1M18A

Ligand binding alters the structure and dynamics of nucleosomal dna
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
98
structure length
98
Chain Sequence
b'PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Palindromic 146 Base Pair DNA Fragment
publication title Crystal Structures of Nucleosome Core Particles in Complex with Minor Groove DNA-binding Ligands
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 32
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2002-06-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1m18A00
3RELD 3WA9B 5CPIA 1EQZC 5BS7A 2CV5C 3LZ1A 5KDMB 1EQZD 4J8WB 4E45A 3MVDA 1BH9B 3WTPE 2NZDD 4Z2MH 3AZMB 1P3BA 1BFMA 1M19A 3TU4B 5B2IA 4KUDB 4NFTA 3W96B 3AYWC 4CSRA 3AZIC 3WTPA 4X23B 1P3IA 3AV2B 2FJ7C 1P3FA 5AV9B 3AYWD 3O62B 4HGAC 2FJ7D 3LZ0C 3AZGA 3AFAB 2BYMB 1P3KC 4R8PC 4Z66B 3X1TC 5B1LD 3A6NC 2LY8A 1BH8A 1P3KD 2F8ND 3X1TD 4XUJC 3REJB 3KXBC 4ZBJC 3V9RB 1U35B 4XUJD 4JJND 3KXBD 5GXQB 1M1AA 4XZQC 5C3IC 3AZEA 5CPIB 3WAAA 3LZ1B 4XZQD 1P3MB 1P3PB 3REHC 5GSUC 5AV6A 4UUZB 3B6FC 3REHD 4WU9A 5GSUD 1F1EA 1ID3C 4Z5TB 3B6FD 5CHLB 3KWQB 3R45A 2JSSA 2BYKA 5CPJA 5F99A 1KX4B 3X1SA 3LJAA 3WTPB 5B24A 1TAFA 2AROA 3NQUA 4CAYA 5DNNA 4J8WD 1AOIA 1P3FB 3UTBB 5GT0C 5B32A 5AV8C 5B0YC 3W96C 5AV5C 3WA9A 3C1CC 5GT0D 4X23C 5B0YD 3W96D 5DNMB 5KDMA 5AV5D 1BH8B 3W99A 5AVBA 3O62C 4X23D 3AV2D 5B0ZC 1BH9A 5AV9D 4QLCB 4H9SA 4J8XA 5B33C 3AZMA 3O62D 4H9NB 4LD9A 1S32C 3TU4A 3X1VB 5JRGC 3B6GA 4KUDA 3C1BB 1M1AB 1S32D 4Z66D 5BO0A 3MNNA 3AZEB 4AWLB 5JRGD 3AN2A 2HUEB 1KX3B 3NQJA 5BNXA 3AV1C 3REIC 3X1UA 5GT3C 3LELC 1WWSA 4YM6A 3REID 1U35D 1F66C 4G92B 3AFAA 5B2JB 5BT1C 3LELD 2NQBB 5B1MC 5GXQD 5BS7C 2HIOB 1F66D 4Z2MG 3VH6A 5BT1D 5B31C 5CPID 5B1MD 2BYKB 4NE3A 5CPJB 5F99B 3MVDC 3LJAB 3AZKC 4YS3C 1TAFB 3NQUB 5DNNB 1P3BC 1AOIB 1M19C 3MVDD 4WV4B 4YS3D 5B2IC 1P3BD 1TZYA 1M19D 5B32B 5B2ID 3WTPC 1P3IC 3B0CT 5B40B 2NZDC 3W99B 3WTPD 1P3MA 5AVBB 1P3PA 1P3ID 3AZGC 4UUZA 4J8XB 4LD9B 4ZUXB 3MGQC 3AZGD 4Z5TA 4J8UB 3B6GB 1P34A 3KWQA 5BO0B 3MNNB 3VH5A 1HQ3A 3MGQD 5B32G 1KX4A 4G91B 3AN2B 3NQJB 5BNXB 3B0DC 3X1UB 3UT9A 3UTBA 4NE5A 4EO5C 4YM6B 3KUYB 1P3AA 3WKJA 5B1LC 3WAAC 3AZJB 3AZNB 1M1AD 5DNMA 3WAAD 1P3LB 5AV6C 1KU5A 3MGSA 4JJNC 4QLCA 4WU9C 5AV6D 4H9NA 1EQZA 5CPKA 3UTAA 2CV5A 3X1VA 4WU9D 5E5AB 1TZYB 3REKA 3C1BA 5F99C 3MGPA 3X1SC 5B24C 4H9OA 2AROC 3AZLB 5CPJD 1KX3A 5F99D 3X1SD 3LJAD 5B24D 1P3GA 2AROD 1AOID 5DNND 2PYOA 3WA9C 5B2JA 5G49B 3AZIA 4M6BA 2NQBA 5B32D 2HIOA 1Q9CA 1P34B 1ZLAA 3WA9D 3W99C 5AVBC 4J8WC 1HQ3B 3W99D 3LZ0A 4J8XC 4LD9C 3AZMC 5AVBD 3TU4C 4R8PA 3UT9B 1JFIB 4J8XD 4LD9D 3A6NA 3AZMD 3B6GC 4KUDC 5AVCA 1P3AB 3B0CW 3TU4D 3WKJB 1R4VA 3B0BA 4G91C 3B6GD 4KUDD 3MGRA 3AN2C 1P3OB 3MNND 4E44A 3AV2C 4KGCB 5B40A 5AV9C 3X1UC 1B6WA 2IO5B 3AN2D 4WNNA 3MGSB 3X1UD 3AFAC 4H9RB 1EQZB 4YM6D 4ZUXA 5CPKB 3UTAB 2CV5B 4Z66C 4H9PB 4J8UA 3AFAD 4J8VA 3REKB 2F8NK 3MGPB 2YFWA 4H9OB 3REJC 1ID3A 1U35C 2L5AA 3VH5W 4KHAA 1P3GB 1M18A 3REJD 5GXQC 3KUYA 2PYOB 1ULYA 3AYWB 3W97A 5CPIC 3AZIB 3AZJA 3AZNA 3LZ1C 1ZLAB 2FJ7B 1P3MC 1P3PC 1P3LA 3LZ1D 4HGAB 5AV8A 3LZ0B 1P3MD 1P3PD 3C1CA 1H3OA 1P3KB 4H9QA 4R8PB 2F8NB 1A7WA 4Z5TC 3W98A 3A6NB 1KX5A 5E5AA 5AVCB 3KWQC 4DRBA 2YFVB 3VH6T 4Z5TD 1KX4C 5B0ZA 3MGRB 3KWQD 5B33A 3AZLA 1HQ3D 1KX4D 1P3FC 3UT9C 4WNNB 5JRGA 3UTBC 1P3AC 3WKJC 1P3FD 3UT9D 5C3IB 3UTBD 5G49A 1P3AD 3WKJD 3AZHA 5DNMC 3AV1A 5FUGA 4WZSB 4J8VB 3AZFA 3REHB 5GSUB 5GT3A 5DNMD 2YFWB 3MGSC 3B6FB 4QLCC 5B1MA 5CPKC 1ID3B 5AY8A 3UTAC 1M18B 4KHAB 3X1VC 3MGSD 1JFIA 4QLCD 5B31A 3REKC 3C1BC 1M1AC 5CPKD 3UTAD 2CV5D 3MGPC 3X1VD 3AZEC 5CP6A 4AWLC 3AZKA 3W97B 4YS3A 3VH5T 3REKD 3C1BD 2HUEC 4WU8A 1KX3C 1P3OA 3MGPD 3AZED 4KGCA 1P3GC 3RELA 1KX3D 5GT0B 5AV8B 5B0YB 2PYOC 1P3GD 5BNVA 4G92C 5AV5B 2F8NH 5B2JC 3C1CB 1H3OB 2NQBC 4H9RA 4H9QB 2HIOC 3W98B 2PYOD 4H9PA 1KX5B 1ZLAC 5B2JD 2NZDA 3AZID 2NQBD 2HIOD 5CPJC 3LJAC 5B0ZB 1ZLAD 5B33B 1AOIC 5DNNC 5JA4A 1S32B 3LZ0D 3MGQA 5JRGB 5AVCC 5B32C 4R8PD 3A6ND 3MGRC 5AVCD 3AYWA 3AZHB 3AV1B 5B40C 5FUGB 3REIB 3AZFB 2FJ7A 3MGRD 5GT3B 3LELB 1N1JA 5B40D 5B1LA 1F66B 4H9SC 3VH6W 5B1MB 4ZUXC 5AY8B 1P3KA 2F8NA 3X1TA 4J8UC 4J8VC 5B31B 4ZUXD 3MNNC 2YFVA 3MVDB 5CP6B 4J8UD 3AZKB 4YS3B 4J8VD 4XUJA 4JJNA 1P3BB 4WU8B 3KXBA 1M19B 1M18C 1WWIA 3RELB 5B2IB 1HTAA 4YM6C 3KUYC 1ID3D 1M18D 5BNVB 4XZQA 4CSRB 3W97C 3AZJC 3KUYD 3AZNC 1P3IB 3W97D 2NZDB 4DRAA 3AZJD 1P3LC 3REHA 3AZND 5GSUA 5B31G 3AZGB 1P3LD 3B6FA 5JA4B 3KSYA 5AV8D 3W98C 3MGQB 1KX5C 5E5AC 1TZYC 3C1CD 2CWEA 4J8WA 3W98D 1KX5D 5E5AD 1TZYD 3AZLC 5B0ZD 1B67A 3B0DB 4NE6A 5B33D 1N1JB 4EO5B 3AZLD 5GT0A 5B1LB 5B0YA 2RVQC 3W96A 5AV5A 3WAAB 3AZHC 3X1TB 4X23A 3AV2A 2RVQD 1P34C 3AZFC 5AV9A 5AV6B 3O62A 3AZHD 1HQ3C 3AV1D 1P34D 3AZFD 4XUJB 4JJNB 4WU9B 3KXBB 4ZBJB 5GT3D 2BYMA 5AY8C 1S32A 4Z66A 3R45B 5AY8D 4XZQB 3X1SB 5CP6C 5B24B 5B31D 2AROB 3REJA 4CAYB 4WU8C 1P3OC 5CP6D 3AZKD 3V9RA 2F8NG 3REIA 1U35A 4KGCC 3RELC 2IO5C 3LELA 4WU8D 1P3OD 5GXQA 4KGCD 1F66A
chains in the Genus database with same CATH superfamily
3RELD 1W2EA 3WA9B 5CPIA 1EQZC 5BS7A 2CV5C 3LZ1A 5KDMB 1EQZD 2F2AC 4J8WB 4E45A 3MVDA 1BH9B 3WTPE 2NZDD 4Z2MH 3AZMB 1P3BA 1BFMA 1M19A 3TU4B 5B2IA 4KUDB 4NFTA 4DQYB 3W96B 3AYWC 4CSRA 3AZIC 3WTPA 4X23B 1P3IA 3AV2B 2FJ7C 1P3FA 5AV9B 3AYWD 3O62B 2W8SA 4HGAC 2FJ7D 3LZ0C 3AZGA 3AFAB 2BYMB 1P3KC 4R8PC 4Z66B 3X1TC 5B1LD 3A6NC 2LY8A 1BH8A 2XD1A 1P3KD 2F8ND 3X1TD 4XUJC 3REJB 3KXBC 4ZBJC 3V9RB 1U35B 4XUJD 4JJND 3KXBD 5GXQB 1M1AA 2DF4C 4XZQC 5C3IC 3AZEA 5CPIB 3WAAA 3LZ1B 2Y2MA 4XZQD 1P3MB 1P3PB 3REHC 5GSUC 5AV6A 4UUZB 3B6FC 3REHD 4WU9A 5GSUD 1F1EA 1ID3C 4Z5TB 3B6FD 5CHLB 3KWQB 3R45A 2JSSA 2BYKA 5CPJA 5F99A 1KX4B 3X1SA 3LJAA 2J8PA 3WTPB 5B24A 1TAFA 2AROA 3NQUA 4CAYA 5DNNA 4J8WD 1AOIA 1P3FB 3UTBB 5GT0C 5B32A 5B0YC 5AV8C 3W96C 1Z2CB 5AV5C 3WA9A 2Y2JA 3C1CC 5GT0D 4X23C 5B0YD 3W96D 5DNMB 5KDMA 5AV5D 1BH8B 3W99A 3H0MC 5AVBA 3O62C 4X23D 3AV2D 5B0ZC 1BH9A 5AV9D 4QLCB 4H9SA 2Y2LA 4J8XA 5B33C 3O62D 4H9NB 3AZMA 4LD9A 1S32C 3TU4A 3X1VB 5JRGC 3B6GA 4KUDA 3C1BB 1M1AB 1S32D 4Z66D 5BO0A 3MNNA 3AZEB 4AWLB 5JRGD 3AN2A 2HUEB 2Y2QA 1KX3B 3NQJA 5BNXA 3AV1C 3REIC 3X1UA 5GT3C 3LELC 1WWSA 4YM6A 3REID 1U35D 1F66C 4G92B 3AFAA 5B2JB 5BT1C 3LELD 2NQBB 5B1MC 3H0RC 5GXQD 5BS7C 2HIOB 1F66D 4Z2MG 2Y2GA 3VH6A 5BT1D 5B31C 5B1MD 5CPID 2BYKB 4NE3A 5CPJB 5F99B 3MVDC 3LJAB 3AZKC 4YS3C 1TAFB 3NQUB 2Y2PA 5DNNB 1P3BC 1M19C 1AOIB 3MVDD 4WV4B 4YS3D 5B2IC 1P3BD 1TZYA 1M19D 5B32B 5B2ID 3WTPC 1P3IC 3EPHA 3B0CT 5B40B 2NZDC 3W99B 3WTPD 3AL0C 1P3MA 5AVBB 1P3PA 1P3ID 3AZGC 4UUZA 4J8XB 4LD9B 4ZUXB 2ZY4A 3MGQC 3AZGD 4Z5TA 4J8UB 3B6GB 1P34A 3KWQA 5BO0B 3MNNB 3VH5A 1HQ3A 3MGQD 5B32G 1KX4A 4G91B 3AN2B 3NQJB 5BNXB 3B0DC 3X1UB 3UT9A 3UTBA 4NE5A 4EO5C 4YM6B 3KUYB 1P3AA 3WKJA 5B1LC 3WAAC 3AZJB 3AZNB 1M1AD 2JCHA 5DNMA 3WAAD 1P3LB 5AV6C 1KU5A 3MGSA 4JJNC 4QLCA 4WU9C 5AV6D 3FDDA 4H9NA 1EQZA 1PZRA 5CPKA 3UTAA 2CV5A 3X1VA 4WU9D 5E5AB 1TZYB 3REKA 3C1BA 2VQRA 5F99C 3MGPA 3X1SC 3F6TA 5B24C 4H9OA 2AROC 3AZLB 3EPLA 5CPJD 1KX3A 5F99D 3X1SD 3LJAD 5B24D 1P3GA 2AROD 1AOID 5DNND 2PYOA 3WA9C 5B2JA 5G49B 3AZIA 4M6BA 2NQBA 5B32D 2HIOA 1Q9CA 1P34B 1ZLAA 3WA9D 3W99C 5AVBC 4J8WC 1HQ3B 3W99D 3LZ0A 4J8XC 4LD9C 3AZMC 5AVBD 3TU4C 4R8PA 3UT9B 1JFIB 4J8XD 4LD9D 3A6NA 3AZMD 3B6GC 4KUDC 5AVCA 1P3AB 3B0CW 3TU4D 3WKJB 1R4VA 2BG1A 3B0BA 4G91C 3B6GD 4KUDD 3MGRA 3AN2C 4UPKA 1P3OB 3MNND 4E44A 3AV2C 4KGCB 5B40A 5AV9C 3X1UC 1B6WA 2IO5B 3AN2D 4WNNA 2DQNC 3MGSB 3X1UD 3AFAC 3KFUG 4H9RB 1EQZB 4YM6D 4ZUXA 5CPKB 3UTAB 2CV5B 4Z66C 4H9PB 4J8UA 3AFAD 4J8VA 3REKB 2F8NK 3MGPB 2YFWA 4H9OB 3REJC 2JE5A 2Y2IA 2Y2OA 1ID3A 1U35C 2L5AA 3VH5W 4KHAA 1P3GB 1M18A 3REJD 5GXQC 3KUYA 2PYOB 1ULYA 3AYWB 3W97A 5CPIC 3AZIB 3AZJA 3AZNA 3LZ1C 1ZLAB 2FJ7B 1P3MC 1P3PC 1P3LA 3LZ1D 4HGAB 5AV8A 3LZ0B 2ZM5A 1P3MD 1P3PD 3C1CA 1H3OA 1P3KB 4H9QA 4R8PB 2F8NB 1A7WA 4Z5TC 3W98A 3H0LC 3A6NB 1KX5A 5E5AA 5AVCB 3KWQC 4DRBA 2YFVB 3VH6T 4Z5TD 1KX4C 5B0ZA 3MGRB 3KWQD 5B33A 3AZLA 1HQ3D 1KX4D 1P3FC 3UT9C 4WNNB 5JRGA 3UTBC 1P3AC 3WKJC 1P3FD 3UT9D 5C3IB 3UTBD 5G49A 2Y2NA 1P3AD 3WKJD 3AZHA 5DNMC 3AV1A 5FUGA 4WZSB 4J8VB 3AZFA 3REHB 5GSUB 2ZY5A 5GT3A 5DNMD 2YFWB 3MGSC 3B6FB 4QLCC 5B1MA 5CPKC 1ID3B 5AY8A 3UTAC 1M18B 4KHAB 3X1VC 3MGSD 1JFIA 4QLCD 5B31A 3REKC 3C1BC 1M1AC 5CPKD 3UTAD 2CV5D 3MGPC 3X1VD 3AZEC 5CP6A 4AWLC 3AZKA 3EPKA 4YS3A 3W97B 3VH5T 3REKD 3C1BD 2HUEC 4WU8A 1KX3C 1P3OA 3MGPD 3AZED 4KGCA 2RIQA 1P3GC 3A1IA 3IP4C 3RELA 1KX3D 5GT0B 5AV8B 5B0YB 2PYOC 1P3GD 5BNVA 4G92C 5AV5B 2F8NH 5B2JC 3C1CB 1H3OB 2NQBC 4H9RA 4H9QB 2ZY3A 2HIOC 3W98B 2PYOD 4H9PA 1KX5B 1ZLAC 5B2JD 2NZDA 3AZID 2NQBD 2HIOD 5CPJC 3LJAC 5B0ZB 1ZLAD 5B33B 1AOIC 5DNNC 5JA4A 1S32B 3LZ0D 3MGQA 5JRGB 5AVCC 5B32C 4R8PD 3A6ND 3MGRC 5AVCD 3AYWA 3AZHB 2FFFB 3AV1B 5B40C 5FUGB 3REIB 3AZFB 2FJ7A 3MGRD 5GT3B 3LELB 1N1JA 2XD5A 5B40D 5B1LA 1F66B 4H9SC 3VH6W 5B1MB 4ZUXC 5AY8B 1P3KA 2F8NA 3X1TA 4J8UC 2ZY2A 4J8VC 5B31B 2UWXA 4ZUXD 3MNNC 2YFVA 3MVDB 4WJ3C 5CP6B 4J8UD 3AZKB 4YS3B 4J8VD 4XUJA 4JJNA 1P3BB 4WU8B 3KXBA 1M19B 1M18C 1WWIA 3RELB 5B2IB 1HTAA 4YM6C 3KUYC 1ID3D 3P5JB 1M18D 5BNVB 4XZQA 4CSRB 3W97C 3AZJC 3EPJA 3KUYD 3AZNC 1P3IB 3W97D 2NZDB 4DRAA 3AZJD 1P3LC 3REHA 3AZND 5GSUA 5B31G 3AZGB 1P3LD 3B6FA 5JA4B 3KSYA 5AV8D 3W98C 3MGQB 1KX5C 2G5HC 5E5AC 1TZYC 3C1CD 2CWEA 4J8WA 3W98D 1KX5D 5E5AD 1TZYD 3AZLC 5B0ZD 1B67A 3B0DB 4NE6A 5B33D 1N1JB 2G5IC 4EO5B 3AZLD 5GT0A 5B1LB 1T3UA 5B0YA 2RVQC 3W96A 5AV5A 3WAAB 3AZHC 2Y2KA 4X23A 3X1TB 3AV2A 2RVQD 1P34C 3AZFC 5AV9A 2Y2HA 5AV6B 3O62A 3A1KA 3AZHD 1HQ3C 3AV1D 1P34D 3AZFD 4XUJB 4JJNB 4WU9B 3KXBB 4ZBJB 5GT3D 2BYMA 5AY8C 1S32A 4Z66A 3R45B 5AY8D 4XZQB 3X1SB 5CP6C 5B24B 3EG5B 5B31D 2AROB 3REJA 4CAYB 4WU8C 1P3OC 5CP6D 3AZKD 3V9RA 2F8NG 3REIA 1U35A 4KGCC 3RELC 2IO5C 3LELA 4WU8D 1P3OD 5GXQA 4KGCD 1F66A
chains in the Genus database with same CATH topology
3RELD 1W2EA 3WA9B 5CPIA 1EQZC 5BS7A 2CV5C 3LZ1A 5KDMB 1EQZD 2F2AC 4J8WB 4E45A 3MVDA 1BH9B 3WTPE 2NZDD 4Z2MH 3AZMB 1P3BA 1BFMA 1M19A 3TU4B 5B2IA 4KUDB 4NFTA 4DQYB 3W96B 3AYWC 4CSRA 3AZIC 3WTPA 4X23B 1P3IA 3AV2B 2FJ7C 1P3FA 5AV9B 3AYWD 3O62B 2W8SA 4HGAC 2FJ7D 3LZ0C 3AZGA 3AFAB 2BYMB 1P3KC 4R8PC 4Z66B 3X1TC 5B1LD 3A6NC 2LY8A 1BH8A 2XD1A 1P3KD 2F8ND 3X1TD 4XUJC 3REJB 3KXBC 4ZBJC 3V9RB 1U35B 4XUJD 4JJND 3KXBD 5GXQB 1M1AA 2DF4C 4XZQC 5C3IC 3AZEA 5CPIB 3WAAA 3LZ1B 2Y2MA 4XZQD 1P3MB 1P3PB 3REHC 5GSUC 5AV6A 4UUZB 3B6FC 3REHD 4WU9A 5GSUD 1F1EA 1ID3C 4Z5TB 3B6FD 5CHLB 3KWQB 3R45A 2JSSA 2BYKA 5CPJA 5F99A 1KX4B 3X1SA 3LJAA 2J8PA 3WTPB 5B24A 1TAFA 2AROA 3NQUA 4CAYA 5DNNA 4J8WD 1AOIA 1P3FB 3UTBB 5GT0C 5B32A 5B0YC 5AV8C 3W96C 1Z2CB 5AV5C 3WA9A 2Y2JA 3C1CC 5GT0D 4X23C 5B0YD 3W96D 5DNMB 5KDMA 5AV5D 1BH8B 3W99A 3H0MC 5AVBA 3O62C 4X23D 3AV2D 5B0ZC 1BH9A 5AV9D 4QLCB 4H9SA 2Y2LA 4J8XA 5B33C 3O62D 4H9NB 3AZMA 4LD9A 1S32C 3TU4A 3X1VB 5JRGC 3B6GA 4KUDA 3C1BB 1M1AB 1S32D 4Z66D 5BO0A 3MNNA 3AZEB 4AWLB 5JRGD 3AN2A 2HUEB 2Y2QA 1KX3B 3NQJA 5BNXA 3AV1C 3REIC 3X1UA 5GT3C 3LELC 1WWSA 4YM6A 3REID 1U35D 1F66C 4G92B 3AFAA 5B2JB 5BT1C 3LELD 2NQBB 5B1MC 3H0RC 5GXQD 5BS7C 2HIOB 1F66D 4Z2MG 2Y2GA 3VH6A 5BT1D 5B31C 5B1MD 5CPID 2BYKB 4NE3A 5CPJB 5F99B 3MVDC 3LJAB 3AZKC 4YS3C 1TAFB 3NQUB 2Y2PA 5DNNB 1P3BC 1M19C 1AOIB 3MVDD 4WV4B 4YS3D 5B2IC 1P3BD 1TZYA 1M19D 5B32B 5B2ID 3WTPC 1P3IC 3EPHA 3B0CT 5B40B 2NZDC 3W99B 3WTPD 3AL0C 1P3MA 5AVBB 1P3PA 1P3ID 3AZGC 4UUZA 4J8XB 4LD9B 4ZUXB 2ZY4A 3MGQC 3AZGD 4Z5TA 4J8UB 3B6GB 1P34A 3KWQA 5BO0B 3MNNB 3VH5A 1HQ3A 3MGQD 5B32G 1KX4A 4G91B 3AN2B 3NQJB 5BNXB 3B0DC 3X1UB 3UT9A 3UTBA 4NE5A 4EO5C 4YM6B 3KUYB 1P3AA 3WKJA 5B1LC 3WAAC 3AZJB 3AZNB 1M1AD 2JCHA 5DNMA 3WAAD 1P3LB 5AV6C 1KU5A 3MGSA 4JJNC 4QLCA 4WU9C 5AV6D 3FDDA 4H9NA 1EQZA 1PZRA 5CPKA 3UTAA 2CV5A 3X1VA 4WU9D 5E5AB 1TZYB 3REKA 3C1BA 2VQRA 5F99C 3MGPA 3X1SC 3F6TA 5B24C 4H9OA 2AROC 3AZLB 3EPLA 5CPJD 1KX3A 5F99D 3X1SD 3LJAD 5B24D 1P3GA 2AROD 1AOID 5DNND 2PYOA 3WA9C 5B2JA 5G49B 3AZIA 4M6BA 2NQBA 5B32D 2HIOA 1Q9CA 1P34B 1ZLAA 3WA9D 3W99C 5AVBC 4J8WC 1HQ3B 3W99D 3LZ0A 4J8XC 4LD9C 3AZMC 5AVBD 3TU4C 4R8PA 3UT9B 1JFIB 4J8XD 4LD9D 3A6NA 3AZMD 3B6GC 4KUDC 5AVCA 1P3AB 3B0CW 3TU4D 3WKJB 1R4VA 2BG1A 3B0BA 4G91C 3B6GD 4KUDD 3MGRA 3AN2C 4UPKA 1P3OB 3MNND 4E44A 3AV2C 4KGCB 5B40A 5AV9C 3X1UC 1B6WA 2IO5B 3AN2D 4WNNA 2DQNC 3MGSB 3X1UD 3AFAC 3KFUG 4H9RB 1EQZB 4YM6D 4ZUXA 5CPKB 3UTAB 2CV5B 4Z66C 4H9PB 4J8UA 3AFAD 4J8VA 3REKB 2F8NK 3MGPB 2YFWA 4H9OB 3REJC 2JE5A 2Y2IA 2Y2OA 1ID3A 1U35C 2L5AA 3VH5W 4KHAA 1P3GB 1M18A 3REJD 5GXQC 3KUYA 2PYOB 1ULYA 3AYWB 3W97A 5CPIC 3AZIB 3AZJA 3AZNA 3LZ1C 1ZLAB 2FJ7B 1P3MC 1P3PC 1P3LA 3LZ1D 4HGAB 5AV8A 3LZ0B 2ZM5A 1P3MD 1P3PD 3C1CA 1H3OA 1P3KB 4H9QA 4R8PB 2F8NB 1A7WA 4Z5TC 3W98A 3H0LC 3A6NB 1KX5A 5E5AA 5AVCB 3KWQC 4DRBA 2YFVB 3VH6T 4Z5TD 1KX4C 5B0ZA 3MGRB 3KWQD 5B33A 3AZLA 1HQ3D 1KX4D 1P3FC 3UT9C 4WNNB 5JRGA 3UTBC 1P3AC 3WKJC 1P3FD 3UT9D 5C3IB 3UTBD 5G49A 2Y2NA 1P3AD 3WKJD 3AZHA 5DNMC 3AV1A 5FUGA 4WZSB 4J8VB 3AZFA 3REHB 5GSUB 2ZY5A 5GT3A 5DNMD 2YFWB 3MGSC 3B6FB 4QLCC 5B1MA 5CPKC 1ID3B 5AY8A 3UTAC 1M18B 4KHAB 3X1VC 3MGSD 1JFIA 4QLCD 5B31A 3REKC 3C1BC 1M1AC 5CPKD 3UTAD 2CV5D 3MGPC 3X1VD 3AZEC 5CP6A 4AWLC 3AZKA 3EPKA 4YS3A 3W97B 3VH5T 3REKD 3C1BD 2HUEC 4WU8A 1KX3C 1P3OA 3MGPD 3AZED 4KGCA 2RIQA 1P3GC 3A1IA 3IP4C 3RELA 1KX3D 5GT0B 5AV8B 5B0YB 2PYOC 1P3GD 5BNVA 4G92C 5AV5B 2F8NH 5B2JC 3C1CB 1H3OB 2NQBC 4H9RA 4H9QB 2ZY3A 2HIOC 3W98B 2PYOD 4H9PA 1KX5B 1ZLAC 5B2JD 2NZDA 3AZID 2NQBD 2HIOD 5CPJC 3LJAC 5B0ZB 1ZLAD 5B33B 1AOIC 5DNNC 5JA4A 1S32B 3LZ0D 3MGQA 5JRGB 5AVCC 5B32C 4R8PD 3A6ND 3MGRC 5AVCD 3AYWA 3AZHB 2FFFB 3AV1B 5B40C 5FUGB 3REIB 3AZFB 2FJ7A 3MGRD 5GT3B 3LELB 1N1JA 2XD5A 5B40D 5B1LA 1F66B 4H9SC 3VH6W 5B1MB 4ZUXC 5AY8B 1P3KA 2F8NA 3X1TA 4J8UC 2ZY2A 4J8VC 5B31B 2UWXA 4ZUXD 3MNNC 2YFVA 3MVDB 4WJ3C 5CP6B 4J8UD 3AZKB 4YS3B 4J8VD 4XUJA 4JJNA 1P3BB 4WU8B 3KXBA 1M19B 1M18C 1WWIA 3RELB 5B2IB 1HTAA 4YM6C 3KUYC 1ID3D 3P5JB 1M18D 5BNVB 4XZQA 4CSRB 3W97C 3AZJC 3EPJA 3KUYD 3AZNC 1P3IB 3W97D 2NZDB 4DRAA 3AZJD 1P3LC 3REHA 3AZND 5GSUA 5B31G 3AZGB 1P3LD 3B6FA 5JA4B 3KSYA 5AV8D 3W98C 3MGQB 1KX5C 2G5HC 5E5AC 1TZYC 3C1CD 2CWEA 4J8WA 3W98D 1KX5D 5E5AD 1TZYD 3AZLC 5B0ZD 1B67A 3B0DB 4NE6A 5B33D 1N1JB 2G5IC 4EO5B 3AZLD 5GT0A 5B1LB 1T3UA 5B0YA 2RVQC 3W96A 5AV5A 3WAAB 3AZHC 2Y2KA 4X23A 3X1TB 3AV2A 2RVQD 1P34C 3AZFC 5AV9A 2Y2HA 5AV6B 3O62A 3A1KA 3AZHD 1HQ3C 3AV1D 1P34D 3AZFD 4XUJB 4JJNB 4WU9B 3KXBB 4ZBJB 5GT3D 2BYMA 5AY8C 1S32A 4Z66A 3R45B 5AY8D 4XZQB 3X1SB 5CP6C 5B24B 3EG5B 5B31D 2AROB 3REJA 4CAYB 4WU8C 1P3OC 5CP6D 3AZKD 3V9RA 2F8NG 3REIA 1U35A 4KGCC 3RELC 2IO5C 3LELA 4WU8D 1P3OD 5GXQA 4KGCD 1F66A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3REL D;  3WA9 B;  5CPI A;  1EQZ C;  5BS7 A;  2CV5 C;  3LZ1 A;  5KDM B;  1EQZ D;  4J8W B;  4E45 A;  3MVD A;  1BH9 B;  3WTP E;  2NZD D;  4Z2M H;  3AZM B;  1P3B A;  1BFM A;  1M19 A;  3TU4 B;  5B2I A;  4KUD B;  4NFT A;  3W96 B;  3AYW C;  4CSR A;  3AZI C;  3WTP A;  4X23 B;  1P3I A;  3AV2 B;  2FJ7 C;  1P3F A;  5AV9 B;  3AYW D;  3O62 B;  4HGA C;  2FJ7 D;  3LZ0 C;  3AZG A;  3AFA B;  2BYM B;  1P3K C;  4R8P C;  4Z66 B;  3X1T C;  5B1L D;  3A6N C;  2LY8 A;  1BH8 A;  1P3K D;  2F8N D;  3X1T D;  4XUJ C;  3REJ B;  3KXB C;  4ZBJ C;  3V9R B;  1U35 B;  4XUJ D;  4JJN D;  3KXB D;  5GXQ B;  1M1A A;  4XZQ C;  5C3I C;  3AZE A;  5CPI B;  3WAA A;  3LZ1 B;  4XZQ D;  1P3M B;  1P3P B;  3REH C;  5GSU C;  5AV6 A;  4UUZ B;  3B6F C;  3REH D;  4WU9 A;  5GSU D;  1F1E A;  1ID3 C;  4Z5T B;  3B6F D;  5CHL B;  3KWQ B;  3R45 A;  2JSS A;  2BYK A;  5CPJ A;  5F99 A;  1KX4 B;  3X1S A;  3LJA A;  3WTP B;  5B24 A;  1TAF A;  2ARO A;  3NQU A;  4CAY A;  5DNN A;  4J8W D;  1AOI A;  1P3F B;  3UTB B;  5GT0 C;  5B32 A;  5AV8 C;  5B0Y C;  3W96 C;  5AV5 C;  3WA9 A;  3C1C C;  5GT0 D;  4X23 C;  5B0Y D;  3W96 D;  5DNM B;  5KDM A;  5AV5 D;  1BH8 B;  3W99 A;  5AVB A;  3O62 C;  4X23 D;  3AV2 D;  5B0Z C;  1BH9 A;  5AV9 D;  4QLC B;  4H9S A;  4J8X A;  5B33 C;  3AZM A;  3O62 D;  4H9N B;  4LD9 A;  1S32 C;  3TU4 A;  3X1V B;  5JRG C;  3B6G A;  4KUD A;  3C1B B;  1M1A B;  1S32 D;  4Z66 D;  5BO0 A;  3MNN A;  3AZE B;  4AWL B;  5JRG D;  3AN2 A;  2HUE B;  1KX3 B;  3NQJ A;  5BNX A;  3AV1 C;  3REI C;  3X1U A;  5GT3 C;  3LEL C;  1WWS A;  4YM6 A;  3REI D;  1U35 D;  1F66 C;  4G92 B;  3AFA A;  5B2J B;  5BT1 C;  3LEL D;  2NQB B;  5B1M C;  5GXQ D;  5BS7 C;  2HIO B;  1F66 D;  4Z2M G;  3VH6 A;  5BT1 D;  5B31 C;  5CPI D;  5B1M D;  2BYK B;  4NE3 A;  5CPJ B;  5F99 B;  3MVD C;  3LJA B;  3AZK C;  4YS3 C;  1TAF B;  3NQU B;  5DNN B;  1P3B C;  1AOI B;  1M19 C;  3MVD D;  4WV4 B;  4YS3 D;  5B2I C;  1P3B D;  1TZY A;  1M19 D;  5B32 B;  5B2I D;  3WTP C;  1P3I C;  3B0C T;  5B40 B;  2NZD C;  3W99 B;  3WTP D;  1P3M A;  5AVB B;  1P3P A;  1P3I D;  3AZG C;  4UUZ A;  4J8X B;  4LD9 B;  4ZUX B;  3MGQ C;  3AZG D;  4Z5T A;  4J8U B;  3B6G B;  1P34 A;  3KWQ A;  5BO0 B;  3MNN B;  3VH5 A;  1HQ3 A;  3MGQ D;  5B32 G;  1KX4 A;  4G91 B;  3AN2 B;  3NQJ B;  5BNX B;  3B0D C;  3X1U B;  3UT9 A;  3UTB A;  4NE5 A;  4EO5 C;  4YM6 B;  3KUY B;  1P3A A;  3WKJ A;  5B1L C;  3WAA C;  3AZJ B;  3AZN B;  1M1A D;  5DNM A;  3WAA D;  1P3L B;  5AV6 C;  1KU5 A;  3MGS A;  4JJN C;  4QLC A;  4WU9 C;  5AV6 D;  4H9N A;  1EQZ A;  5CPK A;  3UTA A;  2CV5 A;  3X1V A;  4WU9 D;  5E5A B;  1TZY B;  3REK A;  3C1B A;  5F99 C;  3MGP A;  3X1S C;  5B24 C;  4H9O A;  2ARO C;  3AZL B;  5CPJ D;  1KX3 A;  5F99 D;  3X1S D;  3LJA D;  5B24 D;  1P3G A;  2ARO D;  1AOI D;  5DNN D;  2PYO A;  3WA9 C;  5B2J A;  5G49 B;  3AZI A;  4M6B A;  2NQB A;  5B32 D;  2HIO A;  1Q9C A;  1P34 B;  1ZLA A;  3WA9 D;  3W99 C;  5AVB C;  4J8W C;  1HQ3 B;  3W99 D;  3LZ0 A;  4J8X C;  4LD9 C;  3AZM C;  5AVB D;  3TU4 C;  4R8P A;  3UT9 B;  1JFI B;  4J8X D;  4LD9 D;  3A6N A;  3AZM D;  3B6G C;  4KUD C;  5AVC A;  1P3A B;  3B0C W;  3TU4 D;  3WKJ B;  1R4V A;  3B0B A;  4G91 C;  3B6G D;  4KUD D;  3MGR A;  3AN2 C;  1P3O B;  3MNN D;  4E44 A;  3AV2 C;  4KGC B;  5B40 A;  5AV9 C;  3X1U C;  1B6W A;  2IO5 B;  3AN2 D;  4WNN A;  3MGS B;  3X1U D;  3AFA C;  4H9R B;  1EQZ B;  4YM6 D;  4ZUX A;  5CPK B;  3UTA B;  2CV5 B;  4Z66 C;  4H9P B;  4J8U A;  3AFA D;  4J8V A;  3REK B;  2F8N K;  3MGP B;  2YFW A;  4H9O B;  3REJ C;  1ID3 A;  1U35 C;  2L5A A;  3VH5 W;  4KHA A;  1P3G B;  1M18 A;  3REJ D;  5GXQ C;  3KUY A;  2PYO B;  1ULY A;  3AYW B;  3W97 A;  5CPI C;  3AZI B;  3AZJ A;  3AZN A;  3LZ1 C;  1ZLA B;  2FJ7 B;  1P3M C;  1P3P C;  1P3L A;  3LZ1 D;  4HGA B;  5AV8 A;  3LZ0 B;  1P3M D;  1P3P D;  3C1C A;  1H3O A;  1P3K B;  4H9Q A;  4R8P B;  2F8N B;  1A7W A;  4Z5T C;  3W98 A;  3A6N B;  1KX5 A;  5E5A A;  5AVC B;  3KWQ C;  4DRB A;  2YFV B;  3VH6 T;  4Z5T D;  1KX4 C;  5B0Z A;  3MGR B;  3KWQ D;  5B33 A;  3AZL A;  1HQ3 D;  1KX4 D;  1P3F C;  3UT9 C;  4WNN B;  5JRG A;  3UTB C;  1P3A C;  3WKJ C;  1P3F D;  3UT9 D;  5C3I B;  3UTB D;  5G49 A;  1P3A D;  3WKJ D;  3AZH A;  5DNM C;  3AV1 A;  5FUG A;  4WZS B;  4J8V B;  3AZF A;  3REH B;  5GSU B;  5GT3 A;  5DNM D;  2YFW B;  3MGS C;  3B6F B;  4QLC C;  5B1M A;  5CPK C;  1ID3 B;  5AY8 A;  3UTA C;  1M18 B;  4KHA B;  3X1V C;  3MGS D;  1JFI A;  4QLC D;  5B31 A;  3REK C;  3C1B C;  1M1A C;  5CPK D;  3UTA D;  2CV5 D;  3MGP C;  3X1V D;  3AZE C;  5CP6 A;  4AWL C;  3AZK A;  3W97 B;  4YS3 A;  3VH5 T;  3REK D;  3C1B D;  2HUE C;  4WU8 A;  1KX3 C;  1P3O A;  3MGP D;  3AZE D;  4KGC A;  1P3G C;  3REL A;  1KX3 D;  5GT0 B;  5AV8 B;  5B0Y B;  2PYO C;  1P3G D;  5BNV A;  4G92 C;  5AV5 B;  2F8N H;  5B2J C;  3C1C B;  1H3O B;  2NQB C;  4H9R A;  4H9Q B;  2HIO C;  3W98 B;  2PYO D;  4H9P A;  1KX5 B;  1ZLA C;  5B2J D;  2NZD A;  3AZI D;  2NQB D;  2HIO D;  5CPJ C;  3LJA C;  5B0Z B;  1ZLA D;  5B33 B;  1AOI C;  5DNN C;  5JA4 A;  1S32 B;  3LZ0 D;  3MGQ A;  5JRG B;  5AVC C;  5B32 C;  4R8P D;  3A6N D;  3MGR C;  5AVC D;  3AYW A;  3AZH B;  3AV1 B;  5B40 C;  5FUG B;  3REI B;  3AZF B;  2FJ7 A;  3MGR D;  5GT3 B;  3LEL B;  1N1J A;  5B40 D;  5B1L A;  1F66 B;  4H9S C;  3VH6 W;  5B1M B;  4ZUX C;  5AY8 B;  1P3K A;  2F8N A;  3X1T A;  4J8U C;  4J8V C;  5B31 B;  4ZUX D;  3MNN C;  2YFV A;  3MVD B;  5CP6 B;  4J8U D;  3AZK B;  4YS3 B;  4J8V D;  4XUJ A;  4JJN A;  1P3B B;  4WU8 B;  3KXB A;  1M19 B;  1M18 C;  1WWI A;  3REL B;  5B2I B;  1HTA A;  4YM6 C;  3KUY C;  1ID3 D;  1M18 D;  5BNV B;  4XZQ A;  4CSR B;  3W97 C;  3AZJ C;  3KUY D;  3AZN C;  1P3I B;  3W97 D;  2NZD B;  4DRA A;  3AZJ D;  1P3L C;  3REH A;  3AZN D;  5GSU A;  5B31 G;  3AZG B;  1P3L D;  3B6F A;  5JA4 B;  3KSY A;  5AV8 D;  3W98 C;  3MGQ B;  1KX5 C;  5E5A C;  1TZY C;  3C1C D;  2CWE A;  4J8W A;  3W98 D;  1KX5 D;  5E5A D;  1TZY D;  3AZL C;  5B0Z D;  1B67 A;  3B0D B;  4NE6 A;  5B33 D;  1N1J B;  4EO5 B;  3AZL D;  5GT0 A;  5B1L B;  5B0Y A;  2RVQ C;  3W96 A;  5AV5 A;  3WAA B;  3AZH C;  3X1T B;  4X23 A;  3AV2 A;  2RVQ D;  1P34 C;  3AZF C;  5AV9 A;  5AV6 B;  3O62 A;  3AZH D;  1HQ3 C;  3AV1 D;  1P34 D;  3AZF D;  4XUJ B;  4JJN B;  4WU9 B;  3KXB B;  4ZBJ B;  5GT3 D;  2BYM A;  5AY8 C;  1S32 A;  4Z66 A;  3R45 B;  5AY8 D;  4XZQ B;  3X1S B;  5CP6 C;  5B24 B;  5B31 D;  2ARO B;  3REJ A;  4CAY B;  4WU8 C;  1P3O C;  5CP6 D;  3AZK D;  3V9R A;  2F8N G;  3REI A;  1U35 A;  4KGC C;  3REL C;  2IO5 C;  3LEL A;  4WU8 D;  1P3O D;  5GXQ A;  4KGC D;  1F66 A; 
#chains in the Genus database with same CATH topology
 3REL D;  1W2E A;  3WA9 B;  5CPI A;  1EQZ C;  5BS7 A;  2CV5 C;  3LZ1 A;  5KDM B;  1EQZ D;  2F2A C;  4J8W B;  4E45 A;  3MVD A;  1BH9 B;  3WTP E;  2NZD D;  4Z2M H;  3AZM B;  1P3B A;  1BFM A;  1M19 A;  3TU4 B;  5B2I A;  4KUD B;  4NFT A;  4DQY B;  3W96 B;  3AYW C;  4CSR A;  3AZI C;  3WTP A;  4X23 B;  1P3I A;  3AV2 B;  2FJ7 C;  1P3F A;  5AV9 B;  3AYW D;  3O62 B;  2W8S A;  4HGA C;  2FJ7 D;  3LZ0 C;  3AZG A;  3AFA B;  2BYM B;  1P3K C;  4R8P C;  4Z66 B;  3X1T C;  5B1L D;  3A6N C;  2LY8 A;  1BH8 A;  2XD1 A;  1P3K D;  2F8N D;  3X1T D;  4XUJ C;  3REJ B;  3KXB C;  4ZBJ C;  3V9R B;  1U35 B;  4XUJ D;  4JJN D;  3KXB D;  5GXQ B;  1M1A A;  2DF4 C;  4XZQ C;  5C3I C;  3AZE A;  5CPI B;  3WAA A;  3LZ1 B;  2Y2M A;  4XZQ D;  1P3M B;  1P3P B;  3REH C;  5GSU C;  5AV6 A;  4UUZ B;  3B6F C;  3REH D;  4WU9 A;  5GSU D;  1F1E A;  1ID3 C;  4Z5T B;  3B6F D;  5CHL B;  3KWQ B;  3R45 A;  2JSS A;  2BYK A;  5CPJ A;  5F99 A;  1KX4 B;  3X1S A;  3LJA A;  2J8P A;  3WTP B;  5B24 A;  1TAF A;  2ARO A;  3NQU A;  4CAY A;  5DNN A;  4J8W D;  1AOI A;  1P3F B;  3UTB B;  5GT0 C;  5B32 A;  5B0Y C;  5AV8 C;  3W96 C;  1Z2C B;  5AV5 C;  3WA9 A;  2Y2J A;  3C1C C;  5GT0 D;  4X23 C;  5B0Y D;  3W96 D;  5DNM B;  5KDM A;  5AV5 D;  1BH8 B;  3W99 A;  3H0M C;  5AVB A;  3O62 C;  4X23 D;  3AV2 D;  5B0Z C;  1BH9 A;  5AV9 D;  4QLC B;  4H9S A;  2Y2L A;  4J8X A;  5B33 C;  3O62 D;  4H9N B;  3AZM A;  4LD9 A;  1S32 C;  3TU4 A;  3X1V B;  5JRG C;  3B6G A;  4KUD A;  3C1B B;  1M1A B;  1S32 D;  4Z66 D;  5BO0 A;  3MNN A;  3AZE B;  4AWL B;  5JRG D;  3AN2 A;  2HUE B;  2Y2Q A;  1KX3 B;  3NQJ A;  5BNX A;  3AV1 C;  3REI C;  3X1U A;  5GT3 C;  3LEL C;  1WWS A;  4YM6 A;  3REI D;  1U35 D;  1F66 C;  4G92 B;  3AFA A;  5B2J B;  5BT1 C;  3LEL D;  2NQB B;  5B1M C;  3H0R C;  5GXQ D;  5BS7 C;  2HIO B;  1F66 D;  4Z2M G;  2Y2G A;  3VH6 A;  5BT1 D;  5B31 C;  5B1M D;  5CPI D;  2BYK B;  4NE3 A;  5CPJ B;  5F99 B;  3MVD C;  3LJA B;  3AZK C;  4YS3 C;  1TAF B;  3NQU B;  2Y2P A;  5DNN B;  1P3B C;  1M19 C;  1AOI B;  3MVD D;  4WV4 B;  4YS3 D;  5B2I C;  1P3B D;  1TZY A;  1M19 D;  5B32 B;  5B2I D;  3WTP C;  1P3I C;  3EPH A;  3B0C T;  5B40 B;  2NZD C;  3W99 B;  3WTP D;  3AL0 C;  1P3M A;  5AVB B;  1P3P A;  1P3I D;  3AZG C;  4UUZ A;  4J8X B;  4LD9 B;  4ZUX B;  2ZY4 A;  3MGQ C;  3AZG D;  4Z5T A;  4J8U B;  3B6G B;  1P34 A;  3KWQ A;  5BO0 B;  3MNN B;  3VH5 A;  1HQ3 A;  3MGQ D;  5B32 G;  1KX4 A;  4G91 B;  3AN2 B;  3NQJ B;  5BNX B;  3B0D C;  3X1U B;  3UT9 A;  3UTB A;  4NE5 A;  4EO5 C;  4YM6 B;  3KUY B;  1P3A A;  3WKJ A;  5B1L C;  3WAA C;  3AZJ B;  3AZN B;  1M1A D;  2JCH A;  5DNM A;  3WAA D;  1P3L B;  5AV6 C;  1KU5 A;  3MGS A;  4JJN C;  4QLC A;  4WU9 C;  5AV6 D;  3FDD A;  4H9N A;  1EQZ A;  1PZR A;  5CPK A;  3UTA A;  2CV5 A;  3X1V A;  4WU9 D;  5E5A B;  1TZY B;  3REK A;  3C1B A;  2VQR A;  5F99 C;  3MGP A;  3X1S C;  3F6T A;  5B24 C;  4H9O A;  2ARO C;  3AZL B;  3EPL A;  5CPJ D;  1KX3 A;  5F99 D;  3X1S D;  3LJA D;  5B24 D;  1P3G A;  2ARO D;  1AOI D;  5DNN D;  2PYO A;  3WA9 C;  5B2J A;  5G49 B;  3AZI A;  4M6B A;  2NQB A;  5B32 D;  2HIO A;  1Q9C A;  1P34 B;  1ZLA A;  3WA9 D;  3W99 C;  5AVB C;  4J8W C;  1HQ3 B;  3W99 D;  3LZ0 A;  4J8X C;  4LD9 C;  3AZM C;  5AVB D;  3TU4 C;  4R8P A;  3UT9 B;  1JFI B;  4J8X D;  4LD9 D;  3A6N A;  3AZM D;  3B6G C;  4KUD C;  5AVC A;  1P3A B;  3B0C W;  3TU4 D;  3WKJ B;  1R4V A;  2BG1 A;  3B0B A;  4G91 C;  3B6G D;  4KUD D;  3MGR A;  3AN2 C;  4UPK A;  1P3O B;  3MNN D;  4E44 A;  3AV2 C;  4KGC B;  5B40 A;  5AV9 C;  3X1U C;  1B6W A;  2IO5 B;  3AN2 D;  4WNN A;  2DQN C;  3MGS B;  3X1U D;  3AFA C;  3KFU G;  4H9R B;  1EQZ B;  4YM6 D;  4ZUX A;  5CPK B;  3UTA B;  2CV5 B;  4Z66 C;  4H9P B;  4J8U A;  3AFA D;  4J8V A;  3REK B;  2F8N K;  3MGP B;  2YFW A;  4H9O B;  3REJ C;  2JE5 A;  2Y2I A;  2Y2O A;  1ID3 A;  1U35 C;  2L5A A;  3VH5 W;  4KHA A;  1P3G B;  1M18 A;  3REJ D;  5GXQ C;  3KUY A;  2PYO B;  1ULY A;  3AYW B;  3W97 A;  5CPI C;  3AZI B;  3AZJ A;  3AZN A;  3LZ1 C;  1ZLA B;  2FJ7 B;  1P3M C;  1P3P C;  1P3L A;  3LZ1 D;  4HGA B;  5AV8 A;  3LZ0 B;  2ZM5 A;  1P3M D;  1P3P D;  3C1C A;  1H3O A;  1P3K B;  4H9Q A;  4R8P B;  2F8N B;  1A7W A;  4Z5T C;  3W98 A;  3H0L C;  3A6N B;  1KX5 A;  5E5A A;  5AVC B;  3KWQ C;  4DRB A;  2YFV B;  3VH6 T;  4Z5T D;  1KX4 C;  5B0Z A;  3MGR B;  3KWQ D;  5B33 A;  3AZL A;  1HQ3 D;  1KX4 D;  1P3F C;  3UT9 C;  4WNN B;  5JRG A;  3UTB C;  1P3A C;  3WKJ C;  1P3F D;  3UT9 D;  5C3I B;  3UTB D;  5G49 A;  2Y2N A;  1P3A D;  3WKJ D;  3AZH A;  5DNM C;  3AV1 A;  5FUG A;  4WZS B;  4J8V B;  3AZF A;  3REH B;  5GSU B;  2ZY5 A;  5GT3 A;  5DNM D;  2YFW B;  3MGS C;  3B6F B;  4QLC C;  5B1M A;  5CPK C;  1ID3 B;  5AY8 A;  3UTA C;  1M18 B;  4KHA B;  3X1V C;  3MGS D;  1JFI A;  4QLC D;  5B31 A;  3REK C;  3C1B C;  1M1A C;  5CPK D;  3UTA D;  2CV5 D;  3MGP C;  3X1V D;  3AZE C;  5CP6 A;  4AWL C;  3AZK A;  3EPK A;  4YS3 A;  3W97 B;  3VH5 T;  3REK D;  3C1B D;  2HUE C;  4WU8 A;  1KX3 C;  1P3O A;  3MGP D;  3AZE D;  4KGC A;  2RIQ A;  1P3G C;  3A1I A;  3IP4 C;  3REL A;  1KX3 D;  5GT0 B;  5AV8 B;  5B0Y B;  2PYO C;  1P3G D;  5BNV A;  4G92 C;  5AV5 B;  2F8N H;  5B2J C;  3C1C B;  1H3O B;  2NQB C;  4H9R A;  4H9Q B;  2ZY3 A;  2HIO C;  3W98 B;  2PYO D;  4H9P A;  1KX5 B;  1ZLA C;  5B2J D;  2NZD A;  3AZI D;  2NQB D;  2HIO D;  5CPJ C;  3LJA C;  5B0Z B;  1ZLA D;  5B33 B;  1AOI C;  5DNN C;  5JA4 A;  1S32 B;  3LZ0 D;  3MGQ A;  5JRG B;  5AVC C;  5B32 C;  4R8P D;  3A6N D;  3MGR C;  5AVC D;  3AYW A;  3AZH B;  2FFF B;  3AV1 B;  5B40 C;  5FUG B;  3REI B;  3AZF B;  2FJ7 A;  3MGR D;  5GT3 B;  3LEL B;  1N1J A;  2XD5 A;  5B40 D;  5B1L A;  1F66 B;  4H9S C;  3VH6 W;  5B1M B;  4ZUX C;  5AY8 B;  1P3K A;  2F8N A;  3X1T A;  4J8U C;  2ZY2 A;  4J8V C;  5B31 B;  2UWX A;  4ZUX D;  3MNN C;  2YFV A;  3MVD B;  4WJ3 C;  5CP6 B;  4J8U D;  3AZK B;  4YS3 B;  4J8V D;  4XUJ A;  4JJN A;  1P3B B;  4WU8 B;  3KXB A;  1M19 B;  1M18 C;  1WWI A;  3REL B;  5B2I B;  1HTA A;  4YM6 C;  3KUY C;  1ID3 D;  3P5J B;  1M18 D;  5BNV B;  4XZQ A;  4CSR B;  3W97 C;  3AZJ C;  3EPJ A;  3KUY D;  3AZN C;  1P3I B;  3W97 D;  2NZD B;  4DRA A;  3AZJ D;  1P3L C;  3REH A;  3AZN D;  5GSU A;  5B31 G;  3AZG B;  1P3L D;  3B6F A;  5JA4 B;  3KSY A;  5AV8 D;  3W98 C;  3MGQ B;  1KX5 C;  2G5H C;  5E5A C;  1TZY C;  3C1C D;  2CWE A;  4J8W A;  3W98 D;  1KX5 D;  5E5A D;  1TZY D;  3AZL C;  5B0Z D;  1B67 A;  3B0D B;  4NE6 A;  5B33 D;  1N1J B;  2G5I C;  4EO5 B;  3AZL D;  5GT0 A;  5B1L B;  1T3U A;  5B0Y A;  2RVQ C;  3W96 A;  5AV5 A;  3WAA B;  3AZH C;  2Y2K A;  4X23 A;  3X1T B;  3AV2 A;  2RVQ D;  1P34 C;  3AZF C;  5AV9 A;  2Y2H A;  5AV6 B;  3O62 A;  3A1K A;  3AZH D;  1HQ3 C;  3AV1 D;  1P34 D;  3AZF D;  4XUJ B;  4JJN B;  4WU9 B;  3KXB B;  4ZBJ B;  5GT3 D;  2BYM A;  5AY8 C;  1S32 A;  4Z66 A;  3R45 B;  5AY8 D;  4XZQ B;  3X1S B;  5CP6 C;  5B24 B;  3EG5 B;  5B31 D;  2ARO B;  3REJ A;  4CAY B;  4WU8 C;  1P3O C;  5CP6 D;  3AZK D;  3V9R A;  2F8N G;  3REI A;  1U35 A;  4KGC C;  3REL C;  2IO5 C;  3LEL A;  4WU8 D;  1P3O D;  5GXQ A;  4KGC D;  1F66 A; 
#chains in the Genus database with same CATH homology
 3REL D;  1W2E A;  3WA9 B;  5CPI A;  1EQZ C;  5BS7 A;  2CV5 C;  3LZ1 A;  5KDM B;  1EQZ D;  2F2A C;  4J8W B;  4E45 A;  3MVD A;  1BH9 B;  3WTP E;  2NZD D;  4Z2M H;  3AZM B;  1P3B A;  1BFM A;  1M19 A;  3TU4 B;  5B2I A;  4KUD B;  4NFT A;  4DQY B;  3W96 B;  3AYW C;  4CSR A;  3AZI C;  3WTP A;  4X23 B;  1P3I A;  3AV2 B;  2FJ7 C;  1P3F A;  5AV9 B;  3AYW D;  3O62 B;  2W8S A;  4HGA C;  2FJ7 D;  3LZ0 C;  3AZG A;  3AFA B;  2BYM B;  1P3K C;  4R8P C;  4Z66 B;  3X1T C;  5B1L D;  3A6N C;  2LY8 A;  1BH8 A;  2XD1 A;  1P3K D;  2F8N D;  3X1T D;  4XUJ C;  3REJ B;  3KXB C;  4ZBJ C;  3V9R B;  1U35 B;  4XUJ D;  4JJN D;  3KXB D;  5GXQ B;  1M1A A;  2DF4 C;  4XZQ C;  5C3I C;  3AZE A;  5CPI B;  3WAA A;  3LZ1 B;  2Y2M A;  4XZQ D;  1P3M B;  1P3P B;  3REH C;  5GSU C;  5AV6 A;  4UUZ B;  3B6F C;  3REH D;  4WU9 A;  5GSU D;  1F1E A;  1ID3 C;  4Z5T B;  3B6F D;  5CHL B;  3KWQ B;  3R45 A;  2JSS A;  2BYK A;  5CPJ A;  5F99 A;  1KX4 B;  3X1S A;  3LJA A;  2J8P A;  3WTP B;  5B24 A;  1TAF A;  2ARO A;  3NQU A;  4CAY A;  5DNN A;  4J8W D;  1AOI A;  1P3F B;  3UTB B;  5GT0 C;  5B32 A;  5B0Y C;  5AV8 C;  3W96 C;  1Z2C B;  5AV5 C;  3WA9 A;  2Y2J A;  3C1C C;  5GT0 D;  4X23 C;  5B0Y D;  3W96 D;  5DNM B;  5KDM A;  5AV5 D;  1BH8 B;  3W99 A;  3H0M C;  5AVB A;  3O62 C;  4X23 D;  3AV2 D;  5B0Z C;  1BH9 A;  5AV9 D;  4QLC B;  4H9S A;  2Y2L A;  4J8X A;  5B33 C;  3O62 D;  4H9N B;  3AZM A;  4LD9 A;  1S32 C;  3TU4 A;  3X1V B;  5JRG C;  3B6G A;  4KUD A;  3C1B B;  1M1A B;  1S32 D;  4Z66 D;  5BO0 A;  3MNN A;  3AZE B;  4AWL B;  5JRG D;  3AN2 A;  2HUE B;  2Y2Q A;  1KX3 B;  3NQJ A;  5BNX A;  3AV1 C;  3REI C;  3X1U A;  5GT3 C;  3LEL C;  1WWS A;  4YM6 A;  3REI D;  1U35 D;  1F66 C;  4G92 B;  3AFA A;  5B2J B;  5BT1 C;  3LEL D;  2NQB B;  5B1M C;  3H0R C;  5GXQ D;  5BS7 C;  2HIO B;  1F66 D;  4Z2M G;  2Y2G A;  3VH6 A;  5BT1 D;  5B31 C;  5B1M D;  5CPI D;  2BYK B;  4NE3 A;  5CPJ B;  5F99 B;  3MVD C;  3LJA B;  3AZK C;  4YS3 C;  1TAF B;  3NQU B;  2Y2P A;  5DNN B;  1P3B C;  1M19 C;  1AOI B;  3MVD D;  4WV4 B;  4YS3 D;  5B2I C;  1P3B D;  1TZY A;  1M19 D;  5B32 B;  5B2I D;  3WTP C;  1P3I C;  3EPH A;  3B0C T;  5B40 B;  2NZD C;  3W99 B;  3WTP D;  3AL0 C;  1P3M A;  5AVB B;  1P3P A;  1P3I D;  3AZG C;  4UUZ A;  4J8X B;  4LD9 B;  4ZUX B;  2ZY4 A;  3MGQ C;  3AZG D;  4Z5T A;  4J8U B;  3B6G B;  1P34 A;  3KWQ A;  5BO0 B;  3MNN B;  3VH5 A;  1HQ3 A;  3MGQ D;  5B32 G;  1KX4 A;  4G91 B;  3AN2 B;  3NQJ B;  5BNX B;  3B0D C;  3X1U B;  3UT9 A;  3UTB A;  4NE5 A;  4EO5 C;  4YM6 B;  3KUY B;  1P3A A;  3WKJ A;  5B1L C;  3WAA C;  3AZJ B;  3AZN B;  1M1A D;  2JCH A;  5DNM A;  3WAA D;  1P3L B;  5AV6 C;  1KU5 A;  3MGS A;  4JJN C;  4QLC A;  4WU9 C;  5AV6 D;  3FDD A;  4H9N A;  1EQZ A;  1PZR A;  5CPK A;  3UTA A;  2CV5 A;  3X1V A;  4WU9 D;  5E5A B;  1TZY B;  3REK A;  3C1B A;  2VQR A;  5F99 C;  3MGP A;  3X1S C;  3F6T A;  5B24 C;  4H9O A;  2ARO C;  3AZL B;  3EPL A;  5CPJ D;  1KX3 A;  5F99 D;  3X1S D;  3LJA D;  5B24 D;  1P3G A;  2ARO D;  1AOI D;  5DNN D;  2PYO A;  3WA9 C;  5B2J A;  5G49 B;  3AZI A;  4M6B A;  2NQB A;  5B32 D;  2HIO A;  1Q9C A;  1P34 B;  1ZLA A;  3WA9 D;  3W99 C;  5AVB C;  4J8W C;  1HQ3 B;  3W99 D;  3LZ0 A;  4J8X C;  4LD9 C;  3AZM C;  5AVB D;  3TU4 C;  4R8P A;  3UT9 B;  1JFI B;  4J8X D;  4LD9 D;  3A6N A;  3AZM D;  3B6G C;  4KUD C;  5AVC A;  1P3A B;  3B0C W;  3TU4 D;  3WKJ B;  1R4V A;  2BG1 A;  3B0B A;  4G91 C;  3B6G D;  4KUD D;  3MGR A;  3AN2 C;  4UPK A;  1P3O B;  3MNN D;  4E44 A;  3AV2 C;  4KGC B;  5B40 A;  5AV9 C;  3X1U C;  1B6W A;  2IO5 B;  3AN2 D;  4WNN A;  2DQN C;  3MGS B;  3X1U D;  3AFA C;  3KFU G;  4H9R B;  1EQZ B;  4YM6 D;  4ZUX A;  5CPK B;  3UTA B;  2CV5 B;  4Z66 C;  4H9P B;  4J8U A;  3AFA D;  4J8V A;  3REK B;  2F8N K;  3MGP B;  2YFW A;  4H9O B;  3REJ C;  2JE5 A;  2Y2I A;  2Y2O A;  1ID3 A;  1U35 C;  2L5A A;  3VH5 W;  4KHA A;  1P3G B;  1M18 A;  3REJ D;  5GXQ C;  3KUY A;  2PYO B;  1ULY A;  3AYW B;  3W97 A;  5CPI C;  3AZI B;  3AZJ A;  3AZN A;  3LZ1 C;  1ZLA B;  2FJ7 B;  1P3M C;  1P3P C;  1P3L A;  3LZ1 D;  4HGA B;  5AV8 A;  3LZ0 B;  2ZM5 A;  1P3M D;  1P3P D;  3C1C A;  1H3O A;  1P3K B;  4H9Q A;  4R8P B;  2F8N B;  1A7W A;  4Z5T C;  3W98 A;  3H0L C;  3A6N B;  1KX5 A;  5E5A A;  5AVC B;  3KWQ C;  4DRB A;  2YFV B;  3VH6 T;  4Z5T D;  1KX4 C;  5B0Z A;  3MGR B;  3KWQ D;  5B33 A;  3AZL A;  1HQ3 D;  1KX4 D;  1P3F C;  3UT9 C;  4WNN B;  5JRG A;  3UTB C;  1P3A C;  3WKJ C;  1P3F D;  3UT9 D;  5C3I B;  3UTB D;  5G49 A;  2Y2N A;  1P3A D;  3WKJ D;  3AZH A;  5DNM C;  3AV1 A;  5FUG A;  4WZS B;  4J8V B;  3AZF A;  3REH B;  5GSU B;  2ZY5 A;  5GT3 A;  5DNM D;  2YFW B;  3MGS C;  3B6F B;  4QLC C;  5B1M A;  5CPK C;  1ID3 B;  5AY8 A;  3UTA C;  1M18 B;  4KHA B;  3X1V C;  3MGS D;  1JFI A;  4QLC D;  5B31 A;  3REK C;  3C1B C;  1M1A C;  5CPK D;  3UTA D;  2CV5 D;  3MGP C;  3X1V D;  3AZE C;  5CP6 A;  4AWL C;  3AZK A;  3EPK A;  4YS3 A;  3W97 B;  3VH5 T;  3REK D;  3C1B D;  2HUE C;  4WU8 A;  1KX3 C;  1P3O A;  3MGP D;  3AZE D;  4KGC A;  2RIQ A;  1P3G C;  3A1I A;  3IP4 C;  3REL A;  1KX3 D;  5GT0 B;  5AV8 B;  5B0Y B;  2PYO C;  1P3G D;  5BNV A;  4G92 C;  5AV5 B;  2F8N H;  5B2J C;  3C1C B;  1H3O B;  2NQB C;  4H9R A;  4H9Q B;  2ZY3 A;  2HIO C;  3W98 B;  2PYO D;  4H9P A;  1KX5 B;  1ZLA C;  5B2J D;  2NZD A;  3AZI D;  2NQB D;  2HIO D;  5CPJ C;  3LJA C;  5B0Z B;  1ZLA D;  5B33 B;  1AOI C;  5DNN C;  5JA4 A;  1S32 B;  3LZ0 D;  3MGQ A;  5JRG B;  5AVC C;  5B32 C;  4R8P D;  3A6N D;  3MGR C;  5AVC D;  3AYW A;  3AZH B;  2FFF B;  3AV1 B;  5B40 C;  5FUG B;  3REI B;  3AZF B;  2FJ7 A;  3MGR D;  5GT3 B;  3LEL B;  1N1J A;  2XD5 A;  5B40 D;  5B1L A;  1F66 B;  4H9S C;  3VH6 W;  5B1M B;  4ZUX C;  5AY8 B;  1P3K A;  2F8N A;  3X1T A;  4J8U C;  2ZY2 A;  4J8V C;  5B31 B;  2UWX A;  4ZUX D;  3MNN C;  2YFV A;  3MVD B;  4WJ3 C;  5CP6 B;  4J8U D;  3AZK B;  4YS3 B;  4J8V D;  4XUJ A;  4JJN A;  1P3B B;  4WU8 B;  3KXB A;  1M19 B;  1M18 C;  1WWI A;  3REL B;  5B2I B;  1HTA A;  4YM6 C;  3KUY C;  1ID3 D;  3P5J B;  1M18 D;  5BNV B;  4XZQ A;  4CSR B;  3W97 C;  3AZJ C;  3EPJ A;  3KUY D;  3AZN C;  1P3I B;  3W97 D;  2NZD B;  4DRA A;  3AZJ D;  1P3L C;  3REH A;  3AZN D;  5GSU A;  5B31 G;  3AZG B;  1P3L D;  3B6F A;  5JA4 B;  3KSY A;  5AV8 D;  3W98 C;  3MGQ B;  1KX5 C;  2G5H C;  5E5A C;  1TZY C;  3C1C D;  2CWE A;  4J8W A;  3W98 D;  1KX5 D;  5E5A D;  1TZY D;  3AZL C;  5B0Z D;  1B67 A;  3B0D B;  4NE6 A;  5B33 D;  1N1J B;  2G5I C;  4EO5 B;  3AZL D;  5GT0 A;  5B1L B;  1T3U A;  5B0Y A;  2RVQ C;  3W96 A;  5AV5 A;  3WAA B;  3AZH C;  2Y2K A;  4X23 A;  3X1T B;  3AV2 A;  2RVQ D;  1P34 C;  3AZF C;  5AV9 A;  2Y2H A;  5AV6 B;  3O62 A;  3A1K A;  3AZH D;  1HQ3 C;  3AV1 D;  1P34 D;  3AZF D;  4XUJ B;  4JJN B;  4WU9 B;  3KXB B;  4ZBJ B;  5GT3 D;  2BYM A;  5AY8 C;  1S32 A;  4Z66 A;  3R45 B;  5AY8 D;  4XZQ B;  3X1S B;  5CP6 C;  5B24 B;  3EG5 B;  5B31 D;  2ARO B;  3REJ A;  4CAY B;  4WU8 C;  1P3O C;  5CP6 D;  3AZK D;  3V9R A;  2F8N G;  3REI A;  1U35 A;  4KGC C;  3REL C;  2IO5 C;  3LEL A;  4WU8 D;  1P3O D;  5GXQ A;  4KGC D;  1F66 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...