KWQ C;  5CPJ C;  4XZQ B;  5AVB B;  2FJ7 B;  1M19 C;  4H9P B;  4WU8 D;  5B31 A;  4JJN C;  3KUY D;  3W99 C;  3TU4 D;  3NQJ A;  3REK A;  3A6N C;  4KGC A;  1TAF B;  5GT0 B;  3AFA D;  3O62 B;  1EQZ C;  1ID3 A;  4YM6 A;  4J8X C;  3MGP D;  5AV6 C;  4ZUX C;  4YS3 C;  4H9R A;  3VH6 W;  5B31 B;  4Z5T A;  5AV9 D;  4WU9 C;  3NQJ B;  3REK B;  3MVD A;  3REL A;  4KGC B;  1AOI A;  4LD9 D;  1KX3 A;  4DRA A;  1ID3 B;  4YM6 B;  5CPK A;  2ARO A;  3X1T D;  3AYW A;  4H9R B;  1U35 D;  4Z5T B;  4J8V A;  1P3A C;  3UTB C;  5AV5 A;  3MVD B;  3LJA A;  3REH D;  1KX4 D;  3LEL A;  3REL B;  1AOI B;  1ZLA D;  1KX3 B;  4Z2M G;  5GSU A;  5GT3 D;  3VH5 T;  5BS7 A;  3MGS A;  5CPK B;  3LZ0 A;  4QLC C;  2ARO B;  2BYM A;  3X1V C;  5E5A A;  3AYW B;  5B32 D;  1P3G D;  4J8V B;  3AZK D;  1P3F A;  5AV5 B;  3LJA B;  3AZM A;  3LEL B;  4J8W D;  3AN2 C;  5F99 A;  5GSU B;  3MGS B;  3B0D B;  1S32 C;  3LZ0 B;  1N1J A;  2BYM B;  5E5A B;  5B0Y D;  5B0Z D;  1M18 D;  3X1S A;  3AZF D;  4XZQ D;  4AWL B;  5AVB D;  2FJ7 D;  3B6F A;  1P3F B;  2YFV A;  4H9S C;  5DNN C;  3AZM B;  5B2J C;  5F99 B;  3AFA A;  3W96 C;  2L5A A;  1N1J B;  3X1S B;  5GT0 D;  1M1A C;  3B6F B;  5BT1 D;  2YFV B;  3O62 C;  5B31 D;  4XUJ D;  3MGQ D;  2NQB C;  2HIO C;  3REK D;  1F66 C;  1P3L C;  4KGC D;  3WTP A;  5AV8 A;  1ID3 D;  4CAY A;  4YM6 D;  2RVQ C;  4H9Q A;  1KX5 D;  3AV2 A;  3AZL A;  5CPI A;  4NE3 A;  1WWS A;  3REH A;  1KX4 A;  4Z5T D;  3AZN C;  3C1B A;  5GT3 A;  4J8U C;  4X23 A;  5CP6 A;  1A7W A;  3REL D;  1AOI D;  3WTP B;  1KX3 D;  4H9N A;  5AV8 B;  5JRG C;  5B33 C;  4CAY B;  3MVD C;  4H9Q B;  5CPK D;  2PYO C;  2ARO D;  2F8N G;  3AV2 B;  2JSS A;  3AZL B;  3AYW D;  5CPI B;  1P3M D;  3VH5 W;  3REH B;  1KX4 B;  5B24 C;  3C1B B;  4DRB A;  5GT3 B;  4J8V D;  3AZE C;  1P3P C;  4X23 B;  5AV5 D;  5CP6 B;  3LJA D;  5B40 A;  3LEL D;  3C1C A;  1M18 A;  4H9N B;  4EO5 C;  5GSU D;  4R8P D;  3MGS D;  3LZ0 D;  2HUE B;  4G92 B;  5E5A D;  3B6G C;  1F1E A;  3AZG A;  4H9O A;  3X1U C;  5AY8 C;  4M6B A;  3AZI A;  1P3F D;  3AZM D;  5B40 B;  1P3K C;  3MNN C;  3AV1 A;  3C1C B;  1M18 B;  1HQ3 D;  5F99 D;  3AZJ A;  3W98 A;  3B0C T;  3X1S D;  3MGR C;  2NZD A;  3AZG B;  4H9O B;  5DNM A;  4HGA C;  4XUJ A;  3MGQ A;  3B6F D;  3AZI B;  4WU8 C;  5C3I B;  3KUY C;  3AV1 B;  3TU4 C;  3LZ1 A;  3WAA C;  3AZJ B;  5B2I A;  3W98 B;  1KX5 A;  4Z66 A;  3UT9 A;  4G91 B;  3AFA C;  1P3I A;  1P3B A;  2NZD B;  5DNM B;  1BFM A;  3UTA A;  4XUJ B;  3MGP C;  3MGQ B;  3AZH A;  5AV9 C;  3LZ1 B;  3KXB C;  4WV4 B;  5B2I B;  1KX5 B;  4Z66 B;  3UT9 B;  2CV5 A;  4LD9 C;  1P3M A;  3WTP D;  1P3I B;  1P3B B;  5AV8 D;  5AV6 D;  3UTA B;  5B1M D;  3X1T C;  5BO0 A;  5GXQ D;  3AV2 D;  3AZH B;  3AZL D;  3WA9 A;  5CPI D;  1U35 C;  1P3O A;  3C1B D;  4R8P A;  4X23 D;  1KX4 C;  5CP6 D;  2CV5 B;  1ZLA C;  1P3M B;  1Q9C A;  5BO0 B;  3WA9 B;  5B32 C;  1P3O B;  1P3G C;  1HQ3 A;  4R8P B;  3AZK C;  1P34 A;  1HTA A;  4J8W C;  5B40 D;  3C1C D;  5AVC A;  4KUD A;  5FUG A;  5B0Y C;  5B0Z C;  3WKJ A;  1M18 C;  1TZY A;  3AZF C;  3AZG D;  4XZQ C;  5AVB C;  1HQ3 B;  2FJ7 C;  1P34 B;  2IO5 B;  3AZI D;  1H3O A;  3REI A;  1B6W A;  1BH8 A;  3AV1 D;  3KWQ A;  5CPJ A;  1S32 D;  3AZJ D;  5AVC B;  4KUD B;  3W98 D;  5FUG B;  3WKJ B;  1TZY B;  5GT0 C;  4JJN A;  2NZD D;  5G49 A;  5DNM D;  5BT1 C;  2CWE A;  3A6N A;  5B31 C; 
#chains in the Genus database with same CATH topology
 1H3O B;  3REI B;  3EPH A;  1BH8 B;  1EQZ A;  3KWQ B;  5CPJ B;  4KHA A;  4J8X A;  3LZ1 D;  2DQN C;  5B2I D;  4ZUX A;  5AV6 A;  3REK C;  5B1M A;  4Z66 D;  2F8N K;  3UT9 D;  4KGC C;  5GXQ A;  4JJN B;  1P3B D;  1P3I D;  5G49 B;  1ID3 C;  4YM6 C;  3UTA D;  2F8N A;  3A6N B;  3AZH D;  4Z5T C;  1EQZ B;  4KHA B;  4J8X B;  5AV6 B;  4ZUX B;  5B1M B;  3REL C;  2CV5 D;  5GXQ B;  1KX3 C;  1AOI C;  3R45 A;  5CPK C;  1P3A A;  3UTB A;  2ARO C;  5B1L D;  3AYW C;  2F8N B;  1P3M C;  3WA9 D;  3B0B A;  3AZN D;  5CHL B;  1P3O D;  4ZBJ B;  4J8V C;  4QLC A;  5AV5 C;  3X1V A;  3LJA C;  3LEL C;  2BYK A;  3A6N A;  5B33 D;  3R45 B;  5GSU C;  3MGS C;  3B0D C;  5BS7 C;  1P3A B;  3LZ0 C;  3UTB B;  5E5A C;  3NQU A;  3AN2 A;  5B24 D;  4AWL C;  1S32 A;  4QLC B;  1P3F C;  1P34 D;  3X1V B;  3AZM C;  2BYK B;  5B32 G;  4CSR A;  5F99 C;  3REJ D;  5AVC D;  3B6G D;  4KUD D;  4WNN A;  3WKJ D;  4H9S A;  5DNN A;  1TZY D;  3NQU B;  4UPK A;  3AN2 B;  3X1S C;  5B2J A;  3W96 A;  4Z2M H;  1S32 B;  3B6F C;  3W97 D;  4NE6 A;  3V9R A;  4UUZ A;  3REI D;  4CSR B;  3KWQ D;  5CPJ D;  1M1A A;  1M19 D;  3VH6 A;  4WNN B;  5DNN B;  4E45 A;  4JJN D;  5B2J B;  4WZS B;  3W96 B;  3W99 D;  2NQB A;  2HIO A;  3V9R B;  1F66 A;  1P3L A;  3A6N D;  4UUZ B;  1EQZ D;  1R4V A;  3WAA D;  5KDM A;  4J8X D;  1M1A B;  4YS3 D;  4ZUX D;  3IP4 C;  5B31 G;  5B1L A;  3WTP C;  3AZN A;  5AV8 C;  4WU9 D;  5B1M C;  4J8U A;  2NQB B;  1WWI A;  2HIO B;  2LY8 A;  5GXQ C;  2Y2O A;  3AZL C;  3AV2 C;  5CPI C;  1P3L B;  1F66 B;  2F8N D;  3REH C;  3C1B C;  5JRG A;  5B33 A;  3KXB D;  5KDM B;  5GT3 C;  2PYO A;  4X23 C;  5CP6 C;  5B1L B;  4ZBJ C;  3AZN B;  5B24 A;  2BG1 A;  1P3A D;  4J8U B;  3EG5 B;  2HUE C;  3UTB D;  4G92 C;  3AZE A;  1P3P A;  2JCH A;  5JRG B;  4WJ3 C;  5B33 B;  1JFI A;  3AL0 C;  2PYO B;  4QLC D;  3REJ A;  3X1V D;  2G5H C;  3B6G A;  5B40 C;  2J8P A;  3C1C C;  5B24 B;  5AY8 A;  3X1U A;  3AZE B;  1P3P B;  3W97 A;  3B0C W;  3AN2 D;  1P3K A;  3MNN A;  3AZG C;  4EO5 B;  2YFW A;  1JFI B;  3REJ B;  3AZI C;  1M19 A;  3B6G B;  5C3I C;  2Y2P A;  2F8N H;  3MGR A;  3AV1 C;  1KU5 A;  3EPJ A;  3X1U B;  5AY8 B;  3AZJ C;  3W98 C;  3W99 A;  4WU8 A;  3W97 B;  5DNN D;  4G91 C;  3KUY A;  1P3K B;  3MNN B;  2NZD C;  5DNM C;  5B2J D;  2YFW B;  3TU4 A;  3W96 D;  3WAA A;  4XUJ C;  3MGQ C;  2FFF B;  2Y2N A;  1M19 B;  4YS3 A;  2Y2H A;  3MGR B;  5JA4 A;  3KSY A;  3LZ1 C;  1M1A D;  4HGA B;  5B2I C;  3MGP A;  4WU9 A;  3W99 B;  4E44 A;  4WU8 B;  4Z66 C;  3O62 D;  3FDD A;  3UT9 C;  1KX5 C;  2Y2M A;  3KUY B;  2Y2G A;  1P3I C;  1P3B C;  5AV9 A;  3TU4 B;  3WAA B;  3UTA C;  3KXB A;  2NQB D;  2HIO D;  2XD5 A;  3AZH C;  1F66 D;  1P3L D;  4LD9 A;  4YS3 B;  3AFA B;  3VH6 T;  5JA4 B;  2RVQ D;  3MGP B;  3X1T A;  4WU9 B;  3VH5 A;  1BH9 A;  2CV5 C;  1U35 A;  5AV9 B;  3KXB B;  4J8U D;  5B1L C;  3WA9 C;  1Z2C B;  5BNV A;  1ZLA A;  4LD9 B;  1P3O C;  5JRG D;  1B67 A;  4R8P C;  3MVD D;  2PYO D;  3X1T B;  1BH9 B;  2G5I C;  1U35 B;  5B32 A;  5BNX A;  1P3G A;  3AZK A;  1ULY A;  3AZE D;  1P3P D;  4NFT A;  5BNV B;  4J8W A;  1ZLA B;  2W8S A;  3H0M C;  3H0L C;  1HQ3 C;  2UWX A;  1P34 C;  2IO5 C;  5B0Y A;  5B0Z A;  3AZF A;  5B32 B;  2ZY5 A;  5BNX B;  4XZQ A;  1P3G B;  3X1U D;  5AY8 D;  5AVB A;  3REJ C;  2FJ7 A;  5AVC C;  3AZK B;  4KUD C;  3KFU G;  4H9P A;  3WKJ C;  1TZY C;  4J8W B;  1P3K D;  3MNN D;  3W97 C;  4NE5 A;  5B0Y B;  5B0Z B;  3WTP E;  1TAF A;  5GT0 A;  3EPK A;  3O62 A;  3REI C;  3AZF B;  3MGR D;  3KWQ C;  5CPJ C;  4XZQ B;  5AVB B;  2FJ7 B;  1M19 C;  4H9P B;  4WU8 D;  5B31 A;  4JJN C;  3KUY D;  2Y2I A;  3W99 C;  3TU4 D;  3NQJ A;  3REK A;  3A6N C;  4KGC A;  1TAF B;  5GT0 B;  3AFA D;  3O62 B;  1EQZ C;  2ZY4 A;  1ID3 A;  4YM6 A;  4J8X C;  3MGP D;  5AV6 C;  4ZUX C;  4YS3 C;  4H9R A;  3VH6 W;  5B31 B;  4Z5T A;  5AV9 D;  4WU9 C;  3NQJ B;  3REK B;  3MVD A;  3REL A;  4KGC B;  1AOI A;  4LD9 D;  1KX3 A;  4DRA A;  1ID3 B;  4YM6 B;  5CPK A;  2ARO A;  3X1T D;  3AYW A;  4H9R B;  2Y2K A;  1U35 D;  4Z5T B;  2ZY3 A;  4J8V A;  1P3A C;  3UTB C;  5AV5 A;  3MVD B;  3LJA A;  3REH D;  1KX4 D;  3H0R C;  3LEL A;  3REL B;  1AOI B;  3A1K A;  1KX3 B;  4Z2M G;  1ZLA D;  5GSU A;  5GT3 D;  3VH5 T;  5BS7 A;  3MGS A;  5CPK B;  3LZ0 A;  4QLC C;  2ARO B;  2BYM A;  2F2A C;  5E5A A;  3X1V C;  3AYW B;  2Y2Q A;  5B32 D;  1P3G D;  4J8V B;  3AZK D;  1P3F A;  5AV5 B;  2XD1 A;  3LJA B;  3AZM A;  3LEL B;  4J8W D;  3AN2 C;  5F99 A;  5GSU B;  3MGS B;  3B0D B;  1S32 C;  3LZ0 B;  1N1J A;  2BYM B;  5E5A B;  5B0Y D;  5B0Z D;  1M18 D;  3X1S A;  3AZF D;  3A1I A;  4XZQ D;  4AWL B;  5AVB D;  2FJ7 D;  3B6F A;  1P3F B;  2YFV A;  4H9S C;  5DNN C;  3AZM B;  5B2J C;  5F99 B;  3AFA A;  3W96 C;  2L5A A;  1N1J B;  3X1S B;  5GT0 D;  1M1A C;  3B6F B;  5BT1 D;  2YFV B;  3O62 C;  5B31 D;  4XUJ D;  3MGQ D;  2NQB C;  2HIO C;  3REK D;  1F66 C;  1P3L C;  4KGC D;  3WTP A;  5AV8 A;  1ID3 D;  4CAY A;  4YM6 D;  2DF4 C;  2RVQ C;  4H9Q A;  1KX5 D;  3AV2 A;  3AZL A;  5CPI A;  4NE3 A;  1WWS A;  3REH A;  1KX4 A;  3P5J B;  4Z5T D;  3AZN C;  3C1B A;  5GT3 A;  4J8U C;  4X23 A;  5CP6 A;  1A7W A;  1T3U A;  3REL D;  2Y2J A;  1AOI D;  3WTP B;  1KX3 D;  4H9N A;  5AV8 B;  5JRG C;  5B33 C;  2Y2L A;  4CAY B;  3MVD C;  4H9Q B;  5CPK D;  2PYO C;  2ARO D;  3EPL A;  3AV2 B;  2F8N G;  2JSS A;  3AZL B;  3AYW D;  5CPI B;  1P3M D;  3VH5 W;  3REH B;  1KX4 B;  5B24 C;  3C1B B;  4DRB A;  5GT3 B;  4J8V D;  3AZE C;  1P3P C;  4X23 B;  5AV5 D;  5CP6 B;  3LJA D;  5B40 A;  3LEL D;  3C1C A;  1M18 A;  4H9N B;  4EO5 C;  5GSU D;  4R8P D;  3MGS D;  3LZ0 D;  2HUE B;  4G92 B;  5E5A D;  3B6G C;  1F1E A;  3AZG A;  1W2E A;  4H9O A;  3X1U C;  5AY8 C;  4M6B A;  3AZI A;  1P3F D;  2ZM5 A;  3AZM D;  5B40 B;  1P3K C;  3MNN C;  3AV1 A;  3C1C B;  1M18 B;  1HQ3 D;  5F99 D;  3AZJ A;  3W98 A;  3B0C T;  3X1S D;  3MGR C;  2NZD A;  3AZG B;  4H9O B;  5DNM A;  4HGA C;  4XUJ A;  3MGQ A;  3B6F D;  3AZI B;  4WU8 C;  5C3I B;  4DQY B;  3KUY C;  3AV1 B;  3TU4 C;  3LZ1 A;  3WAA C;  3AZJ B;  5B2I A;  3W98 B;  1KX5 A;  4Z66 A;  3UT9 A;  4G91 B;  3AFA C;  1P3I A;  1P3B A;  2NZD B;  5DNM B;  1BFM A;  3UTA A;  4XUJ B;  3MGP C;  3MGQ B;  3AZH A;  5AV9 C;  3LZ1 B;  3KXB C;  4WV4 B;  5B2I B;  1KX5 B;  4Z66 B;  3UT9 B;  2CV5 A;  4LD9 C;  2ZY2 A;  1P3M A;  3WTP D;  1P3I B;  1P3B B;  5AV8 D;  5AV6 D;  3UTA B;  5B1M D;  3X1T C;  5BO0 A;  5GXQ D;  3AV2 D;  3AZH B;  3AZL D;  3WA9 A;  5CPI D;  1U35 C;  1P3O A;  3C1B D;  4R8P A;  4X23 D;  1KX4 C;  5CP6 D;  2CV5 B;  1ZLA C;  3F6T A;  1P3M B;  1Q9C A;  5BO0 B;  3WA9 B;  5B32 C;  1P3O B;  1P3G C;  1HQ3 A;  4R8P B;  3AZK C;  1P34 A;  1HTA A;  4J8W C;  5B40 D;  3C1C D;  5AVC A;  4KUD A;  5FUG A;  5B0Y C;  5B0Z C;  3WKJ A;  1M18 C;  1TZY A;  3AZF C;  3AZG D;  4XZQ C;  5AVB C;  1HQ3 B;  2JE5 A;  2FJ7 C;  1P34 B;  2IO5 B;  3AZI D;  1H3O A;  3REI A;  1B6W A;  1BH8 A;  3AV1 D;  3KWQ A;  1PZR A;  5CPJ A;  1S32 D;  3AZJ D;  5AVC B;  4KUD B;  3W98 D;  5FUG B;  3WKJ B;  1TZY B;  5GT0 C;  4JJN A;  2NZD D;  5G49 A;  5DNM D;  2RIQ A;  5BT1 C;  2CWE A;  2VQR A;  5B31 C; 
#chains in the Genus database with same CATH homology
 1H3O B;  3REI B;  3EPH A;  1BH8 B;  1EQZ A;  3KWQ B;  5CPJ B;  4KHA A;  4J8X A;  3LZ1 D;  2DQN C;  5B2I D;  4ZUX A;  5AV6 A;  3REK C;  5B1M A;  4Z66 D;  2F8N K;  3UT9 D;  4KGC C;  5GXQ A;  4JJN B;  1P3B D;  1P3I D;  5G49 B;  1ID3 C;  4YM6 C;  3UTA D;  2F8N A;  3A6N B;  3AZH D;  4Z5T C;  1EQZ B;  4KHA B;  4J8X B;  5AV6 B;  4ZUX B;  5B1M B;  3REL C;  2CV5 D;  5GXQ B;  1KX3 C;  1AOI C;  3R45 A;  5CPK C;  1P3A A;  3UTB A;  2ARO C;  5B1L D;  3AYW C;  2F8N B;  1P3M C;  3WA9 D;  3B0B A;  3AZN D;  5CHL B;  1P3O D;  4ZBJ B;  4J8V C;  4QLC A;  5AV5 C;  3X1V A;  3LJA C;  3LEL C;  2BYK A;  3A6N A;  5B33 D;  3R45 B;  5GSU C;  3MGS C;  3B0D C;  5BS7 C;  1P3A B;  3LZ0 C;  3UTB B;  5E5A C;  3NQU A;  3AN2 A;  5B24 D;  4AWL C;  1S32 A;  4QLC B;  1P3F C;  1P34 D;  3X1V B;  3AZM C;  2BYK B;  5B32 G;  4CSR A;  5F99 C;  3REJ D;  5AVC D;  3B6G D;  4KUD D;  4WNN A;  3WKJ D;  4H9S A;  5DNN A;  1TZY D;  3NQU B;  4UPK A;  3AN2 B;  3X1S C;  5B2J A;  3W96 A;  4Z2M H;  1S32 B;  3B6F C;  3W97 D;  4NE6 A;  3V9R A;  4UUZ A;  3REI D;  4CSR B;  3KWQ D;  5CPJ D;  1M1A A;  1M19 D;  3VH6 A;  4WNN B;  5DNN B;  4E45 A;  4JJN D;  5B2J B;  4WZS B;  3W96 B;  3W99 D;  2NQB A;  2HIO A;  3V9R B;  1F66 A;  1P3L A;  3A6N D;  4UUZ B;  1EQZ D;  1R4V A;  3WAA D;  5KDM A;  4J8X D;  1M1A B;  4YS3 D;  4ZUX D;  3IP4 C;  5B31 G;  5B1L A;  3WTP C;  3AZN A;  5AV8 C;  4WU9 D;  5B1M C;  4J8U A;  2NQB B;  1WWI A;  2HIO B;  2LY8 A;  5GXQ C;  2Y2O A;  3AZL C;  3AV2 C;  5CPI C;  1P3L B;  1F66 B;  2F8N D;  3REH C;  3C1B C;  5JRG A;  5B33 A;  3KXB D;  5KDM B;  5GT3 C;  2PYO A;  4X23 C;  5CP6 C;  5B1L B;  4ZBJ C;  3AZN B;  5B24 A;  2BG1 A;  1P3A D;  4J8U B;  3EG5 B;  2HUE C;  3UTB D;  4G92 C;  3AZE A;  1P3P A;  2JCH A;  5JRG B;  4WJ3 C;  5B33 B;  1JFI A;  3AL0 C;  2PYO B;  4QLC D;  3REJ A;  3X1V D;  2G5H C;  3B6G A;  5B40 C;  2J8P A;  3C1C C;  5B24 B;  5AY8 A;  3X1U A;  3AZE B;  1P3P B;  3W97 A;  3B0C W;  3AN2 D;  1P3K A;  3MNN A;  3AZG C;  4EO5 B;  2YFW A;  1JFI B;  3REJ B;  3AZI C;  1M19 A;  3B6G B;  5C3I C;  2Y2P A;  2F8N H;  3MGR A;  3AV1 C;  1KU5 A;  3EPJ A;  3X1U B;  5AY8 B;  3AZJ C;  3W98 C;  3W99 A;  4WU8 A;  3W97 B;  5DNN D;  4G91 C;  3KUY A;  1P3K B;  3MNN B;  2NZD C;  5DNM C;  5B2J D;  2YFW B;  3TU4 A;  3W96 D;  3WAA A;  4XUJ C;  3MGQ C;  2FFF B;  2Y2N A;  1M19 B;  4YS3 A;  2Y2H A;  3MGR B;  5JA4 A;  3KSY A;  3LZ1 C;  1M1A D;  4HGA B;  5B2I C;  3MGP A;  4WU9 A;  3W99 B;  4E44 A;  4WU8 B;  4Z66 C;  3O62 D;  3FDD A;  3UT9 C;  1KX5 C;  2Y2M A;  3KUY B;  2Y2G A;  1P3I C;  1P3B C;  5AV9 A;  3TU4 B;  3WAA B;  3UTA C;  3KXB A;  2NQB D;  2HIO D;  2XD5 A;  3AZH C;  1F66 D;  1P3L D;  4LD9 A;  4YS3 B;  3AFA B;  3VH6 T;  5JA4 B;  2RVQ D;  3MGP B;  3X1T A;  4WU9 B;  3VH5 A;  1BH9 A;  2CV5 C;  1U35 A;  5AV9 B;  3KXB B;  4J8U D;  5B1L C;  3WA9 C;  1Z2C B;  5BNV A;  1ZLA A;  4LD9 B;  1P3O C;  5JRG D;  1B67 A;  4R8P C;  3MVD D;  2PYO D;  3X1T B;  1BH9 B;  2G5I C;  1U35 B;  5B32 A;  5BNX A;  1P3G A;  3AZK A;  1ULY A;  3AZE D;  1P3P D;  4NFT A;  5BNV B;  4J8W A;  1ZLA B;  2W8S A;  3H0M C;  3H0L C;  1HQ3 C;  2UWX A;  1P34 C;  2IO5 C;  5B0Y A;  5B0Z A;  3AZF A;  5B32 B;  2ZY5 A;  5BNX B;  4XZQ A;  1P3G B;  3X1U D;  5AY8 D;  5AVB A;  3REJ C;  2FJ7 A;  5AVC C;  3AZK B;  4KUD C;  3KFU G;  4H9P A;  3WKJ C;  1TZY C;  4J8W B;  1P3K D;  3MNN D;  3W97 C;  4NE5 A;  5B0Y B;  5B0Z B;  3WTP E;  1TAF A;  5GT0 A;  3EPK A;  3O62 A;  3REI C;  3AZF B;  3MGR D;  3KWQ C;  5CPJ C;  4XZQ B;  5AVB B;  2FJ7 B;  1M19 C;  4H9P B;  4WU8 D;  5B31 A;  4JJN C;  3KUY D;  2Y2I A;  3W99 C;  3TU4 D;  3NQJ A;  3REK A;  3A6N C;  4KGC A;  1TAF B;  5GT0 B;  3AFA D;  3O62 B;  1EQZ C;  2ZY4 A;  1ID3 A;  4YM6 A;  4J8X C;  3MGP D;  5AV6 C;  4ZUX C;  4YS3 C;  4H9R A;  3VH6 W;  5B31 B;  4Z5T A;  5AV9 D;  4WU9 C;  3NQJ B;  3REK B;  3MVD A;  3REL A;  4KGC B;  1AOI A;  4LD9 D;  1KX3 A;  4DRA A;  1ID3 B;  4YM6 B;  5CPK A;  2ARO A;  3X1T D;  3AYW A;  4H9R B;  2Y2K A;  1U35 D;  4Z5T B;  2ZY3 A;  4J8V A;  1P3A C;  3UTB C;  5AV5 A;  3MVD B;  3LJA A;  3REH D;  1KX4 D;  3H0R C;  3LEL A;  3REL B;  1AOI B;  3A1K A;  1KX3 B;  4Z2M G;  1ZLA D;  5GSU A;  5GT3 D;  3VH5 T;  5BS7 A;  3MGS A;  5CPK B;  3LZ0 A;  4QLC C;  2ARO B;  2BYM A;  2F2A C;  5E5A A;  3X1V C;  3AYW B;  2Y2Q A;  5B32 D;  1P3G D;  4J8V B;  3AZK D;  1P3F A;  5AV5 B;  2XD1 A;  3LJA B;  3AZM A;  3LEL B;  4J8W D;  3AN2 C;  5F99 A;  5GSU B;  3MGS B;  3B0D B;  1S32 C;  3LZ0 B;  1N1J A;  2BYM B;  5E5A B;  5B0Y D;  5B0Z D;  1M18 D;  3X1S A;  3AZF D;  3A1I A;  4XZQ D;  4AWL B;  5AVB D;  2FJ7 D;  3B6F A;  1P3F B;  2YFV A;  4H9S C;  5DNN C;  3AZM B;  5B2J C;  5F99 B;  3AFA A;  3W96 C;  2L5A A;  1N1J B;  3X1S B;  5GT0 D;  1M1A C;  3B6F B;  5BT1 D;  2YFV B;  3O62 C;  5B31 D;  4XUJ D;  3MGQ D;  2NQB C;  2HIO C;  3REK D;  1F66 C;  1P3L C;  4KGC D;  3WTP A;  5AV8 A;  1ID3 D;  4CAY A;  4YM6 D;  2DF4 C;  2RVQ C;  4H9Q A;  1KX5 D;  3AV2 A;  3AZL A;  5CPI A;  4NE3 A;  1WWS A;  3REH A;  1KX4 A;  3P5J B;  4Z5T D;  3AZN C;  3C1B A;  5GT3 A;  4J8U C;  4X23 A;  5CP6 A;  1A7W A;  1T3U A;  3REL D;  2Y2J A;  1AOI D;  3WTP B;  1KX3 D;  4H9N A;  5AV8 B;  5JRG C;  5B33 C;  2Y2L A;  4CAY B;  3MVD C;  4H9Q B;  5CPK D;  2PYO C;  2ARO D;  3EPL A;  3AV2 B;  2F8N G;  2JSS A;  3AZL B;  3AYW D;  5CPI B;  1P3M D;  3VH5 W;  3REH B;  1KX4 B;  5B24 C;  3C1B B;  4DRB A;  5GT3 B;  4J8V D;  3AZE C;  1P3P C;  4X23 B;  5AV5 D;  5CP6 B;  3LJA D;  5B40 A;  3LEL D;  3C1C A;  1M18 A;  4H9N B;  4EO5 C;  5GSU D;  4R8P D;  3MGS D;  3LZ0 D;  2HUE B;  4G92 B;  5E5A D;  3B6G C;  1F1E A;  3AZG A;  1W2E A;  4H9O A;  3X1U C;  5AY8 C;  4M6B A;  3AZI A;  1P3F D;  2ZM5 A;  3AZM D;  5B40 B;  1P3K C;  3MNN C;  3AV1 A;  3C1C B;  1M18 B;  1HQ3 D;  5F99 D;  3AZJ A;  3W98 A;  3B0C T;  3X1S D;  3MGR C;  2NZD A;  3AZG B;  4H9O B;  5DNM A;  4HGA C;  4XUJ A;  3MGQ A;  3B6F D;  3AZI B;  4WU8 C;  5C3I B;  4DQY B;  3KUY C;  3AV1 B;  3TU4 C;  3LZ1 A;  3WAA C;  3AZJ B;  5B2I A;  3W98 B;  1KX5 A;  4Z66 A;  3UT9 A;  4G91 B;  3AFA C;  1P3I A;  1P3B A;  2NZD B;  5DNM B;  1BFM A;  3UTA A;  4XUJ B;  3MGP C;  3MGQ B;  3AZH A;  5AV9 C;  3LZ1 B;  3KXB C;  4WV4 B;  5B2I B;  1KX5 B;  4Z66 B;  3UT9 B;  2CV5 A;  4LD9 C;  2ZY2 A;  1P3M A;  3WTP D;  1P3I B;  1P3B B;  5AV8 D;  5AV6 D;  3UTA B;  5B1M D;  3X1T C;  5BO0 A;  5GXQ D;  3AV2 D;  3AZH B;  3AZL D;  3WA9 A;  5CPI D;  1U35 C;  1P3O A;  3C1B D;  4R8P A;  4X23 D;  1KX4 C;  5CP6 D;  2CV5 B;  1ZLA C;  3F6T A;  1P3M B;  1Q9C A;  5BO0 B;  3WA9 B;  5B32 C;  1P3O B;  1P3G C;  1HQ3 A;  4R8P B;  3AZK C;  1P34 A;  1HTA A;  4J8W C;  5B40 D;  3C1C D;  5AVC A;  4KUD A;  5FUG A;  5B0Y C;  5B0Z C;  3WKJ A;  1M18 C;  1TZY A;  3AZF C;  3AZG D;  4XZQ C;  5AVB C;  1HQ3 B;  2JE5 A;  2FJ7 C;  1P34 B;  2IO5 B;  3AZI D;  1H3O A;  3REI A;  1B6W A;  1BH8 A;  3AV1 D;  3KWQ A;  1PZR A;  5CPJ A;  1S32 D;  3AZJ D;  5AVC B;  4KUD B;  3W98 D;  5FUG B;  3WKJ B;  1TZY B;  5GT0 C;  4JJN A;  2NZD D;  5G49 A;  5DNM D;  2RIQ A;  5BT1 C;  2CWE A;  2VQR A;  5B31 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...