2AROB

Crystal structure of the native histone octamer to 2.1 angstrom resolution, crystalised in the presence of s-nitrosoglutathione
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
92
structure length
92
Chain Sequence
RKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Histone H2A-IV
publication title The oxidised histone octamer does not form a H3 disulphide bond.
pubmed doi rcsb
total genus 36
structure length 92
sequence length 92
chains with identical sequence F
ec nomenclature
pdb deposition date 2005-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2aroB00
1M1AC 5AV5C 4J8VA 3AZKC 5CPIA 3MVDC 3O62A 4Z2MH 5B33B 5DNMA 5AV8C 5AY8B 4XZQB 5GT3A 4YS3A 5CPJA 4YM6A 3B6GA 2HUEC 3WKJB 3AZFC 5CP6C 3UT9A 5DNNB 1EQZD 2NZDA 5E5AC 1P3BB 3R45B 3C1CD 3AZLC 3KXBB 1KX5A 5B1LB 4WZSB 3C1BA 1P3FC 4WV4B 4J8VD 3AYWB 5CPID 3W97C 4H9PB 1ULYA 3MNNA 3O62D 4YS3D 5DNMD 2CWEA 5GT3D 4YM6D 3B6GD 3X1UA 5JRGB 3RELA 2F8NH 4J8XB 1TZYA 4H9QB 3KWQA 3MGQB 3X1VB 1F66A 1BFMA 5BS7C 3UT9D 5B2JB 5BNXA 1P3GC 1KX5D 3C1BD 3KUYB 3WA9B 5B1MC 3W96B 3MNND 5BNVB 4R8PB 4WU8B 1M18A 3LELC 3X1UD 5B2IB 5AVCA 3AZEB 1ZLAA 4E45A 3MGRA 1F66D 1TZYD 4H9SC 3KWQD 1P3LC 3AZGD 2NQBA 1B6WA 1M19A 3X1TC 4LD9A 2CV5C 3AZMC 2F8ND 1KX4B 5GSUC 3A6NA 4XUJB 1P3MB 1TAFB 5AV6B 3W99B 3UTAA 1ID3A 2AROC 4Z66A 3VH5T 4QLCC 4X23C 3AV2B 5B40B 2FJ7C 1M18D 1H3OA 3NQUB 4ZUXC 1P34C 1ZLAD 4DRAA 3AZJB 3TU4B 4UUZB 3MGRD 1M1AA 5AV5A 4E44A 5AVBB 3W98D 4AWLC 3MGSC 3AZKA 1M19D 2NQBD 4Z5TC 4LD9D 5B32B 3REKC 4J8WD 3WAAC 3LJAC 3A6ND 3AZNC 1ID3D 4Z66D 3AZFA 5CP6A 2BYKB 5E5AA 3AZLA 3RELC 1M1AD 5AV5D 3W97A 3AZKD 2YFWB 3MVDD 3REHB 3X1SC 5AV8D 2HIOC 3LZ0C 1S32C 5B32G 4J8VB 5CPIB 5BS7A 5CP6D 3O62B 3AZFD 5E5AD 1F1EA 4YS3B 4M6BA 4YM6B 3AZLD 1P3GA 3B6GB 3REJA 1AOIC 1P3FD 5AV9C 1HQ3C 3REIB 3W97D 5B1MA 4G92B 2JSSA 3LELA 5B33C 5AY8C 4XZQC 1KX5B 3C1BB 3KSYA 5B31G 4H9SA 1P3LA 3UTAC 3MNNB 4NE3A 3X1TA 3VH6T 2CV5A 4G91C 3AZMA 1P3PB 1P3GD 5GSUA 2IO5C 1F66B 1TZYB 4H9OA 3KWQB 5B1MD 2AROA 3AZGB 4QLCA 4X23A 4EO5C 2FJ7A 3LELD 4ZUXA 2F8NB 3B0DB 1P34A 5GT0A 5JRGC 4H9RA 1P3LD 3MGSA 3X1TD 4Z5TA 3X1VC 5FUGA 4J8XC 2CV5D 3REKA 3AZMD 3WAAA 1U35B 5B2JC 1ZLAB 3LJAA 5GSUD 3AZNA 1BH8A 2BYMA 2F8NK 2AROD 3W98B 2NQBB 1M19B 4QLCD 4HGAB 3UTBC 4X23D 2FJ7D 4LD9B 4NE6A 4J8WB 5CPJD 4WNNA 4ZUXD 4R8PC 1P34D 1P3AC 3AFAB 5CHLB 5B0ZB 5B2IC 3AZEC 2F8NG 3NQJB 5F99C 5JA4B 4KUDA 3MGSD 4Z5TD 4CAYB 1A7WA 3X1SA 3REKD 2NZDD 2HIOA 3LZ0A 3WAAD 5KDMA 3LJAD 3REJC 1S32A 3AN2C 3AZND 3B0CT 3AZKB 5AV6C 3MVDB 5AV8B 3WTPC 5B40C 1AOIA 1KX3C 3RELD 1P3IA 5AV9A 3LZ1C 1HQ3A 5GXQB 3TU4C 5BT1C 5AVBC 5CP6B 5BO0B 5CPKC 2HIOD 4KHAB 5E5AB 3LZ0D 5B32C 5B33A 5C3IB 5AY8A 4XZQA 1S32D 2PYOB 1P3FB 3W97B 4JJNC 2LY8A 1JFIA 3AV1C 1WWSA 5DNNA 1P3BA 3AZHB 1P3OC 3R45A 5AVCD 1AOID 5GT0C 3MGPB 5AV9D 1HQ3D 4J8UB 4H9PA 4NFTA 5B0YB 5B33D 3REHC 5AY8D 4XZQD 1P3GB 5B31C 3VH5A 5JRGA 3UTAD 4J8XA 3X1VA 3AZIC 4WU9C 5B2JA 4H9NB 1P3KC 4KUDC 1P3LB 4KGCC 3WA9A 5G49A 3X1TB 3REIC 3UTBA 3W96A 1EQZB 3B6FC 4R8PA 3WTPE 3C1CB 2YFVA 1P3AA 5B24C 5GSUB 5B2IA 3AZEA 5F99A 4ZBJC 2AROB 3X1VD 4QLCB 4X23B 2FJ7B 5DNMB 5GT3B 5CPJB 5B2JD 1P34B 1P3PC 3AN2A 1P3IC 3MGSB 1TAFA 5AV6A 3UTBD 5FUGB 3UT9B 3AZGC 3REKB 2NZDB 3WTPA 3WAAB 5B40A 1WWIA 4R8PD 1P3AD 1KX3A 3B0BA 5B2ID 3AZNB 3AZED 1BH9A 5F99D 3WKJC 1BH8B 2BYMB 4CSRA 3LZ1A 4UUZA 3TU4A 5AVBA 5CPKA 5DNNC 4WNNB 3VH5W 5B32A 1P3BC 3X1UB 3REJD 1U35C 3AN2D 3KXBC 3RELB 1Q9CA 5B1LC 4JJNA 1R4VA 4DRBA 4Z2MG 3AYWC 3AV1A 4HGAC 3WTPD 2BYKA 2HIOB 5B40D 3LZ0B 5BNXB 1P3OA 4J8WC 5KDMB 1KX3D 3VH6A 3AFAC 3LZ1D 5B0ZC 3TU4D 5BT1D 5AVBD 3MGQC 5CPKD 1M18B 5B32D 3REHA 5B31A 5AVCB 3MGRB 1HQ3B 4JJND 3KUYC 3WA9C 3W96C 3AZIA 3AV1D 4WU9A 3V9RA 1P3OD 4WU8C 5GT0D 1P3KA 3A6NB 4KGCA 3UTAB 1ID3B 4Z66B 5GXQC 3REIA 4G91B 1JFIB 1H3OB 3REHD 3B6FA 5B31D 5B24A 5C3IC 2IO5B 4NE5A 5AV5B 1M1AB 1KX4C 2PYOC 4XUJC 1P3MC 3W99C 1B67A 3AZID 4EO5B 4WU9D 3AV2C 1N1JA 1P3PA 1P3KD 2HUEB 3AZHC 4KUDD 3AZJC 3MGPC 4KGCD 3REID 3AZFB 3X1SD 3AZGA 2RVQC 4J8UC 3B6FD 3VH6W 3AZLB 2F8NA 5B0YC 5B24D 3WKJA 5G49B 3UTBB 2YFVB 1P3AB 1P3PD 1U35A 3KXBA 1P3ID 5F99B 5B1LA 3AYWA 3W98A 1EQZC 4J8WA 3REJB 3C1CC 3AN2B 3AFAA 3WKJD 5B0ZA 5B1MB 3NQJA 5JA4A 4J8VC 3MGQA 4H9QA 2L5AA 5CPIC 3O62C 4CAYA 3WTPB 5DNND 3LELB 4YS3C 5DNMC 1P3BD 5GT3C 5CPJC 1U35D 1KX3B 4YM6C 3KXBD 3B6GC 1BH9B 5B1LD 4CSRB 3LZ1B 3KUYA 3AYWD 5CPKB 2CV5B 3MVDA 3AZMB 4G92C 3UT9C 5BNVA 2NZDC 5AV8A 4WU8A 3AFAD 5JRGD 1KX5C 1KU5A 5B0ZD 3C1BC 4H9OB 4JJNB 4J8XD 3MGQD 5GXQA 3B0CW 3AV1B 3MNNC 5BO0A 4ZUXB 4KHAA 1P3OB 5GT0B 3X1UC 1KX4A 4H9RB 2PYOA 1P3FA 3KUYD 4AWLB 4XUJA 1P3MA 3WA9D 1F66C 1TZYC 4Z5TB 3KWQC 3W99A 3W96D 3AV2A 4WU8D 5B31B 3NQUA 3LJAB 3AZHA 3B0DC 3AZJA 3MGPA 5GXQD 3AZIB 4WU9B 4J8UA 3V9RB 1M18C 5B0YA 1P3KB 1ZLAC 5AVCC 1KX4D 4KUDB 2PYOD 4KGCB 4XUJD 1P3MD 3MGRC 3W99D 5AV6D 3W98C 2NQBC 3X1SB 1M19C 4LD9C 3AV2D 3B6FB 5B24B 4H9NA 3AZHD 1S32B 3AZJD 3MGPD 4ZBJB 3A6NC 1HTAA 1ID3C 2YFWA 2RVQD 4Z66C 4J8UD 1EQZA 1N1JB 5B0YD 1AOIB 3C1CA 1P3IB 5AV9B
chains in the Genus database with same CATH superfamily
1M1AC 5AV5C 4J8VA 3AZKC 5CPIA 3MVDC 3O62A 4Z2MH 5B33B 5DNMA 5AV8C 5AY8B 4XZQB 5GT3A 4YS3A 5CPJA 4YM6A 3B6GA 2HUEC 3WKJB 3AZFC 5CP6C 3UT9A 5DNNB 1EQZD 2NZDA 5E5AC 1P3BB 3R45B 3C1CD 3AZLC 3KXBB 1KX5A 5B1LB 4WZSB 3C1BA 1P3FC 4WV4B 4J8VD 2Y2KA 3AYWB 5CPID 3W97C 4H9PB 1ULYA 3MNNA 3O62D 4YS3D 5DNMD 2CWEA 5GT3D 4YM6D 3B6GD 3X1UA 5JRGB 3RELA 2F8NH 4J8XB 1TZYA 4H9QB 3KWQA 3MGQB 3X1VB 1F66A 1BFMA 5BS7C 3UT9D 2G5HC 5B2JB 5BNXA 1P3GC 1KX5D 3C1BD 3KUYB 3WA9B 5B1MC 3W96B 3MNND 2DQNC 2JE5A 5BNVB 4R8PB 4WU8B 1M18A 3LELC 3X1UD 5B2IB 5AVCA 3AZEB 1ZLAA 4E45A 3MGRA 1F66D 1TZYD 4H9SC 3P5JB 3KWQD 1P3LC 3AZGD 2NQBA 1B6WA 1M19A 3X1TC 4LD9A 2CV5C 3AZMC 2F8ND 1KX4B 5GSUC 3A6NA 4XUJB 1P3MB 1TAFB 5AV6B 3W99B 3UTAA 1ID3A 2AROC 4Z66A 3VH5T 4QLCC 4X23C 3AV2B 5B40B 2FJ7C 1W2EA 1M18D 1H3OA 3NQUB 4ZUXC 1P34C 1ZLAD 4DRAA 3AZJB 3IP4C 3TU4B 4UUZB 3MGRD 1M1AA 5AV5A 4E44A 5AVBB 3W98D 4AWLC 3MGSC 3AZKA 1M19D 2NQBD 4Z5TC 4LD9D 5B32B 3REKC 4J8WD 3WAAC 2Y2LA 3LJAC 3A6ND 3AZNC 1ID3D 4Z66D 3AZFA 5CP6A 2BYKB 5E5AA 3AZLA 2J8PA 3RELC 1M1AD 5AV5D 3H0MC 3W97A 3AZKD 2YFWB 1T3UA 3MVDD 3REHB 3X1SC 5AV8D 2HIOC 3LZ0C 2Y2PA 1S32C 5B32G 4J8VB 5CPIB 5BS7A 5CP6D 3O62B 3AZFD 3EPKA 5E5AD 1F1EA 4YS3B 4M6BA 4YM6B 3AZLD 1P3GA 3B6GB 3REJA 1AOIC 2ZY3A 1P3FD 5AV9C 1HQ3C 3REIB 3W97D 5B1MA 4G92B 2JSSA 3LELA 5B33C 5AY8C 4XZQC 1KX5B 3C1BB 3KSYA 5B31G 4H9SA 1P3LA 3UTAC 3MNNB 4NE3A 3X1TA 3VH6T 2CV5A 4G91C 3AZMA 1P3PB 1P3GD 5GSUA 2IO5C 1F66B 1TZYB 4H9OA 3KWQB 5B1MD 2AROA 3AZGB 4QLCA 4X23A 4EO5C 2FJ7A 3LELD 4ZUXA 2F8NB 3B0DB 1P34A 5GT0A 5JRGC 4H9RA 1P3LD 3MGSA 3X1TD 4Z5TA 3X1VC 5FUGA 4J8XC 2CV5D 2ZY4A 3REKA 3AZMD 3A1IA 3WAAA 1U35B 5B2JC 1ZLAB 3LJAA 5GSUD 3AZNA 1BH8A 2BYMA 2F8NK 2AROD 3W98B 2NQBB 1M19B 4QLCD 4HGAB 3UTBC 4X23D 2FJ7D 4LD9B 4NE6A 4J8WB 5CPJD 4WNNA 4ZUXD 4R8PC 1P34D 1P3AC 3AFAB 5CHLB 5B0ZB 5B2IC 3AZEC 2F8NG 3NQJB 5F99C 5JA4B 4KUDA 3MGSD 4Z5TD 4CAYB 1A7WA 3X1SA 3REKD 2NZDD 2HIOA 3LZ0A 3WAAD 5KDMA 3LJAD 3REJC 1S32A 3AN2C 3AZND 2UWXA 3B0CT 3AZKB 5AV6C 2ZY5A 3MVDB 5AV8B 3WTPC 5B40C 1AOIA 1KX3C 3EPHA 3RELD 1P3IA 2DF4C 5AV9A 2Y2NA 1HQ3A 3EG5B 5GXQB 3LZ1C 3TU4C 5BT1C 5AVBC 5CP6B 5BO0B 5CPKC 2BG1A 4WJ3C 2Y2IA 2W8SA 2HIOD 4KHAB 5E5AB 3LZ0D 5B32C 5B33A 5C3IB 5AY8A 4XZQA 1S32D 2PYOB 1P3FB 3W97B 4JJNC 2LY8A 1JFIA 3AV1C 1WWSA 5DNNA 1P3BA 3AZHB 1P3OC 3H0RC 3R45A 5AVCD 1AOID 5GT0C 3MGPB 5AV9D 2JCHA 1HQ3D 2Y2OA 4J8UB 4H9PA 3EPLA 4NFTA 5B0YB 5B33D 3REHC 5AY8D 4XZQD 1P3GB 5B31C 3VH5A 5JRGA 3AL0C 3UTAD 4J8XA 3X1VA 3AZIC 4WU9C 5B2JA 4H9NB 1P3KC 2Y2QA 4KUDC 1P3LB 4KGCC 3EPJA 3WA9A 5G49A 3X1TB 3REIC 3UTBA 3W96A 1EQZB 3B6FC 4R8PA 3WTPE 3C1CB 2YFVA 1P3AA 5B24C 5GSUB 5B2IA 3AZEA 5F99A 4ZBJC 2AROB 3X1VD 4QLCB 4X23B 2FJ7B 5DNMB 5GT3B 5CPJB 5B2JD 1P34B 3FDDA 1P3PC 3AN2A 1P3IC 3MGSB 1TAFA 5AV6A 3UTBD 5FUGB 3UT9B 3AZGC 3REKB 2NZDB 3WTPA 3WAAB 5B40A 1WWIA 4R8PD 1P3AD 1KX3A 3B0BA 5B2ID 3AZNB 3AZED 1BH9A 5F99D 3WKJC 1BH8B 2BYMB 4CSRA 3LZ1A 4UUZA 3TU4A 5AVBA 5CPKA 5DNNC 4WNNB 3VH5W 5B32A 1P3BC 3X1UB 3REJD 1U35C 3A1KA 3AN2D 3KXBC 3RELB 1Q9CA 5B1LC 4JJNA 1R4VA 4DRBA 4Z2MG 3AYWC 3AV1A 4HGAC 3WTPD 2BYKA 2HIOB 5B40D 3LZ0B 5BNXB 1P3OA 4J8WC 5KDMB 1KX3D 3VH6A 3AFAC 2VQRA 3LZ1D 5B0ZC 3TU4D 5BT1D 5AVBD 3MGQC 5CPKD 1M18B 5B32D 3REHA 3F6TA 5B31A 5AVCB 3MGRB 1HQ3B 4JJND 3KUYC 3WA9C 3H0LC 3W96C 3AZIA 3AV1D 4WU9A 3V9RA 1P3OD 4WU8C 5GT0D 1P3KA 2FFFB 3A6NB 4KGCA 1Z2CB 2Y2HA 3UTAB 1ID3B 4Z66B 5GXQC 3REIA 4G91B 1JFIB 1H3OB 3REHD 3B6FA 5B31D 5B24A 5C3IC 2IO5B 4NE5A 5AV5B 1M1AB 1KX4C 2PYOC 4XUJC 1P3MC 3W99C 1B67A 3AZID 4EO5B 4WU9D 3AV2C 1N1JA 1P3PA 1P3KD 2HUEB 3AZHC 4KUDD 3AZJC 3MGPC 4KGCD 3REID 3AZFB 3X1SD 3AZGA 2RVQC 4J8UC 3B6FD 3VH6W 3AZLB 2F8NA 5B0YC 5B24D 3WKJA 2XD5A 5G49B 3UTBB 2YFVB 1P3AB 1P3PD 1U35A 2F2AC 3KXBA 1P3ID 5F99B 5B1LA 3AYWA 3W98A 1EQZC 4J8WA 3REJB 3C1CC 3AN2B 3AFAA 3WKJD 5B0ZA 2XD1A 5B1MB 3NQJA 5JA4A 4J8VC 3MGQA 4H9QA 2L5AA 5CPIC 3O62C 4CAYA 3WTPB 5DNND 3LELB 4YS3C 5DNMC 1P3BD 2RIQA 5GT3C 5CPJC 1U35D 1KX3B 4YM6C 3KXBD 3B6GC 1BH9B 5B1LD 4CSRB 3LZ1B 3KUYA 3AYWD 5CPKB 2CV5B 3MVDA 3AZMB 4G92C 3UT9C 5BNVA 2NZDC 5AV8A 4WU8A 3AFAD 5JRGD 1KX5C 1KU5A 5B0ZD 3C1BC 4H9OB 4JJNB 4J8XD 3MGQD 5GXQA 3B0CW 3AV1B 3MNNC 5BO0A 2Y2JA 4ZUXB 4KHAA 1P3OB 2Y2GA 5GT0B 3X1UC 1KX4A 4H9RB 2PYOA 1P3FA 3KUYD 2ZM5A 4XUJA 4AWLB 1P3MA 1F66C 1TZYC 4Z5TB 3KWQC 3W99A 3WA9D 3W96D 3AV2A 4WU8D 5B31B 3NQUA 3LJAB 3AZHA 3B0DC 3AZJA 3MGPA 5GXQD 3AZIB 2ZY2A 4WU9B 4J8UA 3V9RB 1M18C 5B0YA 1P3KB 2Y2MA 5AVCC 1ZLAC 1KX4D 4KUDB 2PYOD 4KGCB 4XUJD 1P3MD 3MGRC 3W99D 5AV6D 4DQYB 3W98C 2NQBC 3X1SB 1M19C 4LD9C 3AV2D 3B6FB 2G5IC 5B24B 4H9NA 3AZHD 1S32B 3AZJD 3MGPD 4ZBJB 3A6NC 1HTAA 1ID3C 2YFWA 2RVQD 4Z66C 4J8UD 1PZRA 1EQZA 4UPKA 1N1JB 5B0YD 1AOIB 3C1CA 3KFUG 1P3IB 5AV9B
chains in the Genus database with same CATH topology
1M1AC 5AV5C 4J8VA 3AZKC 5CPIA 3MVDC 3O62A 4Z2MH 5B33B 5DNMA 5AV8C 5AY8B 4XZQB 5GT3A 4YS3A 5CPJA 4YM6A 3B6GA 2HUEC 3WKJB 3AZFC 5CP6C 3UT9A 5DNNB 1EQZD 2NZDA 5E5AC 1P3BB 3R45B 3C1CD 3AZLC 3KXBB 1KX5A 5B1LB 4WZSB 3C1BA 1P3FC 4WV4B 4J8VD 2Y2KA 3AYWB 5CPID 3W97C 4H9PB 1ULYA 3MNNA 3O62D 4YS3D 5DNMD 2CWEA 5GT3D 4YM6D 3B6GD 3X1UA 5JRGB 3RELA 2F8NH 4J8XB 1TZYA 4H9QB 3KWQA 3MGQB 3X1VB 1F66A 1BFMA 5BS7C 3UT9D 2G5HC 5B2JB 5BNXA 1P3GC 1KX5D 3C1BD 3KUYB 3WA9B 5B1MC 3W96B 3MNND 2DQNC 2JE5A 5BNVB 4R8PB 4WU8B 1M18A 3LELC 3X1UD 5B2IB 5AVCA 3AZEB 1ZLAA 4E45A 3MGRA 1F66D 1TZYD 4H9SC 3P5JB 3KWQD 1P3LC 3AZGD 2NQBA 1B6WA 1M19A 3X1TC 4LD9A 2CV5C 3AZMC 2F8ND 1KX4B 5GSUC 3A6NA 4XUJB 1P3MB 1TAFB 5AV6B 3W99B 3UTAA 1ID3A 2AROC 4Z66A 3VH5T 4QLCC 4X23C 3AV2B 5B40B 2FJ7C 1W2EA 1M18D 1H3OA 3NQUB 4ZUXC 1P34C 1ZLAD 4DRAA 3AZJB 3IP4C 3TU4B 4UUZB 3MGRD 1M1AA 5AV5A 4E44A 5AVBB 3W98D 4AWLC 3MGSC 3AZKA 1M19D 2NQBD 4Z5TC 4LD9D 5B32B 3REKC 4J8WD 3WAAC 2Y2LA 3LJAC 3A6ND 3AZNC 1ID3D 4Z66D 3AZFA 5CP6A 2BYKB 5E5AA 3AZLA 2J8PA 3RELC 1M1AD 5AV5D 3H0MC 3W97A 3AZKD 2YFWB 1T3UA 3MVDD 3REHB 3X1SC 5AV8D 2HIOC 3LZ0C 2Y2PA 1S32C 5B32G 4J8VB 5CPIB 5BS7A 5CP6D 3O62B 3AZFD 3EPKA 5E5AD 1F1EA 4YS3B 4M6BA 4YM6B 3AZLD 1P3GA 3B6GB 3REJA 1AOIC 2ZY3A 1P3FD 5AV9C 1HQ3C 3REIB 3W97D 5B1MA 4G92B 2JSSA 3LELA 5B33C 5AY8C 4XZQC 1KX5B 3C1BB 3KSYA 5B31G 4H9SA 1P3LA 3UTAC 3MNNB 4NE3A 3X1TA 3VH6T 2CV5A 4G91C 3AZMA 1P3PB 1P3GD 5GSUA 2IO5C 1F66B 1TZYB 4H9OA 3KWQB 5B1MD 2AROA 3AZGB 4QLCA 4X23A 4EO5C 2FJ7A 3LELD 4ZUXA 2F8NB 3B0DB 1P34A 5GT0A 5JRGC 4H9RA 1P3LD 3MGSA 3X1TD 4Z5TA 3X1VC 5FUGA 4J8XC 2CV5D 2ZY4A 3REKA 3AZMD 3A1IA 3WAAA 1U35B 5B2JC 1ZLAB 3LJAA 5GSUD 3AZNA 1BH8A 2BYMA 2F8NK 2AROD 3W98B 2NQBB 1M19B 4QLCD 4HGAB 3UTBC 4X23D 2FJ7D 4LD9B 4NE6A 4J8WB 5CPJD 4WNNA 4ZUXD 4R8PC 1P34D 1P3AC 3AFAB 5CHLB 5B0ZB 5B2IC 3AZEC 2F8NG 3NQJB 5F99C 5JA4B 4KUDA 3MGSD 4Z5TD 4CAYB 1A7WA 3X1SA 3REKD 2NZDD 2HIOA 3LZ0A 3WAAD 5KDMA 3LJAD 3REJC 1S32A 3AN2C 3AZND 2UWXA 3B0CT 3AZKB 5AV6C 2ZY5A 3MVDB 5AV8B 3WTPC 5B40C 1AOIA 1KX3C 3EPHA 3RELD 1P3IA 2DF4C 5AV9A 2Y2NA 1HQ3A 3EG5B 5GXQB 3LZ1C 3TU4C 5BT1C 5AVBC 5CP6B 5BO0B 5CPKC 2BG1A 4WJ3C 2Y2IA 2W8SA 2HIOD 4KHAB 5E5AB 3LZ0D 5B32C 5B33A 5C3IB 5AY8A 4XZQA 1S32D 2PYOB 1P3FB 3W97B 4JJNC 2LY8A 1JFIA 3AV1C 1WWSA 5DNNA 1P3BA 3AZHB 1P3OC 3H0RC 3R45A 5AVCD 1AOID 5GT0C 3MGPB 5AV9D 2JCHA 1HQ3D 2Y2OA 4J8UB 4H9PA 3EPLA 4NFTA 5B0YB 5B33D 3REHC 5AY8D 4XZQD 1P3GB 5B31C 3VH5A 5JRGA 3AL0C 3UTAD 4J8XA 3X1VA 3AZIC 4WU9C 5B2JA 4H9NB 1P3KC 2Y2QA 4KUDC 1P3LB 4KGCC 3EPJA 3WA9A 5G49A 3X1TB 3REIC 3UTBA 3W96A 1EQZB 3B6FC 4R8PA 3WTPE 3C1CB 2YFVA 1P3AA 5B24C 5GSUB 5B2IA 3AZEA 5F99A 4ZBJC 2AROB 3X1VD 4QLCB 4X23B 2FJ7B 5DNMB 5GT3B 5CPJB 5B2JD 1P34B 3FDDA 1P3PC 3AN2A 1P3IC 3MGSB 1TAFA 5AV6A 3UTBD 5FUGB 3UT9B 3AZGC 3REKB 2NZDB 3WTPA 3WAAB 5B40A 1WWIA 4R8PD 1P3AD 1KX3A 3B0BA 5B2ID 3AZNB 3AZED 1BH9A 5F99D 3WKJC 1BH8B 2BYMB 4CSRA 3LZ1A 4UUZA 3TU4A 5AVBA 5CPKA 5DNNC 4WNNB 3VH5W 5B32A 1P3BC 3X1UB 3REJD 1U35C 3A1KA 3AN2D 3KXBC 3RELB 1Q9CA 5B1LC 4JJNA 1R4VA 4DRBA 4Z2MG 3AYWC 3AV1A 4HGAC 3WTPD 2BYKA 2HIOB 5B40D 3LZ0B 5BNXB 1P3OA 4J8WC 5KDMB 1KX3D 3VH6A 3AFAC 2VQRA 3LZ1D 5B0ZC 3TU4D 5BT1D 5AVBD 3MGQC 5CPKD 1M18B 5B32D 3REHA 3F6TA 5B31A 5AVCB 3MGRB 1HQ3B 4JJND 3KUYC 3WA9C 3H0LC 3W96C 3AZIA 3AV1D 4WU9A 3V9RA 1P3OD 4WU8C 5GT0D 1P3KA 2FFFB 3A6NB 4KGCA 1Z2CB 2Y2HA 3UTAB 1ID3B 4Z66B 5GXQC 3REIA 4G91B 1JFIB 1H3OB 3REHD 3B6FA 5B31D 5B24A 5C3IC 2IO5B 4NE5A 5AV5B 1M1AB 1KX4C 2PYOC 4XUJC 1P3MC 3W99C 1B67A 3AZID 4EO5B 4WU9D 3AV2C 1N1JA 1P3PA 1P3KD 2HUEB 3AZHC 4KUDD 3AZJC 3MGPC 4KGCD 3REID 3AZFB 3X1SD 3AZGA 2RVQC 4J8UC 3B6FD 3VH6W 3AZLB 2F8NA 5B0YC 5B24D 3WKJA 2XD5A 5G49B 3UTBB 2YFVB 1P3AB 1P3PD 1U35A 2F2AC 3KXBA 1P3ID 5F99B 5B1LA 3AYWA 3W98A 1EQZC 4J8WA 3REJB 3C1CC 3AN2B 3AFAA 3WKJD 5B0ZA 2XD1A 5B1MB 3NQJA 5JA4A 4J8VC 3MGQA 4H9QA 2L5AA 5CPIC 3O62C 4CAYA 3WTPB 5DNND 3LELB 4YS3C 5DNMC 1P3BD 2RIQA 5GT3C 5CPJC 1U35D 1KX3B 4YM6C 3KXBD 3B6GC 1BH9B 5B1LD 4CSRB 3LZ1B 3KUYA 3AYWD 5CPKB 2CV5B 3MVDA 3AZMB 4G92C 3UT9C 5BNVA 2NZDC 5AV8A 4WU8A 3AFAD 5JRGD 1KX5C 1KU5A 5B0ZD 3C1BC 4H9OB 4JJNB 4J8XD 3MGQD 5GXQA 3B0CW 3AV1B 3MNNC 5BO0A 2Y2JA 4ZUXB 4KHAA 1P3OB 2Y2GA 5GT0B 3X1UC 1KX4A 4H9RB 2PYOA 1P3FA 3KUYD 2ZM5A 4XUJA 4AWLB 1P3MA 1F66C 1TZYC 4Z5TB 3KWQC 3W99A 3WA9D 3W96D 3AV2A 4WU8D 5B31B 3NQUA 3LJAB 3AZHA 3B0DC 3AZJA 3MGPA 5GXQD 3AZIB 2ZY2A 4WU9B 4J8UA 3V9RB 1M18C 5B0YA 1P3KB 2Y2MA 5AVCC 1ZLAC 1KX4D 4KUDB 2PYOD 4KGCB 4XUJD 1P3MD 3MGRC 3W99D 5AV6D 4DQYB 3W98C 2NQBC 3X1SB 1M19C 4LD9C 3AV2D 3B6FB 2G5IC 5B24B 4H9NA 3AZHD 1S32B 3AZJD 3MGPD 4ZBJB 3A6NC 1HTAA 1ID3C 2YFWA 2RVQD 4Z66C 4J8UD 1PZRA 1EQZA 4UPKA 1N1JB 5B0YD 1AOIB 3C1CA 3KFUG 1P3IB 5AV9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M1A C;  5AV5 C;  4J8V A;  3AZK C;  5CPI A;  3MVD C;  3O62 A;  4Z2M H;  5B33 B;  5DNM A;  5AV8 C;  5AY8 B;  4XZQ B;  5GT3 A;  4YS3 A;  5CPJ A;  4YM6 A;  3B6G A;  2HUE C;  3WKJ B;  3AZF C;  5CP6 C;  3UT9 A;  5DNN B;  1EQZ D;  2NZD A;  5E5A C;  1P3B B;  3R45 B;  3C1C D;  3AZL C;  3KXB B;  1KX5 A;  5B1L B;  4WZS B;  3C1B A;  1P3F C;  4WV4 B;  4J8V D;  3AYW B;  5CPI D;  3W97 C;  4H9P B;  1ULY A;  3MNN A;  3O62 D;  4YS3 D;  5DNM D;  2CWE A;  5GT3 D;  4YM6 D;  3B6G D;  3X1U A;  5JRG B;  3REL A;  2F8N H;  4J8X B;  1TZY A;  4H9Q B;  3KWQ A;  3MGQ B;  3X1V B;  1F66 A;  1BFM A;  5BS7 C;  3UT9 D;  5B2J B;  5BNX A;  1P3G C;  1KX5 D;  3C1B D;  3KUY B;  3WA9 B;  5B1M C;  3W96 B;  3MNN D;  5BNV B;  4R8P B;  4WU8 B;  1M18 A;  3LEL C;  3X1U D;  5B2I B;  5AVC A;  3AZE B;  1ZLA A;  4E45 A;  3MGR A;  1F66 D;  1TZY D;  4H9S C;  3KWQ D;  1P3L C;  3AZG D;  2NQB A;  1B6W A;  1M19 A;  3X1T C;  4LD9 A;  2CV5 C;  3AZM C;  2F8N D;  1KX4 B;  5GSU C;  3A6N A;  4XUJ B;  1P3M B;  1TAF B;  5AV6 B;  3W99 B;  3UTA A;  1ID3 A;  2ARO C;  4Z66 A;  3VH5 T;  4QLC C;  4X23 C;  3AV2 B;  5B40 B;  2FJ7 C;  1M18 D;  1H3O A;  3NQU B;  4ZUX C;  1P34 C;  1ZLA D;  4DRA A;  3AZJ B;  3TU4 B;  4UUZ B;  3MGR D;  1M1A A;  5AV5 A;  4E44 A;  5AVB B;  3W98 D;  4AWL C;  3MGS C;  3AZK A;  1M19 D;  2NQB D;  4Z5T C;  4LD9 D;  5B32 B;  3REK C;  4J8W D;  3WAA C;  3LJA C;  3A6N D;  3AZN C;  1ID3 D;  4Z66 D;  3AZF A;  5CP6 A;  2BYK B;  5E5A A;  3AZL A;  3REL C;  1M1A D;  5AV5 D;  3W97 A;  3AZK D;  2YFW B;  3MVD D;  3REH B;  3X1S C;  5AV8 D;  2HIO C;  3LZ0 C;  1S32 C;  5B32 G;  4J8V B;  5CPI B;  5BS7 A;  5CP6 D;  3O62 B;  3AZF D;  5E5A D;  1F1E A;  4YS3 B;  4M6B A;  4YM6 B;  3AZL D;  1P3G A;  3B6G B;  3REJ A;  1AOI C;  1P3F D;  5AV9 C;  1HQ3 C;  3REI B;  3W97 D;  5B1M A;  4G92 B;  2JSS A;  3LEL A;  5B33 C;  5AY8 C;  4XZQ C;  1KX5 B;  3C1B B;  3KSY A;  5B31 G;  4H9S A;  1P3L A;  3UTA C;  3MNN B;  4NE3 A;  3X1T A;  3VH6 T;  2CV5 A;  4G91 C;  3AZM A;  1P3P B;  1P3G D;  5GSU A;  2IO5 C;  1F66 B;  1TZY B;  4H9O A;  3KWQ B;  5B1M D;  2ARO A;  3AZG B;  4QLC A;  4X23 A;  4EO5 C;  2FJ7 A;  3LEL D;  4ZUX A;  2F8N B;  3B0D B;  1P34 A;  5GT0 A;  5JRG C;  4H9R A;  1P3L D;  3MGS A;  3X1T D;  4Z5T A;  3X1V C;  5FUG A;  4J8X C;  2CV5 D;  3REK A;  3AZM D;  3WAA A;  1U35 B;  5B2J C;  1ZLA B;  3LJA A;  5GSU D;  3AZN A;  1BH8 A;  2BYM A;  2F8N K;  2ARO D;  3W98 B;  2NQB B;  1M19 B;  4QLC D;  4HGA B;  3UTB C;  4X23 D;  2FJ7 D;  4LD9 B;  4NE6 A;  4J8W B;  5CPJ D;  4WNN A;  4ZUX D;  4R8P C;  1P34 D;  1P3A C;  3AFA B;  5CHL B;  5B0Z B;  5B2I C;  3AZE C;  2F8N G;  3NQJ B;  5F99 C;  5JA4 B;  4KUD A;  3MGS D;  4Z5T D;  4CAY B;  1A7W A;  3X1S A;  3REK D;  2NZD D;  2HIO A;  3LZ0 A;  3WAA D;  5KDM A;  3LJA D;  3REJ C;  1S32 A;  3AN2 C;  3AZN D;  3B0C T;  3AZK B;  5AV6 C;  3MVD B;  5AV8 B;  3WTP C;  5B40 C;  1AOI A;  1KX3 C;  3REL D;  1P3I A;  5AV9 A;  3LZ1 C;  1HQ3 A;  5GXQ B;  3TU4 C;  5BT1 C;  5AVB C;  5CP6 B;  5BO0 B;  5CPK C;  2HIO D;  4KHA B;  5E5A B;  3LZ0 D;  5B32 C;  5B33 A;  5C3I B;  5AY8 A;  4XZQ A;  1S32 D;  2PYO B;  1P3F B;  3W97 B;  4JJN C;  2LY8 A;  1JFI A;  3AV1 C;  1WWS A;  5DNN A;  1P3B A;  3AZH B;  1P3O C;  3R45 A;  5AVC D;  1AOI D;  5GT0 C;  3MGP B;  5AV9 D;  1HQ3 D;  4J8U B;  4H9P A;  4NFT A;  5B0Y B;  5B33 D;  3REH C;  5AY8 D;  4XZQ D;  1P3G B;  5B31 C;  3VH5 A;  5JRG A;  3UTA D;  4J8X A;  3X1V A;  3AZI C;  4WU9 C;  5B2J A;  4H9N B;  1P3K C;  4KUD C;  1P3L B;  4KGC C;  3WA9 A;  5G49 A;  3X1T B;  3REI C;  3UTB A;  3W96 A;  1EQZ B;  3B6F C;  4R8P A;  3WTP E;  3C1C B;  2YFV A;  1P3A A;  5B24 C;  5GSU B;  5B2I A;  3AZE A;  5F99 A;  4ZBJ C;  2ARO B;  3X1V D;  4QLC B;  4X23 B;  2FJ7 B;  5DNM B;  5GT3 B;  5CPJ B;  5B2J D;  1P34 B;  1P3P C;  3AN2 A;  1P3I C;  3MGS B;  1TAF A;  5AV6 A;  3UTB D;  5FUG B;  3UT9 B;  3AZG C;  3REK B;  2NZD B;  3WTP A;  3WAA B;  5B40 A;  1WWI A;  4R8P D;  1P3A D;  1KX3 A;  3B0B A;  5B2I D;  3AZN B;  3AZE D;  1BH9 A;  5F99 D;  3WKJ C;  1BH8 B;  2BYM B;  4CSR A;  3LZ1 A;  4UUZ A;  3TU4 A;  5AVB A;  5CPK A;  5DNN C;  4WNN B;  3VH5 W;  5B32 A;  1P3B C;  3X1U B;  3REJ D;  1U35 C;  3AN2 D;  3KXB C;  3REL B;  1Q9C A;  5B1L C;  4JJN A;  1R4V A;  4DRB A;  4Z2M G;  3AYW C;  3AV1 A;  4HGA C;  3WTP D;  2BYK A;  2HIO B;  5B40 D;  3LZ0 B;  5BNX B;  1P3O A;  4J8W C;  5KDM B;  1KX3 D;  3VH6 A;  3AFA C;  3LZ1 D;  5B0Z C;  3TU4 D;  5BT1 D;  5AVB D;  3MGQ C;  5CPK D;  1M18 B;  5B32 D;  3REH A;  5B31 A;  5AVC B;  3MGR B;  1HQ3 B;  4JJN D;  3KUY C;  3WA9 C;  3W96 C;  3AZI A;  3AV1 D;  4WU9 A;  3V9R A;  1P3O D;  4WU8 C;  5GT0 D;  1P3K A;  3A6N B;  4KGC A;  3UTA B;  1ID3 B;  4Z66 B;  5GXQ C;  3REI A;  4G91 B;  1JFI B;  1H3O B;  3REH D;  3B6F A;  5B31 D;  5B24 A;  5C3I C;  2IO5 B;  4NE5 A;  5AV5 B;  1M1A B;  1KX4 C;  2PYO C;  4XUJ C;  1P3M C;  3W99 C;  1B67 A;  3AZI D;  4EO5 B;  4WU9 D;  3AV2 C;  1N1J A;  1P3P A;  1P3K D;  2HUE B;  3AZH C;  4KUD D;  3AZJ C;  3MGP C;  4KGC D;  3REI D;  3AZF B;  3X1S D;  3AZG A;  2RVQ C;  4J8U C;  3B6F D;  3VH6 W;  3AZL B;  2F8N A;  5B0Y C;  5B24 D;  3WKJ A;  5G49 B;  3UTB B;  2YFV B;  1P3A B;  1P3P D;  1U35 A;  3KXB A;  1P3I D;  5F99 B;  5B1L A;  3AYW A;  3W98 A;  1EQZ C;  4J8W A;  3REJ B;  3C1C C;  3AN2 B;  3AFA A;  3WKJ D;  5B0Z A;  5B1M B;  3NQJ A;  5JA4 A;  4J8V C;  3MGQ A;  4H9Q A;  2L5A A;  5CPI C;  3O62 C;  4CAY A;  3WTP B;  5DNN D;  3LEL B;  4YS3 C;  5DNM C;  1P3B D;  5GT3 C;  5CPJ C;  1U35 D;  1KX3 B;  4YM6 C;  3KXB D;  3B6G C;  1BH9 B;  5B1L D;  4CSR B;  3LZ1 B;  3KUY A;  3AYW D;  5CPK B;  2CV5 B;  3MVD A;  3AZM B;  4G92 C;  3UT9 C;  5BNV A;  2NZD C;  5AV8 A;  4WU8 A;  3AFA D;  5JRG D;  1KX5 C;  1KU5 A;  5B0Z D;  3C1B C;  4H9O B;  4JJN B;  4J8X D;  3MGQ D;  5GXQ A;  3B0C W;  3AV1 B;  3MNN C;  5BO0 A;  4ZUX B;  4KHA A;  1P3O B;  5GT0 B;  3X1U C;  1KX4 A;  4H9R B;  2PYO A;  1P3F A;  3KUY D;  4AWL B;  4XUJ A;  1P3M A;  3WA9 D;  1F66 C;  1TZY C;  4Z5T B;  3KWQ C;  3W99 A;  3W96 D;  3AV2 A;  4WU8 D;  5B31 B;  3NQU A;  3LJA B;  3AZH A;  3B0D C;  3AZJ A;  3MGP A;  5GXQ D;  3AZI B;  4WU9 B;  4J8U A;  3V9R B;  1M18 C;  5B0Y A;  1P3K B;  1ZLA C;  5AVC C;  1KX4 D;  4KUD B;  2PYO D;  4KGC B;  4XUJ D;  1P3M D;  3MGR C;  3W99 D;  5AV6 D;  3W98 C;  2NQB C;  3X1S B;  1M19 C;  4LD9 C;  3AV2 D;  3B6F B;  5B24 B;  4H9N A;  3AZH D;  1S32 B;  3AZJ D;  3MGP D;  4ZBJ B;  3A6N C;  1HTA A;  1ID3 C;  2YFW A;  2RVQ D;  4Z66 C;  4J8U D;  1EQZ A;  1N1J B;  5B0Y D;  1AOI B;  3C1C A;  1P3I B;  5AV9 B; 
#chains in the Genus database with same CATH topology
 1M1A C;  5AV5 C;  4J8V A;  3AZK C;  5CPI A;  3MVD C;  3O62 A;  4Z2M H;  5B33 B;  5DNM A;  5AV8 C;  5AY8 B;  4XZQ B;  5GT3 A;  4YS3 A;  5CPJ A;  4YM6 A;  3B6G A;  2HUE C;  3WKJ B;  3AZF C;  5CP6 C;  3UT9 A;  5DNN B;  1EQZ D;  2NZD A;  5E5A C;  1P3B B;  3R45 B;  3C1C D;  3AZL C;  3KXB B;  1KX5 A;  5B1L B;  4WZS B;  3C1B A;  1P3F C;  4WV4 B;  4J8V D;  2Y2K A;  3AYW B;  5CPI D;  3W97 C;  4H9P B;  1ULY A;  3MNN A;  3O62 D;  4YS3 D;  5DNM D;  2CWE A;  5GT3 D;  4YM6 D;  3B6G D;  3X1U A;  5JRG B;  3REL A;  2F8N H;  4J8X B;  1TZY A;  4H9Q B;  3KWQ A;  3MGQ B;  3X1V B;  1F66 A;  1BFM A;  5BS7 C;  3UT9 D;  2G5H C;  5B2J B;  5BNX A;  1P3G C;  1KX5 D;  3C1B D;  3KUY B;  3WA9 B;  5B1M C;  3W96 B;  3MNN D;  2DQN C;  2JE5 A;  5BNV B;  4R8P B;  4WU8 B;  1M18 A;  3LEL C;  3X1U D;  5B2I B;  5AVC A;  3AZE B;  1ZLA A;  4E45 A;  3MGR A;  1F66 D;  1TZY D;  4H9S C;  3P5J B;  3KWQ D;  1P3L C;  3AZG D;  2NQB A;  1B6W A;  1M19 A;  3X1T C;  4LD9 A;  2CV5 C;  3AZM C;  2F8N D;  1KX4 B;  5GSU C;  3A6N A;  4XUJ B;  1P3M B;  1TAF B;  5AV6 B;  3W99 B;  3UTA A;  1ID3 A;  2ARO C;  4Z66 A;  3VH5 T;  4QLC C;  4X23 C;  3AV2 B;  5B40 B;  2FJ7 C;  1W2E A;  1M18 D;  1H3O A;  3NQU B;  4ZUX C;  1P34 C;  1ZLA D;  4DRA A;  3AZJ B;  3IP4 C;  3TU4 B;  4UUZ B;  3MGR D;  1M1A A;  5AV5 A;  4E44 A;  5AVB B;  3W98 D;  4AWL C;  3MGS C;  3AZK A;  1M19 D;  2NQB D;  4Z5T C;  4LD9 D;  5B32 B;  3REK C;  4J8W D;  3WAA C;  2Y2L A;  3LJA C;  3A6N D;  3AZN C;  1ID3 D;  4Z66 D;  3AZF A;  5CP6 A;  2BYK B;  5E5A A;  3AZL A;  2J8P A;  3REL C;  1M1A D;  5AV5 D;  3H0M C;  3W97 A;  3AZK D;  2YFW B;  1T3U A;  3MVD D;  3REH B;  3X1S C;  5AV8 D;  2HIO C;  3LZ0 C;  2Y2P A;  1S32 C;  5B32 G;  4J8V B;  5CPI B;  5BS7 A;  5CP6 D;  3O62 B;  3AZF D;  3EPK A;  5E5A D;  1F1E A;  4YS3 B;  4M6B A;  4YM6 B;  3AZL D;  1P3G A;  3B6G B;  3REJ A;  1AOI C;  2ZY3 A;  1P3F D;  5AV9 C;  1HQ3 C;  3REI B;  3W97 D;  5B1M A;  4G92 B;  2JSS A;  3LEL A;  5B33 C;  5AY8 C;  4XZQ C;  1KX5 B;  3C1B B;  3KSY A;  5B31 G;  4H9S A;  1P3L A;  3UTA C;  3MNN B;  4NE3 A;  3X1T A;  3VH6 T;  2CV5 A;  4G91 C;  3AZM A;  1P3P B;  1P3G D;  5GSU A;  2IO5 C;  1F66 B;  1TZY B;  4H9O A;  3KWQ B;  5B1M D;  2ARO A;  3AZG B;  4QLC A;  4X23 A;  4EO5 C;  2FJ7 A;  3LEL D;  4ZUX A;  2F8N B;  3B0D B;  1P34 A;  5GT0 A;  5JRG C;  4H9R A;  1P3L D;  3MGS A;  3X1T D;  4Z5T A;  3X1V C;  5FUG A;  4J8X C;  2CV5 D;  2ZY4 A;  3REK A;  3AZM D;  3A1I A;  3WAA A;  1U35 B;  5B2J C;  1ZLA B;  3LJA A;  5GSU D;  3AZN A;  1BH8 A;  2BYM A;  2F8N K;  2ARO D;  3W98 B;  2NQB B;  1M19 B;  4QLC D;  4HGA B;  3UTB C;  4X23 D;  2FJ7 D;  4LD9 B;  4NE6 A;  4J8W B;  5CPJ D;  4WNN A;  4ZUX D;  4R8P C;  1P34 D;  1P3A C;  3AFA B;  5CHL B;  5B0Z B;  5B2I C;  3AZE C;  2F8N G;  3NQJ B;  5F99 C;  5JA4 B;  4KUD A;  3MGS D;  4Z5T D;  4CAY B;  1A7W A;  3X1S A;  3REK D;  2NZD D;  2HIO A;  3LZ0 A;  3WAA D;  5KDM A;  3LJA D;  3REJ C;  1S32 A;  3AN2 C;  3AZN D;  2UWX A;  3B0C T;  3AZK B;  5AV6 C;  2ZY5 A;  3MVD B;  5AV8 B;  3WTP C;  5B40 C;  1AOI A;  1KX3 C;  3EPH A;  3REL D;  1P3I A;  2DF4 C;  5AV9 A;  2Y2N A;  1HQ3 A;  3EG5 B;  5GXQ B;  3LZ1 C;  3TU4 C;  5BT1 C;  5AVB C;  5CP6 B;  5BO0 B;  5CPK C;  2BG1 A;  4WJ3 C;  2Y2I A;  2W8S A;  2HIO D;  4KHA B;  5E5A B;  3LZ0 D;  5B32 C;  5B33 A;  5C3I B;  5AY8 A;  4XZQ A;  1S32 D;  2PYO B;  1P3F B;  3W97 B;  4JJN C;  2LY8 A;  1JFI A;  3AV1 C;  1WWS A;  5DNN A;  1P3B A;  3AZH B;  1P3O C;  3H0R C;  3R45 A;  5AVC D;  1AOI D;  5GT0 C;  3MGP B;  5AV9 D;  2JCH A;  1HQ3 D;  2Y2O A;  4J8U B;  4H9P A;  3EPL A;  4NFT A;  5B0Y B;  5B33 D;  3REH C;  5AY8 D;  4XZQ D;  1P3G B;  5B31 C;  3VH5 A;  5JRG A;  3AL0 C;  3UTA D;  4J8X A;  3X1V A;  3AZI C;  4WU9 C;  5B2J A;  4H9N B;  1P3K C;  2Y2Q A;  4KUD C;  1P3L B;  4KGC C;  3EPJ A;  3WA9 A;  5G49 A;  3X1T B;  3REI C;  3UTB A;  3W96 A;  1EQZ B;  3B6F C;  4R8P A;  3WTP E;  3C1C B;  2YFV A;  1P3A A;  5B24 C;  5GSU B;  5B2I A;  3AZE A;  5F99 A;  4ZBJ C;  2ARO B;  3X1V D;  4QLC B;  4X23 B;  2FJ7 B;  5DNM B;  5GT3 B;  5CPJ B;  5B2J D;  1P34 B;  3FDD A;  1P3P C;  3AN2 A;  1P3I C;  3MGS B;  1TAF A;  5AV6 A;  3UTB D;  5FUG B;  3UT9 B;  3AZG C;  3REK B;  2NZD B;  3WTP A;  3WAA B;  5B40 A;  1WWI A;  4R8P D;  1P3A D;  1KX3 A;  3B0B A;  5B2I D;  3AZN B;  3AZE D;  1BH9 A;  5F99 D;  3WKJ C;  1BH8 B;  2BYM B;  4CSR A;  3LZ1 A;  4UUZ A;  3TU4 A;  5AVB A;  5CPK A;  5DNN C;  4WNN B;  3VH5 W;  5B32 A;  1P3B C;  3X1U B;  3REJ D;  1U35 C;  3A1K A;  3AN2 D;  3KXB C;  3REL B;  1Q9C A;  5B1L C;  4JJN A;  1R4V A;  4DRB A;  4Z2M G;  3AYW C;  3AV1 A;  4HGA C;  3WTP D;  2BYK A;  2HIO B;  5B40 D;  3LZ0 B;  5BNX B;  1P3O A;  4J8W C;  5KDM B;  1KX3 D;  3VH6 A;  3AFA C;  2VQR A;  3LZ1 D;  5B0Z C;  3TU4 D;  5BT1 D;  5AVB D;  3MGQ C;  5CPK D;  1M18 B;  5B32 D;  3REH A;  3F6T A;  5B31 A;  5AVC B;  3MGR B;  1HQ3 B;  4JJN D;  3KUY C;  3WA9 C;  3H0L C;  3W96 C;  3AZI A;  3AV1 D;  4WU9 A;  3V9R A;  1P3O D;  4WU8 C;  5GT0 D;  1P3K A;  2FFF B;  3A6N B;  4KGC A;  1Z2C B;  2Y2H A;  3UTA B;  1ID3 B;  4Z66 B;  5GXQ C;  3REI A;  4G91 B;  1JFI B;  1H3O B;  3REH D;  3B6F A;  5B31 D;  5B24 A;  5C3I C;  2IO5 B;  4NE5 A;  5AV5 B;  1M1A B;  1KX4 C;  2PYO C;  4XUJ C;  1P3M C;  3W99 C;  1B67 A;  3AZI D;  4EO5 B;  4WU9 D;  3AV2 C;  1N1J A;  1P3P A;  1P3K D;  2HUE B;  3AZH C;  4KUD D;  3AZJ C;  3MGP C;  4KGC D;  3REI D;  3AZF B;  3X1S D;  3AZG A;  2RVQ C;  4J8U C;  3B6F D;  3VH6 W;  3AZL B;  2F8N A;  5B0Y C;  5B24 D;  3WKJ A;  2XD5 A;  5G49 B;  3UTB B;  2YFV B;  1P3A B;  1P3P D;  1U35 A;  2F2A C;  3KXB A;  1P3I D;  5F99 B;  5B1L A;  3AYW A;  3W98 A;  1EQZ C;  4J8W A;  3REJ B;  3C1C C;  3AN2 B;  3AFA A;  3WKJ D;  5B0Z A;  2XD1 A;  5B1M B;  3NQJ A;  5JA4 A;  4J8V C;  3MGQ A;  4H9Q A;  2L5A A;  5CPI C;  3O62 C;  4CAY A;  3WTP B;  5DNN D;  3LEL B;  4YS3 C;  5DNM C;  1P3B D;  2RIQ A;  5GT3 C;  5CPJ C;  1U35 D;  1KX3 B;  4YM6 C;  3KXB D;  3B6G C;  1BH9 B;  5B1L D;  4CSR B;  3LZ1 B;  3KUY A;  3AYW D;  5CPK B;  2CV5 B;  3MVD A;  3AZM B;  4G92 C;  3UT9 C;  5BNV A;  2NZD C;  5AV8 A;  4WU8 A;  3AFA D;  5JRG D;  1KX5 C;  1KU5 A;  5B0Z D;  3C1B C;  4H9O B;  4JJN B;  4J8X D;  3MGQ D;  5GXQ A;  3B0C W;  3AV1 B;  3MNN C;  5BO0 A;  2Y2J A;  4ZUX B;  4KHA A;  1P3O B;  2Y2G A;  5GT0 B;  3X1U C;  1KX4 A;  4H9R B;  2PYO A;  1P3F A;  3KUY D;  2ZM5 A;  4XUJ A;  4AWL B;  1P3M A;  1F66 C;  1TZY C;  4Z5T B;  3KWQ C;  3W99 A;  3WA9 D;  3W96 D;  3AV2 A;  4WU8 D;  5B31 B;  3NQU A;  3LJA B;  3AZH A;  3B0D C;  3AZJ A;  3MGP A;  5GXQ D;  3AZI B;  2ZY2 A;  4WU9 B;  4J8U A;  3V9R B;  1M18 C;  5B0Y A;  1P3K B;  2Y2M A;  5AVC C;  1ZLA C;  1KX4 D;  4KUD B;  2PYO D;  4KGC B;  4XUJ D;  1P3M D;  3MGR C;  3W99 D;  5AV6 D;  4DQY B;  3W98 C;  2NQB C;  3X1S B;  1M19 C;  4LD9 C;  3AV2 D;  3B6F B;  2G5I C;  5B24 B;  4H9N A;  3AZH D;  1S32 B;  3AZJ D;  3MGP D;  4ZBJ B;  3A6N C;  1HTA A;  1ID3 C;  2YFW A;  2RVQ D;  4Z66 C;  4J8U D;  1PZR A;  1EQZ A;  4UPK A;  1N1J B;  5B0Y D;  1AOI B;  3C1C A;  3KFU G;  1P3I B;  5AV9 B; 
#chains in the Genus database with same CATH homology
 1M1A C;  5AV5 C;  4J8V A;  3AZK C;  5CPI A;  3MVD C;  3O62 A;  4Z2M H;  5B33 B;  5DNM A;  5AV8 C;  5AY8 B;  4XZQ B;  5GT3 A;  4YS3 A;  5CPJ A;  4YM6 A;  3B6G A;  2HUE C;  3WKJ B;  3AZF C;  5CP6 C;  3UT9 A;  5DNN B;  1EQZ D;  2NZD A;  5E5A C;  1P3B B;  3R45 B;  3C1C D;  3AZL C;  3KXB B;  1KX5 A;  5B1L B;  4WZS B;  3C1B A;  1P3F C;  4WV4 B;  4J8V D;  2Y2K A;  3AYW B;  5CPI D;  3W97 C;  4H9P B;  1ULY A;  3MNN A;  3O62 D;  4YS3 D;  5DNM D;  2CWE A;  5GT3 D;  4YM6 D;  3B6G D;  3X1U A;  5JRG B;  3REL A;  2F8N H;  4J8X B;  1TZY A;  4H9Q B;  3KWQ A;  3MGQ B;  3X1V B;  1F66 A;  1BFM A;  5BS7 C;  3UT9 D;  2G5H C;  5B2J B;  5BNX A;  1P3G C;  1KX5 D;  3C1B D;  3KUY B;  3WA9 B;  5B1M C;  3W96 B;  3MNN D;  2DQN C;  2JE5 A;  5BNV B;  4R8P B;  4WU8 B;  1M18 A;  3LEL C;  3X1U D;  5B2I B;  5AVC A;  3AZE B;  1ZLA A;  4E45 A;  3MGR A;  1F66 D;  1TZY D;  4H9S C;  3P5J B;  3KWQ D;  1P3L C;  3AZG D;  2NQB A;  1B6W A;  1M19 A;  3X1T C;  4LD9 A;  2CV5 C;  3AZM C;  2F8N D;  1KX4 B;  5GSU C;  3A6N A;  4XUJ B;  1P3M B;  1TAF B;  5AV6 B;  3W99 B;  3UTA A;  1ID3 A;  2ARO C;  4Z66 A;  3VH5 T;  4QLC C;  4X23 C;  3AV2 B;  5B40 B;  2FJ7 C;  1W2E A;  1M18 D;  1H3O A;  3NQU B;  4ZUX C;  1P34 C;  1ZLA D;  4DRA A;  3AZJ B;  3IP4 C;  3TU4 B;  4UUZ B;  3MGR D;  1M1A A;  5AV5 A;  4E44 A;  5AVB B;  3W98 D;  4AWL C;  3MGS C;  3AZK A;  1M19 D;  2NQB D;  4Z5T C;  4LD9 D;  5B32 B;  3REK C;  4J8W D;  3WAA C;  2Y2L A;  3LJA C;  3A6N D;  3AZN C;  1ID3 D;  4Z66 D;  3AZF A;  5CP6 A;  2BYK B;  5E5A A;  3AZL A;  2J8P A;  3REL C;  1M1A D;  5AV5 D;  3H0M C;  3W97 A;  3AZK D;  2YFW B;  1T3U A;  3MVD D;  3REH B;  3X1S C;  5AV8 D;  2HIO C;  3LZ0 C;  2Y2P A;  1S32 C;  5B32 G;  4J8V B;  5CPI B;  5BS7 A;  5CP6 D;  3O62 B;  3AZF D;  3EPK A;  5E5A D;  1F1E A;  4YS3 B;  4M6B A;  4YM6 B;  3AZL D;  1P3G A;  3B6G B;  3REJ A;  1AOI C;  2ZY3 A;  1P3F D;  5AV9 C;  1HQ3 C;  3REI B;  3W97 D;  5B1M A;  4G92 B;  2JSS A;  3LEL A;  5B33 C;  5AY8 C;  4XZQ C;  1KX5 B;  3C1B B;  3KSY A;  5B31 G;  4H9S A;  1P3L A;  3UTA C;  3MNN B;  4NE3 A;  3X1T A;  3VH6 T;  2CV5 A;  4G91 C;  3AZM A;  1P3P B;  1P3G D;  5GSU A;  2IO5 C;  1F66 B;  1TZY B;  4H9O A;  3KWQ B;  5B1M D;  2ARO A;  3AZG B;  4QLC A;  4X23 A;  4EO5 C;  2FJ7 A;  3LEL D;  4ZUX A;  2F8N B;  3B0D B;  1P34 A;  5GT0 A;  5JRG C;  4H9R A;  1P3L D;  3MGS A;  3X1T D;  4Z5T A;  3X1V C;  5FUG A;  4J8X C;  2CV5 D;  2ZY4 A;  3REK A;  3AZM D;  3A1I A;  3WAA A;  1U35 B;  5B2J C;  1ZLA B;  3LJA A;  5GSU D;  3AZN A;  1BH8 A;  2BYM A;  2F8N K;  2ARO D;  3W98 B;  2NQB B;  1M19 B;  4QLC D;  4HGA B;  3UTB C;  4X23 D;  2FJ7 D;  4LD9 B;  4NE6 A;  4J8W B;  5CPJ D;  4WNN A;  4ZUX D;  4R8P C;  1P34 D;  1P3A C;  3AFA B;  5CHL B;  5B0Z B;  5B2I C;  3AZE C;  2F8N G;  3NQJ B;  5F99 C;  5JA4 B;  4KUD A;  3MGS D;  4Z5T D;  4CAY B;  1A7W A;  3X1S A;  3REK D;  2NZD D;  2HIO A;  3LZ0 A;  3WAA D;  5KDM A;  3LJA D;  3REJ C;  1S32 A;  3AN2 C;  3AZN D;  2UWX A;  3B0C T;  3AZK B;  5AV6 C;  2ZY5 A;  3MVD B;  5AV8 B;  3WTP C;  5B40 C;  1AOI A;  1KX3 C;  3EPH A;  3REL D;  1P3I A;  2DF4 C;  5AV9 A;  2Y2N A;  1HQ3 A;  3EG5 B;  5GXQ B;  3LZ1 C;  3TU4 C;  5BT1 C;  5AVB C;  5CP6 B;  5BO0 B;  5CPK C;  2BG1 A;  4WJ3 C;  2Y2I A;  2W8S A;  2HIO D;  4KHA B;  5E5A B;  3LZ0 D;  5B32 C;  5B33 A;  5C3I B;  5AY8 A;  4XZQ A;  1S32 D;  2PYO B;  1P3F B;  3W97 B;  4JJN C;  2LY8 A;  1JFI A;  3AV1 C;  1WWS A;  5DNN A;  1P3B A;  3AZH B;  1P3O C;  3H0R C;  3R45 A;  5AVC D;  1AOI D;  5GT0 C;  3MGP B;  5AV9 D;  2JCH A;  1HQ3 D;  2Y2O A;  4J8U B;  4H9P A;  3EPL A;  4NFT A;  5B0Y B;  5B33 D;  3REH C;  5AY8 D;  4XZQ D;  1P3G B;  5B31 C;  3VH5 A;  5JRG A;  3AL0 C;  3UTA D;  4J8X A;  3X1V A;  3AZI C;  4WU9 C;  5B2J A;  4H9N B;  1P3K C;  2Y2Q A;  4KUD C;  1P3L B;  4KGC C;  3EPJ A;  3WA9 A;  5G49 A;  3X1T B;  3REI C;  3UTB A;  3W96 A;  1EQZ B;  3B6F C;  4R8P A;  3WTP E;  3C1C B;  2YFV A;  1P3A A;  5B24 C;  5GSU B;  5B2I A;  3AZE A;  5F99 A;  4ZBJ C;  2ARO B;  3X1V D;  4QLC B;  4X23 B;  2FJ7 B;  5DNM B;  5GT3 B;  5CPJ B;  5B2J D;  1P34 B;  3FDD A;  1P3P C;  3AN2 A;  1P3I C;  3MGS B;  1TAF A;  5AV6 A;  3UTB D;  5FUG B;  3UT9 B;  3AZG C;  3REK B;  2NZD B;  3WTP A;  3WAA B;  5B40 A;  1WWI A;  4R8P D;  1P3A D;  1KX3 A;  3B0B A;  5B2I D;  3AZN B;  3AZE D;  1BH9 A;  5F99 D;  3WKJ C;  1BH8 B;  2BYM B;  4CSR A;  3LZ1 A;  4UUZ A;  3TU4 A;  5AVB A;  5CPK A;  5DNN C;  4WNN B;  3VH5 W;  5B32 A;  1P3B C;  3X1U B;  3REJ D;  1U35 C;  3A1K A;  3AN2 D;  3KXB C;  3REL B;  1Q9C A;  5B1L C;  4JJN A;  1R4V A;  4DRB A;  4Z2M G;  3AYW C;  3AV1 A;  4HGA C;  3WTP D;  2BYK A;  2HIO B;  5B40 D;  3LZ0 B;  5BNX B;  1P3O A;  4J8W C;  5KDM B;  1KX3 D;  3VH6 A;  3AFA C;  2VQR A;  3LZ1 D;  5B0Z C;  3TU4 D;  5BT1 D;  5AVB D;  3MGQ C;  5CPK D;  1M18 B;  5B32 D;  3REH A;  3F6T A;  5B31 A;  5AVC B;  3MGR B;  1HQ3 B;  4JJN D;  3KUY C;  3WA9 C;  3H0L C;  3W96 C;  3AZI A;  3AV1 D;  4WU9 A;  3V9R A;  1P3O D;  4WU8 C;  5GT0 D;  1P3K A;  2FFF B;  3A6N B;  4KGC A;  1Z2C B;  2Y2H A;  3UTA B;  1ID3 B;  4Z66 B;  5GXQ C;  3REI A;  4G91 B;  1JFI B;  1H3O B;  3REH D;  3B6F A;  5B31 D;  5B24 A;  5C3I C;  2IO5 B;  4NE5 A;  5AV5 B;  1M1A B;  1KX4 C;  2PYO C;  4XUJ C;  1P3M C;  3W99 C;  1B67 A;  3AZI D;  4EO5 B;  4WU9 D;  3AV2 C;  1N1J A;  1P3P A;  1P3K D;  2HUE B;  3AZH C;  4KUD D;  3AZJ C;  3MGP C;  4KGC D;  3REI D;  3AZF B;  3X1S D;  3AZG A;  2RVQ C;  4J8U C;  3B6F D;  3VH6 W;  3AZL B;  2F8N A;  5B0Y C;  5B24 D;  3WKJ A;  2XD5 A;  5G49 B;  3UTB B;  2YFV B;  1P3A B;  1P3P D;  1U35 A;  2F2A C;  3KXB A;  1P3I D;  5F99 B;  5B1L A;  3AYW A;  3W98 A;  1EQZ C;  4J8W A;  3REJ B;  3C1C C;  3AN2 B;  3AFA A;  3WKJ D;  5B0Z A;  2XD1 A;  5B1M B;  3NQJ A;  5JA4 A;  4J8V C;  3MGQ A;  4H9Q A;  2L5A A;  5CPI C;  3O62 C;  4CAY A;  3WTP B;  5DNN D;  3LEL B;  4YS3 C;  5DNM C;  1P3B D;  2RIQ A;  5GT3 C;  5CPJ C;  1U35 D;  1KX3 B;  4YM6 C;  3KXB D;  3B6G C;  1BH9 B;  5B1L D;  4CSR B;  3LZ1 B;  3KUY A;  3AYW D;  5CPK B;  2CV5 B;  3MVD A;  3AZM B;  4G92 C;  3UT9 C;  5BNV A;  2NZD C;  5AV8 A;  4WU8 A;  3AFA D;  5JRG D;  1KX5 C;  1KU5 A;  5B0Z D;  3C1B C;  4H9O B;  4JJN B;  4J8X D;  3MGQ D;  5GXQ A;  3B0C W;  3AV1 B;  3MNN C;  5BO0 A;  2Y2J A;  4ZUX B;  4KHA A;  1P3O B;  2Y2G A;  5GT0 B;  3X1U C;  1KX4 A;  4H9R B;  2PYO A;  1P3F A;  3KUY D;  2ZM5 A;  4XUJ A;  4AWL B;  1P3M A;  1F66 C;  1TZY C;  4Z5T B;  3KWQ C;  3W99 A;  3WA9 D;  3W96 D;  3AV2 A;  4WU8 D;  5B31 B;  3NQU A;  3LJA B;  3AZH A;  3B0D C;  3AZJ A;  3MGP A;  5GXQ D;  3AZI B;  2ZY2 A;  4WU9 B;  4J8U A;  3V9R B;  1M18 C;  5B0Y A;  1P3K B;  2Y2M A;  5AVC C;  1ZLA C;  1KX4 D;  4KUD B;  2PYO D;  4KGC B;  4XUJ D;  1P3M D;  3MGR C;  3W99 D;  5AV6 D;  4DQY B;  3W98 C;  2NQB C;  3X1S B;  1M19 C;  4LD9 C;  3AV2 D;  3B6F B;  2G5I C;  5B24 B;  4H9N A;  3AZH D;  1S32 B;  3AZJ D;  3MGP D;  4ZBJ B;  3A6N C;  1HTA A;  1ID3 C;  2YFW A;  2RVQ D;  4Z66 C;  4J8U D;  1PZR A;  1EQZ A;  4UPK A;  1N1J B;  5B0Y D;  1AOI B;  3C1C A;  3KFU G;  1P3I B;  5AV9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...