1M18A

Ligand binding alters the structure and dynamics of nucleosomal dna
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
98
structure length
98
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein/dna
molecule keywords Palindromic 146 Base Pair DNA Fragment
publication title Crystal Structures of Nucleosome Core Particles in Complex with Minor Groove DNA-binding Ligands
pubmed doi rcsb
source organism Xenopus laevis
total genus 32
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2002-06-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1m18A00
4WV4B 1BH8B 5DNNB 3X1SB 4WU8C 2AROC 3WTPE 5F99A 3KXBC 5GT3D 4X23B 1P3FD 3MGQA 3V9RA 4KGCC 3W96A 3WAAA 3UTAD 3AV1B 1P3OB 4J8WA 5JRGD 4XUJA 4X23D 1TZYD 4KUDA 4DRBA 3AZMA 3REJC 5B33C 3REHC 5CPKA 2CV5A 5B0YA 1ULYA 4H9OB 1P34C 3AV2B 1BH9A 3AV1D 1P3OD 1P3MD 5CP6A 5GT3C 4Z5TA 1P3FC 5BNXB 3X1VB 4ZUXA 5B32G 3MGRA 3X1SC 4CAYA 3UTAC 1AOIB 5JRGC 4YS3B 3MGPB 4X23C 4Z2MH 3AZIA 3AZKA 3X1VD 1KX5D 2NQBB 5AY8A 3UTBD 5GSUB 4NE3A 3REIB 3AV1C 3LJAB 1P3OC 1AOID 1EQZB 4YS3D 3MGPD 3VH6A 3LZ1D 3AN2A 3REKB 1P3IA 2NQBD 1F66B 3AV2C 1EQZD 3X1TA 5DNMD 2FJ7B 4YM6B 1ZLAD 3W98B 3LELB 3VH5T 4NE5A 3X1VC 5B2IA 3RELB 3O62A 3W97A 5GXQB 1AOIC 2FJ7D 4YM6D 5B40B 3W98D 4YS3C 3MGPC 3W99B 4Z2MG 3LZ1C 3RELD 5B1LB 4G92B 2NQBC 4JJND 5CPIB 5GSUC 3REIC 1EQZC 1Q9CA 4WU9D 5DNMC 4WNNA 3W99D 5C3IB 2BYMB 3REKC 1R4VA 5B1LD 1P3AD 1KX4B 1F66C 3WKJA 3X1UA 3TU4B 4DRAA 4Z66A 1ID3D 5B0ZD 5AV5A 2FJ7C 4YM6C 3KWQB 2F8NA 3W98C 3LELC 3RELC 1M1AA 1WWIA 3TU4D 2F8NG 3NQUB 5F99D 4EO5B 5GXQC 4CSRA 4XUJB 4J8XB 3KWQD 3MGQD 5B40C 4KUDB 3W99C 2NZDA 3AZJA 3W96D 5CPKB 5B1LC 4G92C 5B0YB 3AZNB 3WAAD 5AVCA 1P3AC 5CPIC 1P3LA 2L5AA 4XUJD 4QLCB 3AZGA 4KUDD 5C3IC 5AVBA 5CPKD 2CV5D 5B0YD 3AZND 2IO5B 1KX4C 5B24B 2HIOA 4R8PA 3WTPA 3TU4C 1S32B 5CP6D 3AZFB 1P3GA 4Z5TD 3KWQC 3AZLB 4LD9A 4ZUXD 5AV9A 2LY8A 5B24D 4H9NA 5CPJB 5B1MB 4EO5C 4XUJC 3AZKD 1A7WA 5JA4A 3AZLD 4KUDC 1P3IB 5AY8D 5CPKC 5B0YC 3AZNC 5BNVB 3KUYB 5G49B 3C1CA 5B1MD 4QLCC 4NFTA 1P3ID 4AWLB 3B6GB 2PYOB 2IO5C 3KUYD 3X1TD 3C1BA 1U35A 5B24C 3UTAB 3NQJA 3VH6W 5E5AA 5JRGB 3AZFC 1S32C 1TZYB 4J8UA 3B6FB 3AZLC 3B6GD 4H9RB 2PYOD 5AY8C 3W97D 3B0CT 3UT9A 2HUEB 4WZSB 5CPJC 5B1MC 1P3BB 1P3MB 5B31B 1JFIA 5KDMB 3LZ0A 1KX3A 3B6FD 1HQ3A 1P3IC 3WKJB 3KUYC 5B32A 1P3BD 5B31D 4H9PB 4AWLC 1KX5B 3B6GC 3WKJD 2YFWA 1M1AB 2PYOC 3MNNA 3W97C 3UTBB 4Z66D 5AV5D 5FUGB 3MGSA 1N1JB 1B67A 1TZYC 3LZ1B 3B6FC 5B2JA 3AYWA 1M1AD 5AV8A 1P3KA 2HUEC 5GT0A 5DNMB 3AZGB 1P3BC 1P3MC 5B31C 5AVBB 3AZJD 2NZDD 1ZLAB 3KSYA 4H9QB 5CHLB 3AZHA 1P3LD 3WKJC 4R8PB 4G91B 3AZGD 4Z66C 4WU8A 5BO0B 5AVBD 1P3GB 2AROA 1H3OA 3VH5A 1BFMA 1M18B 2JSSA 1KX5C 1M1AC 4R8PD 4JJNB 2YFVB 4KGCA 4NE6A 3UTBC 1P3GD 4WU9B 4LD9D 1M18D 4J8VA 4H9SC 4ZBJB 5AV9D 1P3AB 2BYKB 4UUZB 3REJA 5B33A 3REHA 1P34A 3AZGC 1ID3B 5B0ZB 5AVBC 3MVDB 1P3PA 1ZLAC 4KHAB 1P3FA 1U35B 3C1CD 4R8PC 4G91C 1BH8A 5DNNA 3X1SA 5F99B 3MVDD 1P3GC 1TAFA 3MGQB 4XZQA 3V9RB 1M18C 3W96B 4X23A 1U35D 3WAAB 5BS7A 4JJNC 4J8WB 4WU9C 3LZ0B 3AV1A 1P3OA 3A6NA 3AZMB 2CV5B 4ZBJC 3UT9D 1BH9B 4J8WD 4H9OA 3AV2A 3LZ0D 1KX3D 1ID3C 5CP6B 1HQ3D 5B0ZC 3MVDC 4Z5TB 3AZMD 4ZUXB 3WA9A 3MGRB 3MNNB 1U35C 5B32D 3X1VA 4CAYB 5F99C 3AZKB 3MGQC 3AZIB 3MGRD 4YS3A 3W96C 5AY8B 3MGPA 3MNND 3WAAC 5GT0B 5BT1D 4J8WC 5GSUA 3REIA 3LZ0C 3AZID 3LJAA 5B2JD 3AN2B 3AYWD 5AV8D 2RVQD 3AZMC 1P3KD 2CV5C 3REKA 3X1TB 5GT0D 1F66A 3AN2D 5CP6C 4Z5TC 4YM6A 5B2IB 4ZUXC 3O62B 3AZHD 3MGRC 3W98A 3MNNC 3LELA 3W97B 4WU8D 3RELA 5AV6A 2AROD 5BT1C 5GXQA 3AZKC 4J8VB 3AZIC 5B2JC 5B2ID 5B40A 3O62D 3W99A 2RVQC 5GT0C 1B6WA 4WNNB 5CPIA 1P3PB 3VH5W 4J8VD 3AN2C 2BYMA 3REJD 5B33D 3REHD 3X1TC 1P34D 3X1UB 1KX4A 4Z66B 1P3PD 1TAFB 4E44A 5AV5B 2F8NB 4XZQB 3TU4A 3KWQA 5B2IC 3O62C 3X1UD 4HGAB 5DNND 3X1SD 4CSRB 1HTAA 2F8ND 4XZQD 3A6NB 2NZDB 3NQUA 3AZJB 3AFAA 1M19A 4J8VC 4J8XA 5AVCB 1P3LB 3AZNA 3A6ND 1P3PC 3R45A 4QLCA 3WA9B 5AVCD 3AZEA 2HIOB 3WTPB 3X1UC 3AV2D 5DNNC 5AV5C 5B24A 4XZQC 4LD9B 3WA9D 3KXBA 1S32A 3AZFA 5AV9B 3AZLA 2HIOD 5BS7C 4H9NB 3WTPD 4HGAC 5JA4B 3A6NC 2NZDC 3AZJC 5CPJA 5B1MA 3VH6T 5AVCC 3C1CB 1P3LC 5GSUD 3REID 5BNVA 3LJAD 3KUYA 5G49A 3WA9C 3REKD 5GT3A 3C1BB 1F66D 2HIOC 3B6GA 3NQJB 5AV6B 3WTPC 2PYOA 5E5AB 4J8UB 2F8NH 3UTAA 4LD9C 1WWSA 5JRGA 1TZYA 3LELD 3C1BD 3B6FA 3B0DB 5AV9C 3UT9B 4H9RA 5AV6D 5E5AD 2F8NK 1JFIB 4J8UD 5GXQD 1KX3B 3LJAC 1HQ3B 5B40D 1P3BA 1P3MA 5B31A 5KDMA 5B32B 3C1CC 5CPID 5B31G 3B0CW 4H9PA 2YFWB 5BNXA 3C1BC 1KX5A 1KX4D 5AV6C 5E5AC 3MGSB 2CWEA 3UTBA 4J8UC 3AFAB 1AOIA 1M19B 5B2JB 5FUGA 3AYWB 5AV8B 1N1JA 4M6BA 1P3KB 3LZ1A 3B0DC 3UT9C 4H9SA 2NQBA 3MGSD 3AFAD 1EQZA 3R45B 1M19D 1KX3C 4J8XD 1HQ3C 5DNMA 1ZLAA 3AZHB 3AZEB 3B0BA 4H9QA 5B32C 4WU8B 2AROB 1H3OB 4QLCD 5BO0A 3KXBB 2FJ7A 3AZED 4KGCB 1M18A 4JJNA 2YFVA 3MGSC 4E45A 3KXBD 3AFAC 1S32D 3AZFD 4WU9A 1M19C 4J8XC 1F1EA 3AYWC 5AV8C 1P3KC 4KGCD 3REJB 5B33B 3REHB 5B1LA 1P34B 1P3AA 2BYKA 1KU5A 4UUZA 5CPJD 1ID3A 5B0ZA 3MVDA 5GT3B 1P3FB 3AZHC 4KHAA 3AZEC
chains in the Genus database with same CATH superfamily
4WV4B 1BH8B 5DNNB 3X1SB 4WU8C 2AROC 3WTPE 5F99A 3KXBC 3EG5B 5GT3D 4X23B 2F2AC 1P3FD 3MGQA 3V9RA 1Z2CB 2BG1A 4KGCC 3W96A 3WAAA 3UTAD 3FDDA 2W8SA 3AV1B 1P3OB 4J8WA 5JRGD 4XUJA 4X23D 1TZYD 4KUDA 3EPLA 4DRBA 3AZMA 3REJC 5B33C 3REHC 5CPKA 2CV5A 5B0YA 1ULYA 4H9OB 1P34C 3AV2B 1BH9A 3AV1D 1P3OD 1P3MD 5CP6A 5GT3C 4Z5TA 1P3FC 5BNXB 3X1VB 4ZUXA 2Y2HA 5B32G 3MGRA 3X1SC 4CAYA 3UTAC 1AOIB 5JRGC 4YS3B 3MGPB 4X23C 4Z2MH 3AZIA 3AZKA 3X1VD 1KX5D 2NQBB 5AY8A 3UTBD 2VQRA 5GSUB 4NE3A 3REIB 3AV1C 3LJAB 1P3OC 1AOID 1EQZB 4YS3D 3MGPD 3VH6A 3KFUG 3LZ1D 3AN2A 3REKB 1P3IA 2NQBD 1F66B 3AV2C 1EQZD 3X1TA 5DNMD 2Y2KA 2FJ7B 4YM6B 1ZLAD 3W98B 3LELB 3VH5T 4NE5A 3X1VC 5B2IA 3RELB 3O62A 3W97A 5GXQB 1AOIC 2FJ7D 4YM6D 5B40B 3W98D 4YS3C 3MGPC 3W99B 4Z2MG 3LZ1C 3RELD 5B1LB 4G92B 2NQBC 4JJND 5CPIB 5GSUC 3REIC 1EQZC 1Q9CA 4WU9D 5DNMC 4WNNA 3W99D 5C3IB 2BYMB 3REKC 1R4VA 5B1LD 1P3AD 1KX4B 1F66C 3WKJA 3X1UA 3TU4B 4DRAA 4Z66A 1ID3D 5B0ZD 5AV5A 2ZY5A 4YM6C 3KWQB 2FJ7C 2F8NA 3W98C 3LELC 3RELC 1M1AA 1WWIA 2JCHA 3TU4D 2F8NG 3NQUB 5F99D 4EO5B 5GXQC 4CSRA 4XUJB 4J8XB 3KWQD 4UPKA 3MGQD 5B40C 4KUDB 3W99C 2NZDA 3AZJA 3W96D 5CPKB 2XD5A 5B1LC 4G92C 5B0YB 3AZNB 3WAAD 5AVCA 1P3AC 5CPIC 2DQNC 1P3LA 2L5AA 4XUJD 4QLCB 3AZGA 4KUDD 5C3IC 5AVBA 3IP4C 5CPKD 2CV5D 5B0YD 3AZND 2IO5B 1KX4C 5B24B 2HIOA 4R8PA 3WTPA 3TU4C 2Y2NA 1S32B 5CP6D 3AZFB 1P3GA 4Z5TD 3KWQC 3AZLB 4LD9A 4ZUXD 5AV9A 2LY8A 5B24D 4H9NA 2ZY2A 5CPJB 5B1MB 4EO5C 4XUJC 3AZKD 1A7WA 5JA4A 3AZLD 4KUDC 1P3IB 5AY8D 5CPKC 5B0YC 3AZNC 5BNVB 3KUYB 5G49B 3C1CA 5B1MD 4QLCC 4NFTA 1P3ID 4AWLB 3B6GB 2PYOB 2IO5C 3KUYD 3X1TD 3C1BA 1U35A 5B24C 3UTAB 3NQJA 3VH6W 5E5AA 5JRGB 3AZFC 1S32C 1TZYB 4J8UA 3B6FB 3AZLC 3B6GD 4H9RB 2PYOD 5AY8C 3W97D 3B0CT 3UT9A 2HUEB 2J8PA 4WZSB 5CPJC 5B1MC 1P3BB 3EPHA 1P3MB 5B31B 1JFIA 5KDMB 3LZ0A 1KX3A 3B6FD 1HQ3A 1P3IC 3WKJB 3KUYC 5B32A 1P3BD 5B31D 3A1IA 3H0LC 4H9PB 4AWLC 1KX5B 3B6GC 3WKJD 2G5HC 2YFWA 1M1AB 2PYOC 3MNNA 3W97C 3UTBB 4Z66D 5AV5D 5FUGB 3MGSA 1N1JB 1B67A 1TZYC 3LZ1B 3B6FC 5B2JA 3AYWA 1M1AD 5AV8A 1P3KA 2HUEC 5GT0A 5DNMB 3AZGB 1P3BC 1P3MC 5B31C 5AVBB 3AZJD 2NZDD 1ZLAB 3KSYA 4H9QB 5CHLB 3AZHA 1P3LD 3WKJC 4R8PB 4G91B 3AZGD 5BO0B 4WU8A 5AVBD 4Z66C 1P3GB 2AROA 1H3OA 3VH5A 1BFMA 1M18B 2JSSA 2Y2IA 1KX5C 1M1AC 4R8PD 4JJNB 2YFVB 4KGCA 4NE6A 3UTBC 1P3GD 4WU9B 4LD9D 1M18D 4J8VA 4H9SC 4ZBJB 5AV9D 1P3AB 2BYKB 4UUZB 3REJA 5B33A 3REHA 1P34A 3AZGC 3EPJA 1ID3B 5B0ZB 5AVBC 3MVDB 1P3PA 1ZLAC 4KHAB 1P3FA 1U35B 3C1CD 4R8PC 4G91C 1BH8A 5DNNA 3X1SA 5F99B 3MVDD 1P3GC 1TAFA 3MGQB 4XZQA 3V9RB 1M18C 3W96B 4X23A 1U35D 3WAAB 5BS7A 4JJNC 4J8WB 4WU9C 3LZ0B 3AV1A 1P3OA 3A6NA 3AZMB 2CV5B 4ZBJC 3UT9D 1BH9B 4J8WD 4H9OA 3AV2A 3LZ0D 1KX3D 1ID3C 5CP6B 1HQ3D 5B0ZC 3MVDC 4Z5TB 3AZMD 4ZUXB 3WA9A 3MGRB 3MNNB 1U35C 5B32D 3X1VA 4CAYB 2Y2QA 5F99C 3AZKB 3MGQC 3AZIB 2Y2GA 3MGRD 4YS3A 3W96C 5AY8B 3MGPA 3MNND 3WAAC 2JE5A 5GT0B 3H0RC 5BT1D 4J8WC 5GSUA 3REIA 3LZ0C 3AZID 3LJAA 5B2JD 3AN2B 3AYWD 5AV8D 2RVQD 3AZMC 1P3KD 2CV5C 2ZY4A 3REKA 3X1TB 5GT0D 1F66A 3AN2D 5CP6C 4Z5TC 3H0MC 4YM6A 5B2IB 4ZUXC 3O62B 3AZHD 3MGRC 3W98A 3MNNC 3LELA 3W97B 4WU8D 3RELA 5AV6A 2AROD 5BT1C 5GXQA 3AZKC 4J8VB 3AZIC 1T3UA 5B2JC 5B2ID 5B40A 3O62D 3W99A 2RVQC 5GT0C 1B6WA 4WNNB 5CPIA 1P3PB 3VH5W 4J8VD 3AN2C 2RIQA 2BYMA 3REJD 5B33D 3REHD 3X1TC 3A1KA 2UWXA 3X1UB 1P34D 2Y2JA 1KX4A 4Z66B 2DF4C 1P3PD 1TAFB 4E44A 5AV5B 2F8NB 4XZQB 3TU4A 3KWQA 2Y2PA 5B2IC 3P5JB 3O62C 3X1UD 4HGAB 5DNND 3X1SD 4CSRB 1HTAA 2F8ND 4XZQD 3A6NB 2NZDB 3NQUA 3AZJB 3AFAA 1M19A 4J8VC 4J8XA 5AVCB 1P3LB 3AZNA 3A6ND 1P3PC 3R45A 4QLCA 3WA9B 5AVCD 3AZEA 4DQYB 2HIOB 3WTPB 3X1UC 3AV2D 5DNNC 5AV5C 5B24A 4XZQC 4WJ3C 4LD9B 3WA9D 3KXBA 1S32A 3AZFA 5AV9B 3AZLA 2HIOD 5BS7C 4H9NB 3WTPD 4HGAC 5JA4B 3A6NC 2NZDC 3AZJC 5CPJA 5B1MA 3VH6T 5AVCC 3C1CB 1P3LC 5GSUD 3REID 5BNVA 3LJAD 3KUYA 5G49A 3AL0C 3WA9C 3REKD 5GT3A 3C1BB 1F66D 2HIOC 3B6GA 3NQJB 5AV6B 3WTPC 2PYOA 5E5AB 4J8UB 2F8NH 3UTAA 2XD1A 4LD9C 1WWSA 5JRGA 1TZYA 3LELD 3C1BD 3B6FA 3B0DB 5AV9C 3UT9B 2Y2MA 4H9RA 5AV6D 5E5AD 2F8NK 1JFIB 4J8UD 5GXQD 1KX3B 3LJAC 1HQ3B 5B40D 1P3BA 1P3MA 5B31A 5KDMA 5B32B 3C1CC 5CPID 5B31G 3F6TA 3B0CW 4H9PA 2YFWB 5BNXA 3C1BC 1KX5A 1KX4D 5AV6C 5E5AC 3MGSB 2CWEA 3UTBA 4J8UC 3AFAB 1AOIA 1M19B 5B2JB 2G5IC 5FUGA 3AYWB 5AV8B 1N1JA 4M6BA 1P3KB 3LZ1A 3B0DC 3UT9C 4H9SA 2NQBA 3MGSD 2Y2OA 3AFAD 1EQZA 3R45B 1M19D 1KX3C 4J8XD 1HQ3C 5DNMA 1PZRA 2ZY3A 3AZHB 1ZLAA 3AZEB 3B0BA 4H9QA 5B32C 4WU8B 2AROB 1H3OB 4QLCD 5BO0A 3KXBB 2FJ7A 3AZED 2ZM5A 2FFFB 4KGCB 1M18A 4JJNA 2YFVA 3MGSC 4E45A 3KXBD 3AFAC 1S32D 3AZFD 4WU9A 1M19C 4J8XC 1F1EA 3AYWC 5AV8C 1P3KC 4KGCD 3REJB 5B33B 3REHB 5B1LA 1P34B 1P3AA 2BYKA 1KU5A 4UUZA 5CPJD 1W2EA 2Y2LA 1ID3A 5B0ZA 3MVDA 5GT3B 3EPKA 1P3FB 3AZHC 4KHAA 3AZEC
chains in the Genus database with same CATH topology
4WV4B 1BH8B 5DNNB 3X1SB 4WU8C 2AROC 3WTPE 5F99A 3KXBC 3EG5B 5GT3D 4X23B 2F2AC 1P3FD 3MGQA 3V9RA 1Z2CB 2BG1A 4KGCC 3W96A 3WAAA 3UTAD 3FDDA 2W8SA 3AV1B 1P3OB 4J8WA 5JRGD 4XUJA 4X23D 1TZYD 4KUDA 3EPLA 4DRBA 3AZMA 3REJC 5B33C 3REHC 5CPKA 2CV5A 5B0YA 1ULYA 4H9OB 1P34C 3AV2B 1BH9A 3AV1D 1P3OD 1P3MD 5CP6A 5GT3C 4Z5TA 1P3FC 5BNXB 3X1VB 4ZUXA 2Y2HA 5B32G 3MGRA 3X1SC 4CAYA 3UTAC 1AOIB 5JRGC 4YS3B 3MGPB 4X23C 4Z2MH 3AZIA 3AZKA 3X1VD 1KX5D 2NQBB 5AY8A 3UTBD 2VQRA 5GSUB 4NE3A 3REIB 3AV1C 3LJAB 1P3OC 1AOID 1EQZB 4YS3D 3MGPD 3VH6A 3KFUG 3LZ1D 3AN2A 3REKB 1P3IA 2NQBD 1F66B 3AV2C 1EQZD 3X1TA 5DNMD 2Y2KA 2FJ7B 4YM6B 1ZLAD 3W98B 3LELB 3VH5T 4NE5A 3X1VC 5B2IA 3RELB 3O62A 3W97A 5GXQB 1AOIC 2FJ7D 4YM6D 5B40B 3W98D 4YS3C 3MGPC 3W99B 4Z2MG 3LZ1C 3RELD 5B1LB 4G92B 2NQBC 4JJND 5CPIB 5GSUC 3REIC 1EQZC 1Q9CA 4WU9D 5DNMC 4WNNA 3W99D 5C3IB 2BYMB 3REKC 1R4VA 5B1LD 1P3AD 1KX4B 1F66C 3WKJA 3X1UA 3TU4B 4DRAA 4Z66A 1ID3D 5B0ZD 5AV5A 2ZY5A 4YM6C 3KWQB 2FJ7C 2F8NA 3W98C 3LELC 3RELC 1M1AA 1WWIA 2JCHA 3TU4D 2F8NG 3NQUB 5F99D 4EO5B 5GXQC 4CSRA 4XUJB 4J8XB 3KWQD 4UPKA 3MGQD 5B40C 4KUDB 3W99C 2NZDA 3AZJA 3W96D 5CPKB 2XD5A 5B1LC 4G92C 5B0YB 3AZNB 3WAAD 5AVCA 1P3AC 5CPIC 2DQNC 1P3LA 2L5AA 4XUJD 4QLCB 3AZGA 4KUDD 5C3IC 5AVBA 3IP4C 5CPKD 2CV5D 5B0YD 3AZND 2IO5B 1KX4C 5B24B 2HIOA 4R8PA 3WTPA 3TU4C 2Y2NA 1S32B 5CP6D 3AZFB 1P3GA 4Z5TD 3KWQC 3AZLB 4LD9A 4ZUXD 5AV9A 2LY8A 5B24D 4H9NA 2ZY2A 5CPJB 5B1MB 4EO5C 4XUJC 3AZKD 1A7WA 5JA4A 3AZLD 4KUDC 1P3IB 5AY8D 5CPKC 5B0YC 3AZNC 5BNVB 3KUYB 5G49B 3C1CA 5B1MD 4QLCC 4NFTA 1P3ID 4AWLB 3B6GB 2PYOB 2IO5C 3KUYD 3X1TD 3C1BA 1U35A 5B24C 3UTAB 3NQJA 3VH6W 5E5AA 5JRGB 3AZFC 1S32C 1TZYB 4J8UA 3B6FB 3AZLC 3B6GD 4H9RB 2PYOD 5AY8C 3W97D 3B0CT 3UT9A 2HUEB 2J8PA 4WZSB 5CPJC 5B1MC 1P3BB 3EPHA 1P3MB 5B31B 1JFIA 5KDMB 3LZ0A 1KX3A 3B6FD 1HQ3A 1P3IC 3WKJB 3KUYC 5B32A 1P3BD 5B31D 3A1IA 3H0LC 4H9PB 4AWLC 1KX5B 3B6GC 3WKJD 2G5HC 2YFWA 1M1AB 2PYOC 3MNNA 3W97C 3UTBB 4Z66D 5AV5D 5FUGB 3MGSA 1N1JB 1B67A 1TZYC 3LZ1B 3B6FC 5B2JA 3AYWA 1M1AD 5AV8A 1P3KA 2HUEC 5GT0A 5DNMB 3AZGB 1P3BC 1P3MC 5B31C 5AVBB 3AZJD 2NZDD 1ZLAB 3KSYA 4H9QB 5CHLB 3AZHA 1P3LD 3WKJC 4R8PB 4G91B 3AZGD 5BO0B 4WU8A 5AVBD 4Z66C 1P3GB 2AROA 1H3OA 3VH5A 1BFMA 1M18B 2JSSA 2Y2IA 1KX5C 1M1AC 4R8PD 4JJNB 2YFVB 4KGCA 4NE6A 3UTBC 1P3GD 4WU9B 4LD9D 1M18D 4J8VA 4H9SC 4ZBJB 5AV9D 1P3AB 2BYKB 4UUZB 3REJA 5B33A 3REHA 1P34A 3AZGC 3EPJA 1ID3B 5B0ZB 5AVBC 3MVDB 1P3PA 1ZLAC 4KHAB 1P3FA 1U35B 3C1CD 4R8PC 4G91C 1BH8A 5DNNA 3X1SA 5F99B 3MVDD 1P3GC 1TAFA 3MGQB 4XZQA 3V9RB 1M18C 3W96B 4X23A 1U35D 3WAAB 5BS7A 4JJNC 4J8WB 4WU9C 3LZ0B 3AV1A 1P3OA 3A6NA 3AZMB 2CV5B 4ZBJC 3UT9D 1BH9B 4J8WD 4H9OA 3AV2A 3LZ0D 1KX3D 1ID3C 5CP6B 1HQ3D 5B0ZC 3MVDC 4Z5TB 3AZMD 4ZUXB 3WA9A 3MGRB 3MNNB 1U35C 5B32D 3X1VA 4CAYB 2Y2QA 5F99C 3AZKB 3MGQC 3AZIB 2Y2GA 3MGRD 4YS3A 3W96C 5AY8B 3MGPA 3MNND 3WAAC 2JE5A 5GT0B 3H0RC 5BT1D 4J8WC 5GSUA 3REIA 3LZ0C 3AZID 3LJAA 5B2JD 3AN2B 3AYWD 5AV8D 2RVQD 3AZMC 1P3KD 2CV5C 2ZY4A 3REKA 3X1TB 5GT0D 1F66A 3AN2D 5CP6C 4Z5TC 3H0MC 4YM6A 5B2IB 4ZUXC 3O62B 3AZHD 3MGRC 3W98A 3MNNC 3LELA 3W97B 4WU8D 3RELA 5AV6A 2AROD 5BT1C 5GXQA 3AZKC 4J8VB 3AZIC 1T3UA 5B2JC 5B2ID 5B40A 3O62D 3W99A 2RVQC 5GT0C 1B6WA 4WNNB 5CPIA 1P3PB 3VH5W 4J8VD 3AN2C 2RIQA 2BYMA 3REJD 5B33D 3REHD 3X1TC 3A1KA 2UWXA 3X1UB 1P34D 2Y2JA 1KX4A 4Z66B 2DF4C 1P3PD 1TAFB 4E44A 5AV5B 2F8NB 4XZQB 3TU4A 3KWQA 2Y2PA 5B2IC 3P5JB 3O62C 3X1UD 4HGAB 5DNND 3X1SD 4CSRB 1HTAA 2F8ND 4XZQD 3A6NB 2NZDB 3NQUA 3AZJB 3AFAA 1M19A 4J8VC 4J8XA 5AVCB 1P3LB 3AZNA 3A6ND 1P3PC 3R45A 4QLCA 3WA9B 5AVCD 3AZEA 4DQYB 2HIOB 3WTPB 3X1UC 3AV2D 5DNNC 5AV5C 5B24A 4XZQC 4WJ3C 4LD9B 3WA9D 3KXBA 1S32A 3AZFA 5AV9B 3AZLA 2HIOD 5BS7C 4H9NB 3WTPD 4HGAC 5JA4B 3A6NC 2NZDC 3AZJC 5CPJA 5B1MA 3VH6T 5AVCC 3C1CB 1P3LC 5GSUD 3REID 5BNVA 3LJAD 3KUYA 5G49A 3AL0C 3WA9C 3REKD 5GT3A 3C1BB 1F66D 2HIOC 3B6GA 3NQJB 5AV6B 3WTPC 2PYOA 5E5AB 4J8UB 2F8NH 3UTAA 2XD1A 4LD9C 1WWSA 5JRGA 1TZYA 3LELD 3C1BD 3B6FA 3B0DB 5AV9C 3UT9B 2Y2MA 4H9RA 5AV6D 5E5AD 2F8NK 1JFIB 4J8UD 5GXQD 1KX3B 3LJAC 1HQ3B 5B40D 1P3BA 1P3MA 5B31A 5KDMA 5B32B 3C1CC 5CPID 5B31G 3F6TA 3B0CW 4H9PA 2YFWB 5BNXA 3C1BC 1KX5A 1KX4D 5AV6C 5E5AC 3MGSB 2CWEA 3UTBA 4J8UC 3AFAB 1AOIA 1M19B 5B2JB 2G5IC 5FUGA 3AYWB 5AV8B 1N1JA 4M6BA 1P3KB 3LZ1A 3B0DC 3UT9C 4H9SA 2NQBA 3MGSD 2Y2OA 3AFAD 1EQZA 3R45B 1M19D 1KX3C 4J8XD 1HQ3C 5DNMA 1PZRA 2ZY3A 3AZHB 1ZLAA 3AZEB 3B0BA 4H9QA 5B32C 4WU8B 2AROB 1H3OB 4QLCD 5BO0A 3KXBB 2FJ7A 3AZED 2ZM5A 2FFFB 4KGCB 1M18A 4JJNA 2YFVA 3MGSC 4E45A 3KXBD 3AFAC 1S32D 3AZFD 4WU9A 1M19C 4J8XC 1F1EA 3AYWC 5AV8C 1P3KC 4KGCD 3REJB 5B33B 3REHB 5B1LA 1P34B 1P3AA 2BYKA 1KU5A 4UUZA 5CPJD 1W2EA 2Y2LA 1ID3A 5B0ZA 3MVDA 5GT3B 3EPKA 1P3FB 3AZHC 4KHAA 3AZEC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WV4 B;  1BH8 B;  5DNN B;  3X1S B;  4WU8 C;  2ARO C;  3WTP E;  5F99 A;  3KXB C;  5GT3 D;  4X23 B;  1P3F D;  3MGQ A;  3V9R A;  4KGC C;  3W96 A;  3WAA A;  3UTA D;  3AV1 B;  1P3O B;  4J8W A;  5JRG D;  4XUJ A;  4X23 D;  1TZY D;  4KUD A;  4DRB A;  3AZM A;  3REJ C;  5B33 C;  3REH C;  5CPK A;  2CV5 A;  5B0Y A;  1ULY A;  4H9O B;  1P34 C;  3AV2 B;  1BH9 A;  3AV1 D;  1P3O D;  1P3M D;  5CP6 A;  5GT3 C;  4Z5T A;  1P3F C;  5BNX B;  3X1V B;  4ZUX A;  5B32 G;  3MGR A;  3X1S C;  4CAY A;  3UTA C;  1AOI B;  5JRG C;  4YS3 B;  3MGP B;  4X23 C;  4Z2M H;  3AZI A;  3AZK A;  3X1V D;  1KX5 D;  2NQB B;  5AY8 A;  3UTB D;  5GSU B;  4NE3 A;  3REI B;  3AV1 C;  3LJA B;  1P3O C;  1AOI D;  1EQZ B;  4YS3 D;  3MGP D;  3VH6 A;  3LZ1 D;  3AN2 A;  3REK B;  1P3I A;  2NQB D;  1F66 B;  3AV2 C;  1EQZ D;  3X1T A;  5DNM D;  2FJ7 B;  4YM6 B;  1ZLA D;  3W98 B;  3LEL B;  3VH5 T;  4NE5 A;  3X1V C;  5B2I A;  3REL B;  3O62 A;  3W97 A;  5GXQ B;  1AOI C;  2FJ7 D;  4YM6 D;  5B40 B;  3W98 D;  4YS3 C;  3MGP C;  3W99 B;  4Z2M G;  3LZ1 C;  3REL D;  5B1L B;  4G92 B;  2NQB C;  4JJN D;  5CPI B;  5GSU C;  3REI C;  1EQZ C;  1Q9C A;  4WU9 D;  5DNM C;  4WNN A;  3W99 D;  5C3I B;  2BYM B;  3REK C;  1R4V A;  5B1L D;  1P3A D;  1KX4 B;  1F66 C;  3WKJ A;  3X1U A;  3TU4 B;  4DRA A;  4Z66 A;  1ID3 D;  5B0Z D;  5AV5 A;  2FJ7 C;  4YM6 C;  3KWQ B;  2F8N A;  3W98 C;  3LEL C;  3REL C;  1M1A A;  1WWI A;  3TU4 D;  2F8N G;  3NQU B;  5F99 D;  4EO5 B;  5GXQ C;  4CSR A;  4XUJ B;  4J8X B;  3KWQ D;  3MGQ D;  5B40 C;  4KUD B;  3W99 C;  2NZD A;  3AZJ A;  3W96 D;  5CPK B;  5B1L C;  4G92 C;  5B0Y B;  3AZN B;  3WAA D;  5AVC A;  1P3A C;  5CPI C;  1P3L A;  2L5A A;  4XUJ D;  4QLC B;  3AZG A;  4KUD D;  5C3I C;  5AVB A;  5CPK D;  2CV5 D;  5B0Y D;  3AZN D;  2IO5 B;  1KX4 C;  5B24 B;  2HIO A;  4R8P A;  3WTP A;  3TU4 C;  1S32 B;  5CP6 D;  3AZF B;  1P3G A;  4Z5T D;  3KWQ C;  3AZL B;  4LD9 A;  4ZUX D;  5AV9 A;  2LY8 A;  5B24 D;  4H9N A;  5CPJ B;  5B1M B;  4EO5 C;  4XUJ C;  3AZK D;  1A7W A;  5JA4 A;  3AZL D;  4KUD C;  1P3I B;  5AY8 D;  5CPK C;  5B0Y C;  3AZN C;  5BNV B;  3KUY B;  5G49 B;  3C1C A;  5B1M D;  4QLC C;  4NFT A;  1P3I D;  4AWL B;  3B6G B;  2PYO B;  2IO5 C;  3KUY D;  3X1T D;  3C1B A;  1U35 A;  5B24 C;  3UTA B;  3NQJ A;  3VH6 W;  5E5A A;  5JRG B;  3AZF C;  1S32 C;  1TZY B;  4J8U A;  3B6F B;  3AZL C;  3B6G D;  4H9R B;  2PYO D;  5AY8 C;  3W97 D;  3B0C T;  3UT9 A;  2HUE B;  4WZS B;  5CPJ C;  5B1M C;  1P3B B;  1P3M B;  5B31 B;  1JFI A;  5KDM B;  3LZ0 A;  1KX3 A;  3B6F D;  1HQ3 A;  1P3I C;  3WKJ B;  3KUY C;  5B32 A;  1P3B D;  5B31 D;  4H9P B;  4AWL C;  1KX5 B;  3B6G C;  3WKJ D;  2YFW A;  1M1A B;  2PYO C;  3MNN A;  3W97 C;  3UTB B;  4Z66 D;  5AV5 D;  5FUG B;  3MGS A;  1N1J B;  1B67 A;  1TZY C;  3LZ1 B;  3B6F C;  5B2J A;  3AYW A;  1M1A D;  5AV8 A;  1P3K A;  2HUE C;  5GT0 A;  5DNM B;  3AZG B;  1P3B C;  1P3M C;  5B31 C;  5AVB B;  3AZJ D;  2NZD D;  1ZLA B;  3KSY A;  4H9Q B;  5CHL B;  3AZH A;  1P3L D;  3WKJ C;  4R8P B;  4G91 B;  3AZG D;  4Z66 C;  4WU8 A;  5BO0 B;  5AVB D;  1P3G B;  2ARO A;  1H3O A;  3VH5 A;  1BFM A;  1M18 B;  2JSS A;  1KX5 C;  1M1A C;  4R8P D;  4JJN B;  2YFV B;  4KGC A;  4NE6 A;  3UTB C;  1P3G D;  4WU9 B;  4LD9 D;  1M18 D;  4J8V A;  4H9S C;  4ZBJ B;  5AV9 D;  1P3A B;  2BYK B;  4UUZ B;  3REJ A;  5B33 A;  3REH A;  1P34 A;  3AZG C;  1ID3 B;  5B0Z B;  5AVB C;  3MVD B;  1P3P A;  1ZLA C;  4KHA B;  1P3F A;  1U35 B;  3C1C D;  4R8P C;  4G91 C;  1BH8 A;  5DNN A;  3X1S A;  5F99 B;  3MVD D;  1P3G C;  1TAF A;  3MGQ B;  4XZQ A;  3V9R B;  1M18 C;  3W96 B;  4X23 A;  1U35 D;  3WAA B;  5BS7 A;  4JJN C;  4J8W B;  4WU9 C;  3LZ0 B;  3AV1 A;  1P3O A;  3A6N A;  3AZM B;  2CV5 B;  4ZBJ C;  3UT9 D;  1BH9 B;  4J8W D;  4H9O A;  3AV2 A;  3LZ0 D;  1KX3 D;  1ID3 C;  5CP6 B;  1HQ3 D;  5B0Z C;  3MVD C;  4Z5T B;  3AZM D;  4ZUX B;  3WA9 A;  3MGR B;  3MNN B;  1U35 C;  5B32 D;  3X1V A;  4CAY B;  5F99 C;  3AZK B;  3MGQ C;  3AZI B;  3MGR D;  4YS3 A;  3W96 C;  5AY8 B;  3MGP A;  3MNN D;  3WAA C;  5GT0 B;  5BT1 D;  4J8W C;  5GSU A;  3REI A;  3LZ0 C;  3AZI D;  3LJA A;  5B2J D;  3AN2 B;  3AYW D;  5AV8 D;  2RVQ D;  3AZM C;  1P3K D;  2CV5 C;  3REK A;  3X1T B;  5GT0 D;  1F66 A;  3AN2 D;  5CP6 C;  4Z5T C;  4YM6 A;  5B2I B;  4ZUX C;  3O62 B;  3AZH D;  3MGR C;  3W98 A;  3MNN C;  3LEL A;  3W97 B;  4WU8 D;  3REL A;  5AV6 A;  2ARO D;  5BT1 C;  5GXQ A;  3AZK C;  4J8V B;  3AZI C;  5B2J C;  5B2I D;  5B40 A;  3O62 D;  3W99 A;  2RVQ C;  5GT0 C;  1B6W A;  4WNN B;  5CPI A;  1P3P B;  3VH5 W;  4J8V D;  3AN2 C;  2BYM A;  3REJ D;  5B33 D;  3REH D;  3X1T C;  1P34 D;  3X1U B;  1KX4 A;  4Z66 B;  1P3P D;  1TAF B;  4E44 A;  5AV5 B;  2F8N B;  4XZQ B;  3TU4 A;  3KWQ A;  5B2I C;  3O62 C;  3X1U D;  4HGA B;  5DNN D;  3X1S D;  4CSR B;  1HTA A;  2F8N D;  4XZQ D;  3A6N B;  2NZD B;  3NQU A;  3AZJ B;  3AFA A;  1M19 A;  4J8V C;  4J8X A;  5AVC B;  1P3L B;  3AZN A;  3A6N D;  1P3P C;  3R45 A;  4QLC A;  3WA9 B;  5AVC D;  3AZE A;  2HIO B;  3WTP B;  3X1U C;  3AV2 D;  5DNN C;  5AV5 C;  5B24 A;  4XZQ C;  4LD9 B;  3WA9 D;  3KXB A;  1S32 A;  3AZF A;  5AV9 B;  3AZL A;  2HIO D;  5BS7 C;  4H9N B;  3WTP D;  4HGA C;  5JA4 B;  3A6N C;  2NZD C;  3AZJ C;  5CPJ A;  5B1M A;  3VH6 T;  5AVC C;  3C1C B;  1P3L C;  5GSU D;  3REI D;  5BNV A;  3LJA D;  3KUY A;  5G49 A;  3WA9 C;  3REK D;  5GT3 A;  3C1B B;  1F66 D;  2HIO C;  3B6G A;  3NQJ B;  5AV6 B;  3WTP C;  2PYO A;  5E5A B;  4J8U B;  2F8N H;  3UTA A;  4LD9 C;  1WWS A;  5JRG A;  1TZY A;  3LEL D;  3C1B D;  3B6F A;  3B0D B;  5AV9 C;  3UT9 B;  4H9R A;  5AV6 D;  5E5A D;  2F8N K;  1JFI B;  4J8U D;  5GXQ D;  1KX3 B;  3LJA C;  1HQ3 B;  5B40 D;  1P3B A;  1P3M A;  5B31 A;  5KDM A;  5B32 B;  3C1C C;  5CPI D;  5B31 G;  3B0C W;  4H9P A;  2YFW B;  5BNX A;  3C1B C;  1KX5 A;  1KX4 D;  5AV6 C;  5E5A C;  3MGS B;  2CWE A;  3UTB A;  4J8U C;  3AFA B;  1AOI A;  1M19 B;  5B2J B;  5FUG A;  3AYW B;  5AV8 B;  1N1J A;  4M6B A;  1P3K B;  3LZ1 A;  3B0D C;  3UT9 C;  4H9S A;  2NQB A;  3MGS D;  3AFA D;  1EQZ A;  3R45 B;  1M19 D;  1KX3 C;  4J8X D;  1HQ3 C;  5DNM A;  1ZLA A;  3AZH B;  3AZE B;  3B0B A;  4H9Q A;  5B32 C;  4WU8 B;  2ARO B;  1H3O B;  4QLC D;  5BO0 A;  3KXB B;  2FJ7 A;  3AZE D;  4KGC B;  1M18 A;  4JJN A;  2YFV A;  3MGS C;  4E45 A;  3KXB D;  3AFA C;  1S32 D;  3AZF D;  4WU9 A;  1M19 C;  4J8X C;  1F1E A;  3AYW C;  5AV8 C;  1P3K C;  4KGC D;  3REJ B;  5B33 B;  3REH B;  5B1L A;  1P34 B;  1P3A A;  2BYK A;  1KU5 A;  4UUZ A;  5CPJ D;  1ID3 A;  5B0Z A;  3MVD A;  5GT3 B;  1P3F B;  3AZH C;  4KHA A;  3AZE C; 
#chains in the Genus database with same CATH topology
 4WV4 B;  1BH8 B;  5DNN B;  3X1S B;  4WU8 C;  2ARO C;  3WTP E;  5F99 A;  3KXB C;  3EG5 B;  5GT3 D;  4X23 B;  2F2A C;  1P3F D;  3MGQ A;  3V9R A;  1Z2C B;  2BG1 A;  4KGC C;  3W96 A;  3WAA A;  3UTA D;  3FDD A;  2W8S A;  3AV1 B;  1P3O B;  4J8W A;  5JRG D;  4XUJ A;  4X23 D;  1TZY D;  4KUD A;  3EPL A;  4DRB A;  3AZM A;  3REJ C;  5B33 C;  3REH C;  5CPK A;  2CV5 A;  5B0Y A;  1ULY A;  4H9O B;  1P34 C;  3AV2 B;  1BH9 A;  3AV1 D;  1P3O D;  1P3M D;  5CP6 A;  5GT3 C;  4Z5T A;  1P3F C;  5BNX B;  3X1V B;  4ZUX A;  2Y2H A;  5B32 G;  3MGR A;  3X1S C;  4CAY A;  3UTA C;  1AOI B;  5JRG C;  4YS3 B;  3MGP B;  4X23 C;  4Z2M H;  3AZI A;  3AZK A;  3X1V D;  1KX5 D;  2NQB B;  5AY8 A;  3UTB D;  2VQR A;  5GSU B;  4NE3 A;  3REI B;  3AV1 C;  3LJA B;  1P3O C;  1AOI D;  1EQZ B;  4YS3 D;  3MGP D;  3VH6 A;  3KFU G;  3LZ1 D;  3AN2 A;  3REK B;  1P3I A;  2NQB D;  1F66 B;  3AV2 C;  1EQZ D;  3X1T A;  5DNM D;  2Y2K A;  2FJ7 B;  4YM6 B;  1ZLA D;  3W98 B;  3LEL B;  3VH5 T;  4NE5 A;  3X1V C;  5B2I A;  3REL B;  3O62 A;  3W97 A;  5GXQ B;  1AOI C;  2FJ7 D;  4YM6 D;  5B40 B;  3W98 D;  4YS3 C;  3MGP C;  3W99 B;  4Z2M G;  3LZ1 C;  3REL D;  5B1L B;  4G92 B;  2NQB C;  4JJN D;  5CPI B;  5GSU C;  3REI C;  1EQZ C;  1Q9C A;  4WU9 D;  5DNM C;  4WNN A;  3W99 D;  5C3I B;  2BYM B;  3REK C;  1R4V A;  5B1L D;  1P3A D;  1KX4 B;  1F66 C;  3WKJ A;  3X1U A;  3TU4 B;  4DRA A;  4Z66 A;  1ID3 D;  5B0Z D;  5AV5 A;  2ZY5 A;  4YM6 C;  3KWQ B;  2FJ7 C;  2F8N A;  3W98 C;  3LEL C;  3REL C;  1M1A A;  1WWI A;  2JCH A;  3TU4 D;  2F8N G;  3NQU B;  5F99 D;  4EO5 B;  5GXQ C;  4CSR A;  4XUJ B;  4J8X B;  3KWQ D;  4UPK A;  3MGQ D;  5B40 C;  4KUD B;  3W99 C;  2NZD A;  3AZJ A;  3W96 D;  5CPK B;  2XD5 A;  5B1L C;  4G92 C;  5B0Y B;  3AZN B;  3WAA D;  5AVC A;  1P3A C;  5CPI C;  2DQN C;  1P3L A;  2L5A A;  4XUJ D;  4QLC B;  3AZG A;  4KUD D;  5C3I C;  5AVB A;  3IP4 C;  5CPK D;  2CV5 D;  5B0Y D;  3AZN D;  2IO5 B;  1KX4 C;  5B24 B;  2HIO A;  4R8P A;  3WTP A;  3TU4 C;  2Y2N A;  1S32 B;  5CP6 D;  3AZF B;  1P3G A;  4Z5T D;  3KWQ C;  3AZL B;  4LD9 A;  4ZUX D;  5AV9 A;  2LY8 A;  5B24 D;  4H9N A;  2ZY2 A;  5CPJ B;  5B1M B;  4EO5 C;  4XUJ C;  3AZK D;  1A7W A;  5JA4 A;  3AZL D;  4KUD C;  1P3I B;  5AY8 D;  5CPK C;  5B0Y C;  3AZN C;  5BNV B;  3KUY B;  5G49 B;  3C1C A;  5B1M D;  4QLC C;  4NFT A;  1P3I D;  4AWL B;  3B6G B;  2PYO B;  2IO5 C;  3KUY D;  3X1T D;  3C1B A;  1U35 A;  5B24 C;  3UTA B;  3NQJ A;  3VH6 W;  5E5A A;  5JRG B;  3AZF C;  1S32 C;  1TZY B;  4J8U A;  3B6F B;  3AZL C;  3B6G D;  4H9R B;  2PYO D;  5AY8 C;  3W97 D;  3B0C T;  3UT9 A;  2HUE B;  2J8P A;  4WZS B;  5CPJ C;  5B1M C;  1P3B B;  3EPH A;  1P3M B;  5B31 B;  1JFI A;  5KDM B;  3LZ0 A;  1KX3 A;  3B6F D;  1HQ3 A;  1P3I C;  3WKJ B;  3KUY C;  5B32 A;  1P3B D;  5B31 D;  3A1I A;  3H0L C;  4H9P B;  4AWL C;  1KX5 B;  3B6G C;  3WKJ D;  2G5H C;  2YFW A;  1M1A B;  2PYO C;  3MNN A;  3W97 C;  3UTB B;  4Z66 D;  5AV5 D;  5FUG B;  3MGS A;  1N1J B;  1B67 A;  1TZY C;  3LZ1 B;  3B6F C;  5B2J A;  3AYW A;  1M1A D;  5AV8 A;  1P3K A;  2HUE C;  5GT0 A;  5DNM B;  3AZG B;  1P3B C;  1P3M C;  5B31 C;  5AVB B;  3AZJ D;  2NZD D;  1ZLA B;  3KSY A;  4H9Q B;  5CHL B;  3AZH A;  1P3L D;  3WKJ C;  4R8P B;  4G91 B;  3AZG D;  5BO0 B;  4WU8 A;  5AVB D;  4Z66 C;  1P3G B;  2ARO A;  1H3O A;  3VH5 A;  1BFM A;  1M18 B;  2JSS A;  2Y2I A;  1KX5 C;  1M1A C;  4R8P D;  4JJN B;  2YFV B;  4KGC A;  4NE6 A;  3UTB C;  1P3G D;  4WU9 B;  4LD9 D;  1M18 D;  4J8V A;  4H9S C;  4ZBJ B;  5AV9 D;  1P3A B;  2BYK B;  4UUZ B;  3REJ A;  5B33 A;  3REH A;  1P34 A;  3AZG C;  3EPJ A;  1ID3 B;  5B0Z B;  5AVB C;  3MVD B;  1P3P A;  1ZLA C;  4KHA B;  1P3F A;  1U35 B;  3C1C D;  4R8P C;  4G91 C;  1BH8 A;  5DNN A;  3X1S A;  5F99 B;  3MVD D;  1P3G C;  1TAF A;  3MGQ B;  4XZQ A;  3V9R B;  1M18 C;  3W96 B;  4X23 A;  1U35 D;  3WAA B;  5BS7 A;  4JJN C;  4J8W B;  4WU9 C;  3LZ0 B;  3AV1 A;  1P3O A;  3A6N A;  3AZM B;  2CV5 B;  4ZBJ C;  3UT9 D;  1BH9 B;  4J8W D;  4H9O A;  3AV2 A;  3LZ0 D;  1KX3 D;  1ID3 C;  5CP6 B;  1HQ3 D;  5B0Z C;  3MVD C;  4Z5T B;  3AZM D;  4ZUX B;  3WA9 A;  3MGR B;  3MNN B;  1U35 C;  5B32 D;  3X1V A;  4CAY B;  2Y2Q A;  5F99 C;  3AZK B;  3MGQ C;  3AZI B;  2Y2G A;  3MGR D;  4YS3 A;  3W96 C;  5AY8 B;  3MGP A;  3MNN D;  3WAA C;  2JE5 A;  5GT0 B;  3H0R C;  5BT1 D;  4J8W C;  5GSU A;  3REI A;  3LZ0 C;  3AZI D;  3LJA A;  5B2J D;  3AN2 B;  3AYW D;  5AV8 D;  2RVQ D;  3AZM C;  1P3K D;  2CV5 C;  2ZY4 A;  3REK A;  3X1T B;  5GT0 D;  1F66 A;  3AN2 D;  5CP6 C;  4Z5T C;  3H0M C;  4YM6 A;  5B2I B;  4ZUX C;  3O62 B;  3AZH D;  3MGR C;  3W98 A;  3MNN C;  3LEL A;  3W97 B;  4WU8 D;  3REL A;  5AV6 A;  2ARO D;  5BT1 C;  5GXQ A;  3AZK C;  4J8V B;  3AZI C;  1T3U A;  5B2J C;  5B2I D;  5B40 A;  3O62 D;  3W99 A;  2RVQ C;  5GT0 C;  1B6W A;  4WNN B;  5CPI A;  1P3P B;  3VH5 W;  4J8V D;  3AN2 C;  2RIQ A;  2BYM A;  3REJ D;  5B33 D;  3REH D;  3X1T C;  3A1K A;  2UWX A;  3X1U B;  1P34 D;  2Y2J A;  1KX4 A;  4Z66 B;  2DF4 C;  1P3P D;  1TAF B;  4E44 A;  5AV5 B;  2F8N B;  4XZQ B;  3TU4 A;  3KWQ A;  2Y2P A;  5B2I C;  3P5J B;  3O62 C;  3X1U D;  4HGA B;  5DNN D;  3X1S D;  4CSR B;  1HTA A;  2F8N D;  4XZQ D;  3A6N B;  2NZD B;  3NQU A;  3AZJ B;  3AFA A;  1M19 A;  4J8V C;  4J8X A;  5AVC B;  1P3L B;  3AZN A;  3A6N D;  1P3P C;  3R45 A;  4QLC A;  3WA9 B;  5AVC D;  3AZE A;  4DQY B;  2HIO B;  3WTP B;  3X1U C;  3AV2 D;  5DNN C;  5AV5 C;  5B24 A;  4XZQ C;  4WJ3 C;  4LD9 B;  3WA9 D;  3KXB A;  1S32 A;  3AZF A;  5AV9 B;  3AZL A;  2HIO D;  5BS7 C;  4H9N B;  3WTP D;  4HGA C;  5JA4 B;  3A6N C;  2NZD C;  3AZJ C;  5CPJ A;  5B1M A;  3VH6 T;  5AVC C;  3C1C B;  1P3L C;  5GSU D;  3REI D;  5BNV A;  3LJA D;  3KUY A;  5G49 A;  3AL0 C;  3WA9 C;  3REK D;  5GT3 A;  3C1B B;  1F66 D;  2HIO C;  3B6G A;  3NQJ B;  5AV6 B;  3WTP C;  2PYO A;  5E5A B;  4J8U B;  2F8N H;  3UTA A;  2XD1 A;  4LD9 C;  1WWS A;  5JRG A;  1TZY A;  3LEL D;  3C1B D;  3B6F A;  3B0D B;  5AV9 C;  3UT9 B;  2Y2M A;  4H9R A;  5AV6 D;  5E5A D;  2F8N K;  1JFI B;  4J8U D;  5GXQ D;  1KX3 B;  3LJA C;  1HQ3 B;  5B40 D;  1P3B A;  1P3M A;  5B31 A;  5KDM A;  5B32 B;  3C1C C;  5CPI D;  5B31 G;  3F6T A;  3B0C W;  4H9P A;  2YFW B;  5BNX A;  3C1B C;  1KX5 A;  1KX4 D;  5AV6 C;  5E5A C;  3MGS B;  2CWE A;  3UTB A;  4J8U C;  3AFA B;  1AOI A;  1M19 B;  5B2J B;  2G5I C;  5FUG A;  3AYW B;  5AV8 B;  1N1J A;  4M6B A;  1P3K B;  3LZ1 A;  3B0D C;  3UT9 C;  4H9S A;  2NQB A;  3MGS D;  2Y2O A;  3AFA D;  1EQZ A;  3R45 B;  1M19 D;  1KX3 C;  4J8X D;  1HQ3 C;  5DNM A;  1PZR A;  2ZY3 A;  3AZH B;  1ZLA A;  3AZE B;  3B0B A;  4H9Q A;  5B32 C;  4WU8 B;  2ARO B;  1H3O B;  4QLC D;  5BO0 A;  3KXB B;  2FJ7 A;  3AZE D;  2ZM5 A;  2FFF B;  4KGC B;  1M18 A;  4JJN A;  2YFV A;  3MGS C;  4E45 A;  3KXB D;  3AFA C;  1S32 D;  3AZF D;  4WU9 A;  1M19 C;  4J8X C;  1F1E A;  3AYW C;  5AV8 C;  1P3K C;  4KGC D;  3REJ B;  5B33 B;  3REH B;  5B1L A;  1P34 B;  1P3A A;  2BYK A;  1KU5 A;  4UUZ A;  5CPJ D;  1W2E A;  2Y2L A;  1ID3 A;  5B0Z A;  3MVD A;  5GT3 B;  3EPK A;  1P3F B;  3AZH C;  4KHA A;  3AZE C; 
#chains in the Genus database with same CATH homology
 4WV4 B;  1BH8 B;  5DNN B;  3X1S B;  4WU8 C;  2ARO C;  3WTP E;  5F99 A;  3KXB C;  3EG5 B;  5GT3 D;  4X23 B;  2F2A C;  1P3F D;  3MGQ A;  3V9R A;  1Z2C B;  2BG1 A;  4KGC C;  3W96 A;  3WAA A;  3UTA D;  3FDD A;  2W8S A;  3AV1 B;  1P3O B;  4J8W A;  5JRG D;  4XUJ A;  4X23 D;  1TZY D;  4KUD A;  3EPL A;  4DRB A;  3AZM A;  3REJ C;  5B33 C;  3REH C;  5CPK A;  2CV5 A;  5B0Y A;  1ULY A;  4H9O B;  1P34 C;  3AV2 B;  1BH9 A;  3AV1 D;  1P3O D;  1P3M D;  5CP6 A;  5GT3 C;  4Z5T A;  1P3F C;  5BNX B;  3X1V B;  4ZUX A;  2Y2H A;  5B32 G;  3MGR A;  3X1S C;  4CAY A;  3UTA C;  1AOI B;  5JRG C;  4YS3 B;  3MGP B;  4X23 C;  4Z2M H;  3AZI A;  3AZK A;  3X1V D;  1KX5 D;  2NQB B;  5AY8 A;  3UTB D;  2VQR A;  5GSU B;  4NE3 A;  3REI B;  3AV1 C;  3LJA B;  1P3O C;  1AOI D;  1EQZ B;  4YS3 D;  3MGP D;  3VH6 A;  3KFU G;  3LZ1 D;  3AN2 A;  3REK B;  1P3I A;  2NQB D;  1F66 B;  3AV2 C;  1EQZ D;  3X1T A;  5DNM D;  2Y2K A;  2FJ7 B;  4YM6 B;  1ZLA D;  3W98 B;  3LEL B;  3VH5 T;  4NE5 A;  3X1V C;  5B2I A;  3REL B;  3O62 A;  3W97 A;  5GXQ B;  1AOI C;  2FJ7 D;  4YM6 D;  5B40 B;  3W98 D;  4YS3 C;  3MGP C;  3W99 B;  4Z2M G;  3LZ1 C;  3REL D;  5B1L B;  4G92 B;  2NQB C;  4JJN D;  5CPI B;  5GSU C;  3REI C;  1EQZ C;  1Q9C A;  4WU9 D;  5DNM C;  4WNN A;  3W99 D;  5C3I B;  2BYM B;  3REK C;  1R4V A;  5B1L D;  1P3A D;  1KX4 B;  1F66 C;  3WKJ A;  3X1U A;  3TU4 B;  4DRA A;  4Z66 A;  1ID3 D;  5B0Z D;  5AV5 A;  2ZY5 A;  4YM6 C;  3KWQ B;  2FJ7 C;  2F8N A;  3W98 C;  3LEL C;  3REL C;  1M1A A;  1WWI A;  2JCH A;  3TU4 D;  2F8N G;  3NQU B;  5F99 D;  4EO5 B;  5GXQ C;  4CSR A;  4XUJ B;  4J8X B;  3KWQ D;  4UPK A;  3MGQ D;  5B40 C;  4KUD B;  3W99 C;  2NZD A;  3AZJ A;  3W96 D;  5CPK B;  2XD5 A;  5B1L C;  4G92 C;  5B0Y B;  3AZN B;  3WAA D;  5AVC A;  1P3A C;  5CPI C;  2DQN C;  1P3L A;  2L5A A;  4XUJ D;  4QLC B;  3AZG A;  4KUD D;  5C3I C;  5AVB A;  3IP4 C;  5CPK D;  2CV5 D;  5B0Y D;  3AZN D;  2IO5 B;  1KX4 C;  5B24 B;  2HIO A;  4R8P A;  3WTP A;  3TU4 C;  2Y2N A;  1S32 B;  5CP6 D;  3AZF B;  1P3G A;  4Z5T D;  3KWQ C;  3AZL B;  4LD9 A;  4ZUX D;  5AV9 A;  2LY8 A;  5B24 D;  4H9N A;  2ZY2 A;  5CPJ B;  5B1M B;  4EO5 C;  4XUJ C;  3AZK D;  1A7W A;  5JA4 A;  3AZL D;  4KUD C;  1P3I B;  5AY8 D;  5CPK C;  5B0Y C;  3AZN C;  5BNV B;  3KUY B;  5G49 B;  3C1C A;  5B1M D;  4QLC C;  4NFT A;  1P3I D;  4AWL B;  3B6G B;  2PYO B;  2IO5 C;  3KUY D;  3X1T D;  3C1B A;  1U35 A;  5B24 C;  3UTA B;  3NQJ A;  3VH6 W;  5E5A A;  5JRG B;  3AZF C;  1S32 C;  1TZY B;  4J8U A;  3B6F B;  3AZL C;  3B6G D;  4H9R B;  2PYO D;  5AY8 C;  3W97 D;  3B0C T;  3UT9 A;  2HUE B;  2J8P A;  4WZS B;  5CPJ C;  5B1M C;  1P3B B;  3EPH A;  1P3M B;  5B31 B;  1JFI A;  5KDM B;  3LZ0 A;  1KX3 A;  3B6F D;  1HQ3 A;  1P3I C;  3WKJ B;  3KUY C;  5B32 A;  1P3B D;  5B31 D;  3A1I A;  3H0L C;  4H9P B;  4AWL C;  1KX5 B;  3B6G C;  3WKJ D;  2G5H C;  2YFW A;  1M1A B;  2PYO C;  3MNN A;  3W97 C;  3UTB B;  4Z66 D;  5AV5 D;  5FUG B;  3MGS A;  1N1J B;  1B67 A;  1TZY C;  3LZ1 B;  3B6F C;  5B2J A;  3AYW A;  1M1A D;  5AV8 A;  1P3K A;  2HUE C;  5GT0 A;  5DNM B;  3AZG B;  1P3B C;  1P3M C;  5B31 C;  5AVB B;  3AZJ D;  2NZD D;  1ZLA B;  3KSY A;  4H9Q B;  5CHL B;  3AZH A;  1P3L D;  3WKJ C;  4R8P B;  4G91 B;  3AZG D;  5BO0 B;  4WU8 A;  5AVB D;  4Z66 C;  1P3G B;  2ARO A;  1H3O A;  3VH5 A;  1BFM A;  1M18 B;  2JSS A;  2Y2I A;  1KX5 C;  1M1A C;  4R8P D;  4JJN B;  2YFV B;  4KGC A;  4NE6 A;  3UTB C;  1P3G D;  4WU9 B;  4LD9 D;  1M18 D;  4J8V A;  4H9S C;  4ZBJ B;  5AV9 D;  1P3A B;  2BYK B;  4UUZ B;  3REJ A;  5B33 A;  3REH A;  1P34 A;  3AZG C;  3EPJ A;  1ID3 B;  5B0Z B;  5AVB C;  3MVD B;  1P3P A;  1ZLA C;  4KHA B;  1P3F A;  1U35 B;  3C1C D;  4R8P C;  4G91 C;  1BH8 A;  5DNN A;  3X1S A;  5F99 B;  3MVD D;  1P3G C;  1TAF A;  3MGQ B;  4XZQ A;  3V9R B;  1M18 C;  3W96 B;  4X23 A;  1U35 D;  3WAA B;  5BS7 A;  4JJN C;  4J8W B;  4WU9 C;  3LZ0 B;  3AV1 A;  1P3O A;  3A6N A;  3AZM B;  2CV5 B;  4ZBJ C;  3UT9 D;  1BH9 B;  4J8W D;  4H9O A;  3AV2 A;  3LZ0 D;  1KX3 D;  1ID3 C;  5CP6 B;  1HQ3 D;  5B0Z C;  3MVD C;  4Z5T B;  3AZM D;  4ZUX B;  3WA9 A;  3MGR B;  3MNN B;  1U35 C;  5B32 D;  3X1V A;  4CAY B;  2Y2Q A;  5F99 C;  3AZK B;  3MGQ C;  3AZI B;  2Y2G A;  3MGR D;  4YS3 A;  3W96 C;  5AY8 B;  3MGP A;  3MNN D;  3WAA C;  2JE5 A;  5GT0 B;  3H0R C;  5BT1 D;  4J8W C;  5GSU A;  3REI A;  3LZ0 C;  3AZI D;  3LJA A;  5B2J D;  3AN2 B;  3AYW D;  5AV8 D;  2RVQ D;  3AZM C;  1P3K D;  2CV5 C;  2ZY4 A;  3REK A;  3X1T B;  5GT0 D;  1F66 A;  3AN2 D;  5CP6 C;  4Z5T C;  3H0M C;  4YM6 A;  5B2I B;  4ZUX C;  3O62 B;  3AZH D;  3MGR C;  3W98 A;  3MNN C;  3LEL A;  3W97 B;  4WU8 D;  3REL A;  5AV6 A;  2ARO D;  5BT1 C;  5GXQ A;  3AZK C;  4J8V B;  3AZI C;  1T3U A;  5B2J C;  5B2I D;  5B40 A;  3O62 D;  3W99 A;  2RVQ C;  5GT0 C;  1B6W A;  4WNN B;  5CPI A;  1P3P B;  3VH5 W;  4J8V D;  3AN2 C;  2RIQ A;  2BYM A;  3REJ D;  5B33 D;  3REH D;  3X1T C;  3A1K A;  2UWX A;  3X1U B;  1P34 D;  2Y2J A;  1KX4 A;  4Z66 B;  2DF4 C;  1P3P D;  1TAF B;  4E44 A;  5AV5 B;  2F8N B;  4XZQ B;  3TU4 A;  3KWQ A;  2Y2P A;  5B2I C;  3P5J B;  3O62 C;  3X1U D;  4HGA B;  5DNN D;  3X1S D;  4CSR B;  1HTA A;  2F8N D;  4XZQ D;  3A6N B;  2NZD B;  3NQU A;  3AZJ B;  3AFA A;  1M19 A;  4J8V C;  4J8X A;  5AVC B;  1P3L B;  3AZN A;  3A6N D;  1P3P C;  3R45 A;  4QLC A;  3WA9 B;  5AVC D;  3AZE A;  4DQY B;  2HIO B;  3WTP B;  3X1U C;  3AV2 D;  5DNN C;  5AV5 C;  5B24 A;  4XZQ C;  4WJ3 C;  4LD9 B;  3WA9 D;  3KXB A;  1S32 A;  3AZF A;  5AV9 B;  3AZL A;  2HIO D;  5BS7 C;  4H9N B;  3WTP D;  4HGA C;  5JA4 B;  3A6N C;  2NZD C;  3AZJ C;  5CPJ A;  5B1M A;  3VH6 T;  5AVC C;  3C1C B;  1P3L C;  5GSU D;  3REI D;  5BNV A;  3LJA D;  3KUY A;  5G49 A;  3AL0 C;  3WA9 C;  3REK D;  5GT3 A;  3C1B B;  1F66 D;  2HIO C;  3B6G A;  3NQJ B;  5AV6 B;  3WTP C;  2PYO A;  5E5A B;  4J8U B;  2F8N H;  3UTA A;  2XD1 A;  4LD9 C;  1WWS A;  5JRG A;  1TZY A;  3LEL D;  3C1B D;  3B6F A;  3B0D B;  5AV9 C;  3UT9 B;  2Y2M A;  4H9R A;  5AV6 D;  5E5A D;  2F8N K;  1JFI B;  4J8U D;  5GXQ D;  1KX3 B;  3LJA C;  1HQ3 B;  5B40 D;  1P3B A;  1P3M A;  5B31 A;  5KDM A;  5B32 B;  3C1C C;  5CPI D;  5B31 G;  3F6T A;  3B0C W;  4H9P A;  2YFW B;  5BNX A;  3C1B C;  1KX5 A;  1KX4 D;  5AV6 C;  5E5A C;  3MGS B;  2CWE A;  3UTB A;  4J8U C;  3AFA B;  1AOI A;  1M19 B;  5B2J B;  2G5I C;  5FUG A;  3AYW B;  5AV8 B;  1N1J A;  4M6B A;  1P3K B;  3LZ1 A;  3B0D C;  3UT9 C;  4H9S A;  2NQB A;  3MGS D;  2Y2O A;  3AFA D;  1EQZ A;  3R45 B;  1M19 D;  1KX3 C;  4J8X D;  1HQ3 C;  5DNM A;  1PZR A;  2ZY3 A;  3AZH B;  1ZLA A;  3AZE B;  3B0B A;  4H9Q A;  5B32 C;  4WU8 B;  2ARO B;  1H3O B;  4QLC D;  5BO0 A;  3KXB B;  2FJ7 A;  3AZE D;  2ZM5 A;  2FFF B;  4KGC B;  1M18 A;  4JJN A;  2YFV A;  3MGS C;  4E45 A;  3KXB D;  3AFA C;  1S32 D;  3AZF D;  4WU9 A;  1M19 C;  4J8X C;  1F1E A;  3AYW C;  5AV8 C;  1P3K C;  4KGC D;  3REJ B;  5B33 B;  3REH B;  5B1L A;  1P34 B;  1P3A A;  2BYK A;  1KU5 A;  4UUZ A;  5CPJ D;  1W2E A;  2Y2L A;  1ID3 A;  5B0Z A;  3MVD A;  5GT3 B;  3EPK A;  1P3F B;  3AZH C;  4KHA A;  3AZE C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...