2FJ7B

Crystal structure of nucleosome core particle containing a poly (da.dt) sequence element
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
79
structure length
79
Chain Sequence
DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords 147 bp DNA containing 16 bp poly dA element
publication title Nucleosome Core Particles Containing a Poly(dA.dT) Sequence Element Exhibit a Locally Distorted DNA Structure.
pubmed doi rcsb
source organism Xenopus laevis
total genus 25
structure length 79
sequence length 79
chains with identical sequence F
ec nomenclature
pdb deposition date 2005-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2fj7B00
1N1JA 5B2JB 5JA4A 1AOIA 5B1MB 1HTAA 4XZQC 5E5AB 5F99C 3KXBC 2AROC 5B24B 4H9RB 3MGSC 3NQUB 4ZUXC 4WU8A 1P3LA 5B2JD 1M18B 4QLCC 1BH9B 5B1MD 4J8VB 4YS3C 4HGAB 4Z5TA 5GXQC 5B24D 4JJNC 1M18D 5CHLB 3UTBC 3X1TB 5AV5C 1M19A 1HQ3C 3AZIC 4AWLB 1P3KB 3X1SC 2IO5B 3X1TD 5JRGA 1P3KD 5AV6A 2RVQC 5B0YA 3AZMB 5CPJB 5BNXA 1P3FA 3LJAB 3AV2D 1P34B 3MGPA 3AZMD 1P3IB 5CPJD 1P3MC 5CPIB 3R45B 2F8NB 4KHAB 4H9OA 3LZ0B 3LJAD 3B0CW 4H9QA 1P34D 1JFIA 1P3ID 5CPID 3WTPB 3VH5T 2F8ND 5AV6C 1KX5C 5B1LB 5B0YC 1P3PB 5C3IB 2PYOA 4Z66C 3WTPD 2YFVA 1P3AB 1P3PD 4KUDC 4NE6A 2L5AA 3TU4A 5B40C 3AZGC 3AZLC 1P3AD 2NQBB 1P3GB 3WA9A 5E5AA 5B24A 4H9RA 3NQUA 4UUZA 4LD9B 1TZYC 4CSRA 5KDMB 4J8XB 2NQBD 2PYOC 1P3GD 5GSUB 4J8VA 1KX4A 3VH6T 3KXBB 4LD9D 3LELB 1Q9CA 3AZKB 5GSUD 1S32A 2NZDA 5F99D 3KXBD 4G91B 3A6NB 3LELD 3AZKD 3WA9C 4QLCD 3AFAB 4EO5B 5B33C 3W96B 4R8PB 3WAAA 1KU5A 4YM6B 3AYWC 3C1BB 3A6ND 3AFAD 1KX4C 3LJAA 3X1SD 3W96D 4R8PD 5BNVB 1P34A 1EQZB 4YM6D 3C1BD 2BYKA 2NZDC 1S32C 4KHAA 3LZ0A 4J8UC 5B0ZA 4J8WB 4E45A 5AVCB 1F1EA 3KSYA 4X23B 3AZJA 5CPKB 3WTPA 3V9RB 5B31G 1ID3B 3WAAC 3MGRB 5B1LA 3VH6A 4DRBA 3UTAA 3KWQB 5AVCD 1P3MD 4X23D 3WKJC 5B2IB 5CPKD 3MGRD 3X1VB 1TAFA 3KWQD 1M1AA 4WU9C 3W99C 5B2ID 3REJC 3MVDC 4XUJA 5BO0B 5B0ZC 3X1UC 1KX5D 3C1CC 3W97B 3X1VD 1KX3A 2FJ7B 2F8NG 3AZJC 3AZFA 4H9NA 1P3GA 1P3BB 3UTAC 3AZHB 2F8NH 3W97D 4LD9A 2FJ7D 4J8XA 4KUDD 5AY8B 5B32G 3RELB 1P3BD 3AZHD 3UT9C 2HIOB 5GT3A 3AZGD 3AZLD 3AN2B 1M1AC 3AZKA 5AY8D 5CP6C 3RELD 1BH8A 4XUJC 5AVBC 5AV9C 1KX3C 1ZLAB 2HIOD 3AZFC 5BS7C 3A6NA 4KGCA 1TZYD 3AN2D 3AV1A 3AZNB 4H9SA 4WNNA 5B31B 3NQJA 4R8PA 3MGQA 1AOIC 4WZSB 3B0DB 1ZLAD 4YM6A 4DRAA 3C1BA 5DNNB 3O62B 3AZND 4ZBJB 2F8NK 4WU8C 1P3LC 3AV2B 4CAYA 5B31D 3KUYA 5BNVA 5GT3C 1EQZA 5DNND 3VH5W 3O62D 4Z5TC 3REHA 3B6FB 2YFWB 4J8WA 3AZEA 4KGCC 1M19C 5AVCA 3REIA 3AYWD 3AV1C 3W98A 3B6GB 4H9SC 1B67A 3MGQC 1U35B 3MGRA 1ID3A 3B6FD 1F66A 5JRGC 2CV5A 3B6GD 1H3OB 3MNNB 5B32B 3LZ1B 4NFTA 5GT0A 3KUYC 1U35D 1P3OB 5DNMB 4J8UD 3REKB 1P3FC 5AV8A 3REHC 3MNND 4E44A 5B32D 3W97A 5BO0A 3LZ1D 3MGPC 3AZEC 1P3OD 5DNMD 3W98C 3REIC 3REKD 4G92C 3WKJD 3VH6W 1P3BA 1F66C 5B2JA 3AZHA 2HUEC 1BFMA 5B1MA 2CV5C 3W99D 3RELA 3AZIB 3REJD 5GT0C 5G49B 1M18A 3C1CD 1BH9A 5AV8C 4XZQB 5F99B 3AZID 2AROB 3MGSB 1ZLAA 4ZUXB 3X1TA 4QLCB 3TU4C 4XZQD 3AZNA 1P3KA 4YS3B 2AROD 5GXQB 5B2JC 5B31A 3MGSD 4JJNB 4ZUXD 3WTPE 5FUGB 5B1MC 3UT9D 3UTBB 5AV5B 5DNNA 1HQ3B 5E5AC 5CP6D 5B24C 3X1SB 4YS3D 1M18C 3AV2A 5GXQD 5AV9D 4JJND 4H9PB 3AZMA 5CPJA 3UTBD 5AV5D 1HQ3D 4J8VC 4HGAC 3B6FA 2YFWA 3X1TC 1P3IA 1AOID 5CPIA 3R45A 4AWLC 1P3KC 2F8NA 4WU8D 2RVQD 2IO5C 1P3MB 1H3OA 4Z5TD 3MNNA 5B32A 3AZMC 5CPJC 1P3PA 1P3OA 2JSSA 1M19D 3LJAC 5AV6B 1KX5B 1P34C 5B0YB 1P3IC 1P3AA 5CPIC 5JRGD 4Z66B 3LZ0C 5AV6D 5B0YD 2NQBA 4KUDB 3WTPC 1P3FD 4Z66D 4H9OB 5B1LC 1P3PC 4H9QB 5C3IC 3MGPD 5B40B 3AZGB 3AZLB 5KDMA 5GSUA 5F99A 3KXBA 1P3AC 5B40D 1TZYB 3LELA 2PYOB 2YFVB 4QLCA 2NQBC 5FUGA 1P3GC 3UTBA 2PYOD 3AFAA 3W96A 3X1SA 4LD9C 4J8XC 4H9PA 5GSUC 3WA9B 3TU4D 5B33B 4UUZB 1ULYA 3LELC 4CSRB 3AZKC 3AYWB 3WA9D 5E5AD 1KX4B 4G91C 5BT1C 5B33D 3A6NC 1P3MA 4X23A 3AFAC 5CPKA 2BYMB 1S32B 3V9RA 4EO5C 3W96C 2NZDB 4R8PC 4J8VD 1KX4D 4YM6C 4J8UB 3C1BC 3KWQA 5B2IA 2NZDD 1S32D 1KX5A 3WAAB 1EQZC 1R4VA 3X1VA 3B0BA 3WKJB 4NE5A 4Z66A 4J8WC 3WAAD 2LY8A 5AVCC 2FJ7A 4X23C 4KUDA 2CWEA 5CPKC 2BYKB 4WU9B 3W99B 3REJB 1ID3C 3MGRC 3MVDB 3X1UB 5B0ZB 3C1CB 3KWQC 5B40A 3AZGA 3AZLA 3AZJB 5AY8A 5B2IC 4WU9D 3LZ0D 3MVDD 3X1VC 3X1UD 5B0ZD 3UTAB 2HIOA 1TZYA 3AN2A 3AZJD 3W97C 3B0CT 5B1LD 2FJ7C 3UTAD 4NE3A 3UT9B 1WWIA 1TAFB 1M1AB 5CP6B 4XUJB 1P3BC 5AVBB 5AV9B 3AZHC 1KX3B 5AY8C 3AZFB 1M1AD 4H9NB 3RELC 3O62A 1N1JB 4XUJD 5AVBD 5B33A 2HIOC 5JA4B 1KX3D 1AOIB 3AN2C 3AYWA 3AZFD 4Z2MG 4WU8B 1ZLAC 1P3LB 5GT3B 4J8XD 4Z2MH 3AZNC 3B6GA 1BH8B 2BYMA 4Z5TB 3VH5A 1A7WA 5B31C 1U35A 1P3LD 3B0DC 4J8UA 4KGCB 5DNNC 5GT3D 1M19B 3O62C 3AV1B 4ZBJC 4WNNB 3AV2C 3LZ1A 3NQJB 3MGQB 5BT1D 5DNMA 4KGCD 5JRGB 3REKA 3AV1D 3WKJA 3B6FC 4CAYB 3MGQD 3KUYB 5BNXB 1P3FB 3B6GC 4WU9A 3W99A 1B6WA 3REJA 1U35C 3REHB 1WWSA 3MVDA 3MGPB 3X1UA 3AZEB 3KUYD 3C1CA 1EQZD 3W98B 3REIB 4G92B 3MNNC 5B32C 3LZ1C 3AZIA 3REHD 1P3OC 1JFIB 5G49A 5DNMC 4J8WD 3AZED 1F66B 3REKC 2HUEB 4WV4B 3W98D 3REID 2CV5B 4XZQA 2AROA 5GT0B 1ID3D 4M6BA 3MGSA 4ZUXA 1F66D 3UT9A 5AV8B 2CV5D 5CP6A 4YS3A 5AVBA 5AV9A 5GXQA 5GT0D 4JJNA 5AV5A 5BS7A 3TU4B 1HQ3A 5AV8D
chains in the Genus database with same CATH superfamily
1N1JA 5B2JB 5JA4A 1AOIA 2UWXA 5B1MB 1HTAA 4XZQC 5E5AB 5F99C 3KXBC 2AROC 5B24B 4H9RB 3MGSC 3NQUB 4ZUXC 3P5JB 4WU8A 5B2JD 1P3LA 1M18B 4QLCC 1BH9B 5B1MD 4J8VB 4YS3C 4HGAB 2G5HC 4Z5TA 5GXQC 5B24D 4JJNC 1M18D 5CHLB 3UTBC 3X1TB 5AV5C 1M19A 1HQ3C 3AZIC 4AWLB 1P3KB 3X1SC 2IO5B 3X1TD 5JRGA 1P3KD 2Y2PA 5AV6A 2RVQC 5B0YA 3AZMB 5CPJB 5BNXA 1P3FA 3LJAB 3AV2D 1P34B 3MGPA 3AZMD 1P3IB 5CPJD 1P3MC 5CPIB 3R45B 2F8NB 4KHAB 4H9OA 3LZ0B 3LJAD 3B0CW 4H9QA 1P34D 1JFIA 1P3ID 5CPID 3EPHA 3WTPB 3VH5T 2F8ND 5AV6C 1KX5C 4WJ3C 5B1LB 5B0YC 1P3PB 5C3IB 2PYOA 4Z66C 3WTPD 2YFVA 4UPKA 2ZY4A 1P3AB 1P3PD 4KUDC 4NE6A 2L5AA 3TU4A 5B40C 3AZGC 3AZLC 1P3AD 2NQBB 1P3GB 3WA9A 5E5AA 5B24A 4H9RA 3NQUA 4UUZA 4LD9B 2XD1A 1TZYC 4CSRA 5KDMB 4J8XB 2NQBD 2PYOC 1P3GD 5GSUB 4J8VA 1KX4A 3VH6T 3KXBB 2JE5A 2RIQA 4LD9D 3LELB 1Q9CA 3AZKB 5GSUD 1S32A 2NZDA 5F99D 3KXBD 4G91B 3A6NB 3LELD 3AZKD 3WA9C 4QLCD 3AFAB 4EO5B 5B33C 3W96B 4R8PB 3WAAA 1KU5A 4YM6B 2Y2LA 3AYWC 3C1BB 3A6ND 3AFAD 1KX4C 3LJAA 3X1SD 3W96D 4R8PD 5BNVB 1P34A 1EQZB 4YM6D 3C1BD 2BYKA 2NZDC 1S32C 4KHAA 3LZ0A 4J8UC 5B0ZA 4J8WB 4E45A 5AVCB 1F1EA 3KSYA 4X23B 3AZJA 3H0MC 5CPKB 3WTPA 3V9RB 5B31G 1ID3B 3WAAC 3MGRB 5B1LA 3VH6A 4DRBA 3UTAA 3KWQB 5AVCD 1P3MD 4X23D 3WKJC 5B2IB 5CPKD 3MGRD 3X1VB 1TAFA 3KWQD 1M1AA 4WU9C 3W99C 2ZY2A 5B2ID 3REJC 3MVDC 4XUJA 5BO0B 5B0ZC 3X1UC 1KX5D 3C1CC 3W97B 3X1VD 1KX3A 2FJ7B 2F8NG 3AZJC 3AZFA 4H9NA 1P3GA 1P3BB 3UTAC 3AZHB 2F8NH 3IP4C 3W97D 4LD9A 2FJ7D 4J8XA 4KUDD 5AY8B 5B32G 3RELB 1P3BD 3AZHD 3UT9C 2HIOB 2Y2JA 5GT3A 3AZGD 3AZLD 3AN2B 1M1AC 3AZKA 5AY8D 5CP6C 3RELD 1BH8A 4XUJC 5AVBC 5AV9C 1KX3C 1ZLAB 2HIOD 3AZFC 5BS7C 3A6NA 4KGCA 1TZYD 3AN2D 3AV1A 3AZNB 4H9SA 4WNNA 5B31B 3NQJA 4R8PA 3MGQA 1AOIC 4WZSB 3B0DB 3A1IA 4DQYB 4YM6A 1ZLAD 4DRAA 3C1BA 3H0LC 5DNNB 3O62B 3AZND 4ZBJB 2F8NK 4WU8C 1P3LC 3AV2B 4CAYA 5B31D 3KUYA 5BNVA 5GT3C 1EQZA 2DF4C 5DNND 3VH5W 3O62D 4Z5TC 3REHA 3B6FB 2YFWB 3EPKA 4J8WA 3AZEA 4KGCC 1M19C 5AVCA 3REIA 3AYWD 3AV1C 3W98A 3B6GB 4H9SC 1B67A 3MGQC 1U35B 3MGRA 1ID3A 3B6FD 1F66A 5JRGC 2CV5A 3B6GD 1H3OB 3MNNB 5B32B 3LZ1B 1PZRA 4NFTA 5GT0A 3KUYC 1U35D 1P3OB 5DNMB 4J8UD 3REKB 1P3FC 5AV8A 3REHC 2ZY5A 3MNND 4E44A 5B32D 3W97A 5BO0A 3LZ1D 3MGPC 3AZEC 1P3OD 5DNMD 3W98C 3REIC 3REKD 4G92C 3WKJD 2Y2HA 3VH6W 1P3BA 1F66C 5B2JA 3AZHA 2HUEC 2VQRA 2ZY3A 3KFUG 1BFMA 5B1MA 2CV5C 3W99D 3RELA 3AZIB 3REJD 5GT0C 5G49B 1M18A 2JCHA 3C1CD 1BH9A 5AV8C 4XZQB 2FFFB 5F99B 3AZID 2AROB 3MGSB 1ZLAA 4ZUXB 3X1TA 4QLCB 3TU4C 4XZQD 3AZNA 1P3KA 4YS3B 2AROD 5GXQB 5B2JC 5B31A 3MGSD 4JJNB 2F2AC 4ZUXD 3WTPE 5FUGB 5B1MC 3UT9D 3UTBB 5AV5B 5DNNA 1HQ3B 5E5AC 5CP6D 5B24C 1W2EA 3X1SB 4YS3D 1M18C 3AV2A 5GXQD 5AV9D 2DQNC 4H9PB 4JJND 3AZMA 5CPJA 3UTBD 5AV5D 1HQ3D 4J8VC 4HGAC 3EG5B 3B6FA 2YFWA 3X1TC 1P3IA 1AOID 5CPIA 3R45A 4AWLC 1P3KC 2F8NA 4WU8D 2RVQD 2IO5C 1P3MB 1H3OA 4Z5TD 3MNNA 5B32A 3AZMC 5CPJC 1P3PA 1P3OA 2JSSA 1M19D 3LJAC 5AV6B 1KX5B 1P34C 5B0YB 1P3IC 1P3AA 5CPIC 5JRGD 4Z66B 3LZ0C 5AV6D 3EPJA 5B0YD 2NQBA 4KUDB 3WTPC 1P3FD 4Z66D 4H9OB 5B1LC 1P3PC 4H9QB 5C3IC 3MGPD 5B40B 3AZGB 3AZLB 5KDMA 1Z2CB 5GSUA 5F99A 3KXBA 1P3AC 2Y2NA 5B40D 1TZYB 3LELA 3EPLA 2PYOB 2YFVB 4QLCA 3H0RC 2NQBC 5FUGA 1P3GC 3UTBA 3AL0C 2PYOD 2Y2OA 3F6TA 3AFAA 3W96A 3X1SA 4LD9C 4J8XC 4H9PA 5GSUC 3WA9B 3TU4D 5B33B 4UUZB 1ULYA 3LELC 4CSRB 3AZKC 1T3UA 3AYWB 3WA9D 5E5AD 1KX4B 4G91C 5BT1C 5B33D 3A6NC 2BG1A 1P3MA 4X23A 2Y2MA 3AFAC 5CPKA 2BYMB 1S32B 3V9RA 4EO5C 3W96C 2NZDB 4R8PC 4J8VD 1KX4D 2J8PA 4YM6C 4J8UB 3C1BC 3KWQA 5B2IA 2NZDD 1S32D 1KX5A 3WAAB 1EQZC 1R4VA 3X1VA 2ZM5A 3B0BA 3WKJB 4NE5A 4Z66A 4J8WC 3WAAD 2LY8A 5AVCC 2FJ7A 4X23C 4KUDA 2CWEA 5CPKC 2BYKB 4WU9B 3W99B 3REJB 1ID3C 3MGRC 3MVDB 3X1UB 5B0ZB 3C1CB 3KWQC 5B40A 3AZGA 3AZLA 3AZJB 5AY8A 5B2IC 4WU9D 3LZ0D 3MVDD 3X1VC 3X1UD 5B0ZD 3UTAB 2HIOA 1TZYA 3AN2A 3AZJD 3W97C 3B0CT 5B1LD 2FJ7C 3UTAD 4NE3A 2XD5A 3UT9B 1WWIA 1TAFB 1M1AB 5CP6B 4XUJB 1P3BC 5AVBB 5AV9B 3AZHC 1KX3B 5AY8C 3AZFB 1M1AD 4H9NB 3RELC 3O62A 1N1JB 4XUJD 5AVBD 5B33A 2HIOC 5JA4B 1KX3D 1AOIB 3AN2C 3AYWA 3AZFD 4Z2MG 3A1KA 4WU8B 1ZLAC 1P3LB 5GT3B 2Y2QA 4J8XD 4Z2MH 3AZNC 3B6GA 3FDDA 1BH8B 2BYMA 4Z5TB 2W8SA 1A7WA 3VH5A 5B31C 1U35A 1P3LD 3B0DC 4J8UA 4KGCB 5DNNC 5GT3D 1M19B 3O62C 3AV1B 2Y2IA 4ZBJC 4WNNB 3AV2C 3LZ1A 3NQJB 3MGQB 5BT1D 5DNMA 4KGCD 5JRGB 3REKA 3AV1D 3WKJA 3B6FC 4CAYB 2G5IC 3MGQD 3KUYB 5BNXB 1P3FB 3B6GC 4WU9A 3W99A 1B6WA 3REJA 1U35C 3REHB 1WWSA 3MVDA 3MGPB 3X1UA 3AZEB 3KUYD 3C1CA 1EQZD 3W98B 3REIB 4G92B 3MNNC 5B32C 3LZ1C 3AZIA 3REHD 1P3OC 1JFIB 5G49A 5DNMC 4J8WD 3AZED 1F66B 3REKC 2HUEB 4WV4B 3W98D 3REID 2CV5B 4XZQA 2Y2GA 2AROA 5GT0B 1ID3D 4M6BA 3MGSA 4ZUXA 1F66D 3UT9A 5AV8B 2CV5D 2Y2KA 5CP6A 4YS3A 5AVBA 5AV9A 5GXQA 5GT0D 4JJNA 5AV5A 5BS7A 3TU4B 1HQ3A 5AV8D
chains in the Genus database with same CATH topology
1N1JA 5B2JB 5JA4A 1AOIA 2UWXA 5B1MB 1HTAA 4XZQC 5E5AB 5F99C 3KXBC 2AROC 5B24B 4H9RB 3MGSC 3NQUB 4ZUXC 3P5JB 4WU8A 5B2JD 1P3LA 1M18B 4QLCC 1BH9B 5B1MD 4J8VB 4YS3C 4HGAB 2G5HC 4Z5TA 5GXQC 5B24D 4JJNC 1M18D 5CHLB 3UTBC 3X1TB 5AV5C 1M19A 1HQ3C 3AZIC 4AWLB 1P3KB 3X1SC 2IO5B 3X1TD 5JRGA 1P3KD 2Y2PA 5AV6A 2RVQC 5B0YA 3AZMB 5CPJB 5BNXA 1P3FA 3LJAB 3AV2D 1P34B 3MGPA 3AZMD 1P3IB 5CPJD 1P3MC 5CPIB 3R45B 2F8NB 4KHAB 4H9OA 3LZ0B 3LJAD 3B0CW 4H9QA 1P34D 1JFIA 1P3ID 5CPID 3EPHA 3WTPB 3VH5T 2F8ND 5AV6C 1KX5C 4WJ3C 5B1LB 5B0YC 1P3PB 5C3IB 2PYOA 4Z66C 3WTPD 2YFVA 4UPKA 2ZY4A 1P3AB 1P3PD 4KUDC 4NE6A 2L5AA 3TU4A 5B40C 3AZGC 3AZLC 1P3AD 2NQBB 1P3GB 3WA9A 5E5AA 5B24A 4H9RA 3NQUA 4UUZA 4LD9B 2XD1A 1TZYC 4CSRA 5KDMB 4J8XB 2NQBD 2PYOC 1P3GD 5GSUB 4J8VA 1KX4A 3VH6T 3KXBB 2JE5A 2RIQA 4LD9D 3LELB 1Q9CA 3AZKB 5GSUD 1S32A 2NZDA 5F99D 3KXBD 4G91B 3A6NB 3LELD 3AZKD 3WA9C 4QLCD 3AFAB 4EO5B 5B33C 3W96B 4R8PB 3WAAA 1KU5A 4YM6B 2Y2LA 3AYWC 3C1BB 3A6ND 3AFAD 1KX4C 3LJAA 3X1SD 3W96D 4R8PD 5BNVB 1P34A 1EQZB 4YM6D 3C1BD 2BYKA 2NZDC 1S32C 4KHAA 3LZ0A 4J8UC 5B0ZA 4J8WB 4E45A 5AVCB 1F1EA 3KSYA 4X23B 3AZJA 3H0MC 5CPKB 3WTPA 3V9RB 5B31G 1ID3B 3WAAC 3MGRB 5B1LA 3VH6A 4DRBA 3UTAA 3KWQB 5AVCD 1P3MD 4X23D 3WKJC 5B2IB 5CPKD 3MGRD 3X1VB 1TAFA 3KWQD 1M1AA 4WU9C 3W99C 2ZY2A 5B2ID 3REJC 3MVDC 4XUJA 5BO0B 5B0ZC 3X1UC 1KX5D 3C1CC 3W97B 3X1VD 1KX3A 2FJ7B 2F8NG 3AZJC 3AZFA 4H9NA 1P3GA 1P3BB 3UTAC 3AZHB 2F8NH 3IP4C 3W97D 4LD9A 2FJ7D 4J8XA 4KUDD 5AY8B 5B32G 3RELB 1P3BD 3AZHD 3UT9C 2HIOB 2Y2JA 5GT3A 3AZGD 3AZLD 3AN2B 1M1AC 3AZKA 5AY8D 5CP6C 3RELD 1BH8A 4XUJC 5AVBC 5AV9C 1KX3C 1ZLAB 2HIOD 3AZFC 5BS7C 3A6NA 4KGCA 1TZYD 3AN2D 3AV1A 3AZNB 4H9SA 4WNNA 5B31B 3NQJA 4R8PA 3MGQA 1AOIC 4WZSB 3B0DB 3A1IA 4DQYB 4YM6A 1ZLAD 4DRAA 3C1BA 3H0LC 5DNNB 3O62B 3AZND 4ZBJB 2F8NK 4WU8C 1P3LC 3AV2B 4CAYA 5B31D 3KUYA 5BNVA 5GT3C 1EQZA 2DF4C 5DNND 3VH5W 3O62D 4Z5TC 3REHA 3B6FB 2YFWB 3EPKA 4J8WA 3AZEA 4KGCC 1M19C 5AVCA 3REIA 3AYWD 3AV1C 3W98A 3B6GB 4H9SC 1B67A 3MGQC 1U35B 3MGRA 1ID3A 3B6FD 1F66A 5JRGC 2CV5A 3B6GD 1H3OB 3MNNB 5B32B 3LZ1B 1PZRA 4NFTA 5GT0A 3KUYC 1U35D 1P3OB 5DNMB 4J8UD 3REKB 1P3FC 5AV8A 3REHC 2ZY5A 3MNND 4E44A 5B32D 3W97A 5BO0A 3LZ1D 3MGPC 3AZEC 1P3OD 5DNMD 3W98C 3REIC 3REKD 4G92C 3WKJD 2Y2HA 3VH6W 1P3BA 1F66C 5B2JA 3AZHA 2HUEC 2VQRA 2ZY3A 3KFUG 1BFMA 5B1MA 2CV5C 3W99D 3RELA 3AZIB 3REJD 5GT0C 5G49B 1M18A 2JCHA 3C1CD 1BH9A 5AV8C 4XZQB 2FFFB 5F99B 3AZID 2AROB 3MGSB 1ZLAA 4ZUXB 3X1TA 4QLCB 3TU4C 4XZQD 3AZNA 1P3KA 4YS3B 2AROD 5GXQB 5B2JC 5B31A 3MGSD 4JJNB 2F2AC 4ZUXD 3WTPE 5FUGB 5B1MC 3UT9D 3UTBB 5AV5B 5DNNA 1HQ3B 5E5AC 5CP6D 5B24C 1W2EA 3X1SB 4YS3D 1M18C 3AV2A 5GXQD 5AV9D 2DQNC 4H9PB 4JJND 3AZMA 5CPJA 3UTBD 5AV5D 1HQ3D 4J8VC 4HGAC 3EG5B 3B6FA 2YFWA 3X1TC 1P3IA 1AOID 5CPIA 3R45A 4AWLC 1P3KC 2F8NA 4WU8D 2RVQD 2IO5C 1P3MB 1H3OA 4Z5TD 3MNNA 5B32A 3AZMC 5CPJC 1P3PA 1P3OA 2JSSA 1M19D 3LJAC 5AV6B 1KX5B 1P34C 5B0YB 1P3IC 1P3AA 5CPIC 5JRGD 4Z66B 3LZ0C 5AV6D 3EPJA 5B0YD 2NQBA 4KUDB 3WTPC 1P3FD 4Z66D 4H9OB 5B1LC 1P3PC 4H9QB 5C3IC 3MGPD 5B40B 3AZGB 3AZLB 5KDMA 1Z2CB 5GSUA 5F99A 3KXBA 1P3AC 2Y2NA 5B40D 1TZYB 3LELA 3EPLA 2PYOB 2YFVB 4QLCA 3H0RC 2NQBC 5FUGA 1P3GC 3UTBA 3AL0C 2PYOD 2Y2OA 3F6TA 3AFAA 3W96A 3X1SA 4LD9C 4J8XC 4H9PA 5GSUC 3WA9B 3TU4D 5B33B 4UUZB 1ULYA 3LELC 4CSRB 3AZKC 1T3UA 3AYWB 3WA9D 5E5AD 1KX4B 4G91C 5BT1C 5B33D 3A6NC 2BG1A 1P3MA 4X23A 2Y2MA 3AFAC 5CPKA 2BYMB 1S32B 3V9RA 4EO5C 3W96C 2NZDB 4R8PC 4J8VD 1KX4D 2J8PA 4YM6C 4J8UB 3C1BC 3KWQA 5B2IA 2NZDD 1S32D 1KX5A 3WAAB 1EQZC 1R4VA 3X1VA 2ZM5A 3B0BA 3WKJB 4NE5A 4Z66A 4J8WC 3WAAD 2LY8A 5AVCC 2FJ7A 4X23C 4KUDA 2CWEA 5CPKC 2BYKB 4WU9B 3W99B 3REJB 1ID3C 3MGRC 3MVDB 3X1UB 5B0ZB 3C1CB 3KWQC 5B40A 3AZGA 3AZLA 3AZJB 5AY8A 5B2IC 4WU9D 3LZ0D 3MVDD 3X1VC 3X1UD 5B0ZD 3UTAB 2HIOA 1TZYA 3AN2A 3AZJD 3W97C 3B0CT 5B1LD 2FJ7C 3UTAD 4NE3A 2XD5A 3UT9B 1WWIA 1TAFB 1M1AB 5CP6B 4XUJB 1P3BC 5AVBB 5AV9B 3AZHC 1KX3B 5AY8C 3AZFB 1M1AD 4H9NB 3RELC 3O62A 1N1JB 4XUJD 5AVBD 5B33A 2HIOC 5JA4B 1KX3D 1AOIB 3AN2C 3AYWA 3AZFD 4Z2MG 3A1KA 4WU8B 1ZLAC 1P3LB 5GT3B 2Y2QA 4J8XD 4Z2MH 3AZNC 3B6GA 3FDDA 1BH8B 2BYMA 4Z5TB 2W8SA 1A7WA 3VH5A 5B31C 1U35A 1P3LD 3B0DC 4J8UA 4KGCB 5DNNC 5GT3D 1M19B 3O62C 3AV1B 2Y2IA 4ZBJC 4WNNB 3AV2C 3LZ1A 3NQJB 3MGQB 5BT1D 5DNMA 4KGCD 5JRGB 3REKA 3AV1D 3WKJA 3B6FC 4CAYB 2G5IC 3MGQD 3KUYB 5BNXB 1P3FB 3B6GC 4WU9A 3W99A 1B6WA 3REJA 1U35C 3REHB 1WWSA 3MVDA 3MGPB 3X1UA 3AZEB 3KUYD 3C1CA 1EQZD 3W98B 3REIB 4G92B 3MNNC 5B32C 3LZ1C 3AZIA 3REHD 1P3OC 1JFIB 5G49A 5DNMC 4J8WD 3AZED 1F66B 3REKC 2HUEB 4WV4B 3W98D 3REID 2CV5B 4XZQA 2Y2GA 2AROA 5GT0B 1ID3D 4M6BA 3MGSA 4ZUXA 1F66D 3UT9A 5AV8B 2CV5D 2Y2KA 5CP6A 4YS3A 5AVBA 5AV9A 5GXQA 5GT0D 4JJNA 5AV5A 5BS7A 3TU4B 1HQ3A 5AV8D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N1J A;  5B2J B;  5JA4 A;  1AOI A;  5B1M B;  1HTA A;  4XZQ C;  5E5A B;  5F99 C;  3KXB C;  2ARO C;  5B24 B;  4H9R B;  3MGS C;  3NQU B;  4ZUX C;  4WU8 A;  1P3L A;  5B2J D;  1M18 B;  4QLC C;  1BH9 B;  5B1M D;  4J8V B;  4YS3 C;  4HGA B;  4Z5T A;  5GXQ C;  5B24 D;  4JJN C;  1M18 D;  5CHL B;  3UTB C;  3X1T B;  5AV5 C;  1M19 A;  1HQ3 C;  3AZI C;  4AWL B;  1P3K B;  3X1S C;  2IO5 B;  3X1T D;  5JRG A;  1P3K D;  5AV6 A;  2RVQ C;  5B0Y A;  3AZM B;  5CPJ B;  5BNX A;  1P3F A;  3LJA B;  3AV2 D;  1P34 B;  3MGP A;  3AZM D;  1P3I B;  5CPJ D;  1P3M C;  5CPI B;  3R45 B;  2F8N B;  4KHA B;  4H9O A;  3LZ0 B;  3LJA D;  3B0C W;  4H9Q A;  1P34 D;  1JFI A;  1P3I D;  5CPI D;  3WTP B;  3VH5 T;  2F8N D;  5AV6 C;  1KX5 C;  5B1L B;  5B0Y C;  1P3P B;  5C3I B;  2PYO A;  4Z66 C;  3WTP D;  2YFV A;  1P3A B;  1P3P D;  4KUD C;  4NE6 A;  2L5A A;  3TU4 A;  5B40 C;  3AZG C;  3AZL C;  1P3A D;  2NQB B;  1P3G B;  3WA9 A;  5E5A A;  5B24 A;  4H9R A;  3NQU A;  4UUZ A;  4LD9 B;  1TZY C;  4CSR A;  5KDM B;  4J8X B;  2NQB D;  2PYO C;  1P3G D;  5GSU B;  4J8V A;  1KX4 A;  3VH6 T;  3KXB B;  4LD9 D;  3LEL B;  1Q9C A;  3AZK B;  5GSU D;  1S32 A;  2NZD A;  5F99 D;  3KXB D;  4G91 B;  3A6N B;  3LEL D;  3AZK D;  3WA9 C;  4QLC D;  3AFA B;  4EO5 B;  5B33 C;  3W96 B;  4R8P B;  3WAA A;  1KU5 A;  4YM6 B;  3AYW C;  3C1B B;  3A6N D;  3AFA D;  1KX4 C;  3LJA A;  3X1S D;  3W96 D;  4R8P D;  5BNV B;  1P34 A;  1EQZ B;  4YM6 D;  3C1B D;  2BYK A;  2NZD C;  1S32 C;  4KHA A;  3LZ0 A;  4J8U C;  5B0Z A;  4J8W B;  4E45 A;  5AVC B;  1F1E A;  3KSY A;  4X23 B;  3AZJ A;  5CPK B;  3WTP A;  3V9R B;  5B31 G;  1ID3 B;  3WAA C;  3MGR B;  5B1L A;  3VH6 A;  4DRB A;  3UTA A;  3KWQ B;  5AVC D;  1P3M D;  4X23 D;  3WKJ C;  5B2I B;  5CPK D;  3MGR D;  3X1V B;  1TAF A;  3KWQ D;  1M1A A;  4WU9 C;  3W99 C;  5B2I D;  3REJ C;  3MVD C;  4XUJ A;  5BO0 B;  5B0Z C;  3X1U C;  1KX5 D;  3C1C C;  3W97 B;  3X1V D;  1KX3 A;  2FJ7 B;  2F8N G;  3AZJ C;  3AZF A;  4H9N A;  1P3G A;  1P3B B;  3UTA C;  3AZH B;  2F8N H;  3W97 D;  4LD9 A;  2FJ7 D;  4J8X A;  4KUD D;  5AY8 B;  5B32 G;  3REL B;  1P3B D;  3AZH D;  3UT9 C;  2HIO B;  5GT3 A;  3AZG D;  3AZL D;  3AN2 B;  1M1A C;  3AZK A;  5AY8 D;  5CP6 C;  3REL D;  1BH8 A;  4XUJ C;  5AVB C;  5AV9 C;  1KX3 C;  1ZLA B;  2HIO D;  3AZF C;  5BS7 C;  3A6N A;  4KGC A;  1TZY D;  3AN2 D;  3AV1 A;  3AZN B;  4H9S A;  4WNN A;  5B31 B;  3NQJ A;  4R8P A;  3MGQ A;  1AOI C;  4WZS B;  3B0D B;  1ZLA D;  4YM6 A;  4DRA A;  3C1B A;  5DNN B;  3O62 B;  3AZN D;  4ZBJ B;  2F8N K;  4WU8 C;  1P3L C;  3AV2 B;  4CAY A;  5B31 D;  3KUY A;  5BNV A;  5GT3 C;  1EQZ A;  5DNN D;  3VH5 W;  3O62 D;  4Z5T C;  3REH A;  3B6F B;  2YFW B;  4J8W A;  3AZE A;  4KGC C;  1M19 C;  5AVC A;  3REI A;  3AYW D;  3AV1 C;  3W98 A;  3B6G B;  4H9S C;  1B67 A;  3MGQ C;  1U35 B;  3MGR A;  1ID3 A;  3B6F D;  1F66 A;  5JRG C;  2CV5 A;  3B6G D;  1H3O B;  3MNN B;  5B32 B;  3LZ1 B;  4NFT A;  5GT0 A;  3KUY C;  1U35 D;  1P3O B;  5DNM B;  4J8U D;  3REK B;  1P3F C;  5AV8 A;  3REH C;  3MNN D;  4E44 A;  5B32 D;  3W97 A;  5BO0 A;  3LZ1 D;  3MGP C;  3AZE C;  1P3O D;  5DNM D;  3W98 C;  3REI C;  3REK D;  4G92 C;  3WKJ D;  3VH6 W;  1P3B A;  1F66 C;  5B2J A;  3AZH A;  2HUE C;  1BFM A;  5B1M A;  2CV5 C;  3W99 D;  3REL A;  3AZI B;  3REJ D;  5GT0 C;  5G49 B;  1M18 A;  3C1C D;  1BH9 A;  5AV8 C;  4XZQ B;  5F99 B;  3AZI D;  2ARO B;  3MGS B;  1ZLA A;  4ZUX B;  3X1T A;  4QLC B;  3TU4 C;  4XZQ D;  3AZN A;  1P3K A;  4YS3 B;  2ARO D;  5GXQ B;  5B2J C;  5B31 A;  3MGS D;  4JJN B;  4ZUX D;  3WTP E;  5FUG B;  5B1M C;  3UT9 D;  3UTB B;  5AV5 B;  5DNN A;  1HQ3 B;  5E5A C;  5CP6 D;  5B24 C;  3X1S B;  4YS3 D;  1M18 C;  3AV2 A;  5GXQ D;  5AV9 D;  4JJN D;  4H9P B;  3AZM A;  5CPJ A;  3UTB D;  5AV5 D;  1HQ3 D;  4J8V C;  4HGA C;  3B6F A;  2YFW A;  3X1T C;  1P3I A;  1AOI D;  5CPI A;  3R45 A;  4AWL C;  1P3K C;  2F8N A;  4WU8 D;  2RVQ D;  2IO5 C;  1P3M B;  1H3O A;  4Z5T D;  3MNN A;  5B32 A;  3AZM C;  5CPJ C;  1P3P A;  1P3O A;  2JSS A;  1M19 D;  3LJA C;  5AV6 B;  1KX5 B;  1P34 C;  5B0Y B;  1P3I C;  1P3A A;  5CPI C;  5JRG D;  4Z66 B;  3LZ0 C;  5AV6 D;  5B0Y D;  2NQB A;  4KUD B;  3WTP C;  1P3F D;  4Z66 D;  4H9O B;  5B1L C;  1P3P C;  4H9Q B;  5C3I C;  3MGP D;  5B40 B;  3AZG B;  3AZL B;  5KDM A;  5GSU A;  5F99 A;  3KXB A;  1P3A C;  5B40 D;  1TZY B;  3LEL A;  2PYO B;  2YFV B;  4QLC A;  2NQB C;  5FUG A;  1P3G C;  3UTB A;  2PYO D;  3AFA A;  3W96 A;  3X1S A;  4LD9 C;  4J8X C;  4H9P A;  5GSU C;  3WA9 B;  3TU4 D;  5B33 B;  4UUZ B;  1ULY A;  3LEL C;  4CSR B;  3AZK C;  3AYW B;  3WA9 D;  5E5A D;  1KX4 B;  4G91 C;  5BT1 C;  5B33 D;  3A6N C;  1P3M A;  4X23 A;  3AFA C;  5CPK A;  2BYM B;  1S32 B;  3V9R A;  4EO5 C;  3W96 C;  2NZD B;  4R8P C;  4J8V D;  1KX4 D;  4YM6 C;  4J8U B;  3C1B C;  3KWQ A;  5B2I A;  2NZD D;  1S32 D;  1KX5 A;  3WAA B;  1EQZ C;  1R4V A;  3X1V A;  3B0B A;  3WKJ B;  4NE5 A;  4Z66 A;  4J8W C;  3WAA D;  2LY8 A;  5AVC C;  2FJ7 A;  4X23 C;  4KUD A;  2CWE A;  5CPK C;  2BYK B;  4WU9 B;  3W99 B;  3REJ B;  1ID3 C;  3MGR C;  3MVD B;  3X1U B;  5B0Z B;  3C1C B;  3KWQ C;  5B40 A;  3AZG A;  3AZL A;  3AZJ B;  5AY8 A;  5B2I C;  4WU9 D;  3LZ0 D;  3MVD D;  3X1V C;  3X1U D;  5B0Z D;  3UTA B;  2HIO A;  1TZY A;  3AN2 A;  3AZJ D;  3W97 C;  3B0C T;  5B1L D;  2FJ7 C;  3UTA D;  4NE3 A;  3UT9 B;  1WWI A;  1TAF B;  1M1A B;  5CP6 B;  4XUJ B;  1P3B C;  5AVB B;  5AV9 B;  3AZH C;  1KX3 B;  5AY8 C;  3AZF B;  1M1A D;  4H9N B;  3REL C;  3O62 A;  1N1J B;  4XUJ D;  5AVB D;  5B33 A;  2HIO C;  5JA4 B;  1KX3 D;  1AOI B;  3AN2 C;  3AYW A;  3AZF D;  4Z2M G;  4WU8 B;  1ZLA C;  1P3L B;  5GT3 B;  4J8X D;  4Z2M H;  3AZN C;  3B6G A;  1BH8 B;  2BYM A;  4Z5T B;  3VH5 A;  1A7W A;  5B31 C;  1U35 A;  1P3L D;  3B0D C;  4J8U A;  4KGC B;  5DNN C;  5GT3 D;  1M19 B;  3O62 C;  3AV1 B;  4ZBJ C;  4WNN B;  3AV2 C;  3LZ1 A;  3NQJ B;  3MGQ B;  5BT1 D;  5DNM A;  4KGC D;  5JRG B;  3REK A;  3AV1 D;  3WKJ A;  3B6F C;  4CAY B;  3MGQ D;  3KUY B;  5BNX B;  1P3F B;  3B6G C;  4WU9 A;  3W99 A;  1B6W A;  3REJ A;  1U35 C;  3REH B;  1WWS A;  3MVD A;  3MGP B;  3X1U A;  3AZE B;  3KUY D;  3C1C A;  1EQZ D;  3W98 B;  3REI B;  4G92 B;  3MNN C;  5B32 C;  3LZ1 C;  3AZI A;  3REH D;  1P3O C;  1JFI B;  5G49 A;  5DNM C;  4J8W D;  3AZE D;  1F66 B;  3REK C;  2HUE B;  4WV4 B;  3W98 D;  3REI D;  2CV5 B;  4XZQ A;  2ARO A;  5GT0 B;  1ID3 D;  4M6B A;  3MGS A;  4ZUX A;  1F66 D;  3UT9 A;  5AV8 B;  2CV5 D;  5CP6 A;  4YS3 A;  5AVB A;  5AV9 A;  5GXQ A;  5GT0 D;  4JJN A;  5AV5 A;  5BS7 A;  3TU4 B;  1HQ3 A;  5AV8 D; 
#chains in the Genus database with same CATH topology
 1N1J A;  5B2J B;  5JA4 A;  1AOI A;  2UWX A;  5B1M B;  1HTA A;  4XZQ C;  5E5A B;  5F99 C;  3KXB C;  2ARO C;  5B24 B;  4H9R B;  3MGS C;  3NQU B;  4ZUX C;  3P5J B;  4WU8 A;  5B2J D;  1P3L A;  1M18 B;  4QLC C;  1BH9 B;  5B1M D;  4J8V B;  4YS3 C;  4HGA B;  2G5H C;  4Z5T A;  5GXQ C;  5B24 D;  4JJN C;  1M18 D;  5CHL B;  3UTB C;  3X1T B;  5AV5 C;  1M19 A;  1HQ3 C;  3AZI C;  4AWL B;  1P3K B;  3X1S C;  2IO5 B;  3X1T D;  5JRG A;  1P3K D;  2Y2P A;  5AV6 A;  2RVQ C;  5B0Y A;  3AZM B;  5CPJ B;  5BNX A;  1P3F A;  3LJA B;  3AV2 D;  1P34 B;  3MGP A;  3AZM D;  1P3I B;  5CPJ D;  1P3M C;  5CPI B;  3R45 B;  2F8N B;  4KHA B;  4H9O A;  3LZ0 B;  3LJA D;  3B0C W;  4H9Q A;  1P34 D;  1JFI A;  1P3I D;  5CPI D;  3EPH A;  3WTP B;  3VH5 T;  2F8N D;  5AV6 C;  1KX5 C;  4WJ3 C;  5B1L B;  5B0Y C;  1P3P B;  5C3I B;  2PYO A;  4Z66 C;  3WTP D;  2YFV A;  4UPK A;  2ZY4 A;  1P3A B;  1P3P D;  4KUD C;  4NE6 A;  2L5A A;  3TU4 A;  5B40 C;  3AZG C;  3AZL C;  1P3A D;  2NQB B;  1P3G B;  3WA9 A;  5E5A A;  5B24 A;  4H9R A;  3NQU A;  4UUZ A;  4LD9 B;  2XD1 A;  1TZY C;  4CSR A;  5KDM B;  4J8X B;  2NQB D;  2PYO C;  1P3G D;  5GSU B;  4J8V A;  1KX4 A;  3VH6 T;  3KXB B;  2JE5 A;  2RIQ A;  4LD9 D;  3LEL B;  1Q9C A;  3AZK B;  5GSU D;  1S32 A;  2NZD A;  5F99 D;  3KXB D;  4G91 B;  3A6N B;  3LEL D;  3AZK D;  3WA9 C;  4QLC D;  3AFA B;  4EO5 B;  5B33 C;  3W96 B;  4R8P B;  3WAA A;  1KU5 A;  4YM6 B;  2Y2L A;  3AYW C;  3C1B B;  3A6N D;  3AFA D;  1KX4 C;  3LJA A;  3X1S D;  3W96 D;  4R8P D;  5BNV B;  1P34 A;  1EQZ B;  4YM6 D;  3C1B D;  2BYK A;  2NZD C;  1S32 C;  4KHA A;  3LZ0 A;  4J8U C;  5B0Z A;  4J8W B;  4E45 A;  5AVC B;  1F1E A;  3KSY A;  4X23 B;  3AZJ A;  3H0M C;  5CPK B;  3WTP A;  3V9R B;  5B31 G;  1ID3 B;  3WAA C;  3MGR B;  5B1L A;  3VH6 A;  4DRB A;  3UTA A;  3KWQ B;  5AVC D;  1P3M D;  4X23 D;  3WKJ C;  5B2I B;  5CPK D;  3MGR D;  3X1V B;  1TAF A;  3KWQ D;  1M1A A;  4WU9 C;  3W99 C;  2ZY2 A;  5B2I D;  3REJ C;  3MVD C;  4XUJ A;  5BO0 B;  5B0Z C;  3X1U C;  1KX5 D;  3C1C C;  3W97 B;  3X1V D;  1KX3 A;  2FJ7 B;  2F8N G;  3AZJ C;  3AZF A;  4H9N A;  1P3G A;  1P3B B;  3UTA C;  3AZH B;  2F8N H;  3IP4 C;  3W97 D;  4LD9 A;  2FJ7 D;  4J8X A;  4KUD D;  5AY8 B;  5B32 G;  3REL B;  1P3B D;  3AZH D;  3UT9 C;  2HIO B;  2Y2J A;  5GT3 A;  3AZG D;  3AZL D;  3AN2 B;  1M1A C;  3AZK A;  5AY8 D;  5CP6 C;  3REL D;  1BH8 A;  4XUJ C;  5AVB C;  5AV9 C;  1KX3 C;  1ZLA B;  2HIO D;  3AZF C;  5BS7 C;  3A6N A;  4KGC A;  1TZY D;  3AN2 D;  3AV1 A;  3AZN B;  4H9S A;  4WNN A;  5B31 B;  3NQJ A;  4R8P A;  3MGQ A;  1AOI C;  4WZS B;  3B0D B;  3A1I A;  4DQY B;  4YM6 A;  1ZLA D;  4DRA A;  3C1B A;  3H0L C;  5DNN B;  3O62 B;  3AZN D;  4ZBJ B;  2F8N K;  4WU8 C;  1P3L C;  3AV2 B;  4CAY A;  5B31 D;  3KUY A;  5BNV A;  5GT3 C;  1EQZ A;  2DF4 C;  5DNN D;  3VH5 W;  3O62 D;  4Z5T C;  3REH A;  3B6F B;  2YFW B;  3EPK A;  4J8W A;  3AZE A;  4KGC C;  1M19 C;  5AVC A;  3REI A;  3AYW D;  3AV1 C;  3W98 A;  3B6G B;  4H9S C;  1B67 A;  3MGQ C;  1U35 B;  3MGR A;  1ID3 A;  3B6F D;  1F66 A;  5JRG C;  2CV5 A;  3B6G D;  1H3O B;  3MNN B;  5B32 B;  3LZ1 B;  1PZR A;  4NFT A;  5GT0 A;  3KUY C;  1U35 D;  1P3O B;  5DNM B;  4J8U D;  3REK B;  1P3F C;  5AV8 A;  3REH C;  2ZY5 A;  3MNN D;  4E44 A;  5B32 D;  3W97 A;  5BO0 A;  3LZ1 D;  3MGP C;  3AZE C;  1P3O D;  5DNM D;  3W98 C;  3REI C;  3REK D;  4G92 C;  3WKJ D;  2Y2H A;  3VH6 W;  1P3B A;  1F66 C;  5B2J A;  3AZH A;  2HUE C;  2VQR A;  2ZY3 A;  3KFU G;  1BFM A;  5B1M A;  2CV5 C;  3W99 D;  3REL A;  3AZI B;  3REJ D;  5GT0 C;  5G49 B;  1M18 A;  2JCH A;  3C1C D;  1BH9 A;  5AV8 C;  4XZQ B;  2FFF B;  5F99 B;  3AZI D;  2ARO B;  3MGS B;  1ZLA A;  4ZUX B;  3X1T A;  4QLC B;  3TU4 C;  4XZQ D;  3AZN A;  1P3K A;  4YS3 B;  2ARO D;  5GXQ B;  5B2J C;  5B31 A;  3MGS D;  4JJN B;  2F2A C;  4ZUX D;  3WTP E;  5FUG B;  5B1M C;  3UT9 D;  3UTB B;  5AV5 B;  5DNN A;  1HQ3 B;  5E5A C;  5CP6 D;  5B24 C;  1W2E A;  3X1S B;  4YS3 D;  1M18 C;  3AV2 A;  5GXQ D;  5AV9 D;  2DQN C;  4H9P B;  4JJN D;  3AZM A;  5CPJ A;  3UTB D;  5AV5 D;  1HQ3 D;  4J8V C;  4HGA C;  3EG5 B;  3B6F A;  2YFW A;  3X1T C;  1P3I A;  1AOI D;  5CPI A;  3R45 A;  4AWL C;  1P3K C;  2F8N A;  4WU8 D;  2RVQ D;  2IO5 C;  1P3M B;  1H3O A;  4Z5T D;  3MNN A;  5B32 A;  3AZM C;  5CPJ C;  1P3P A;  1P3O A;  2JSS A;  1M19 D;  3LJA C;  5AV6 B;  1KX5 B;  1P34 C;  5B0Y B;  1P3I C;  1P3A A;  5CPI C;  5JRG D;  4Z66 B;  3LZ0 C;  5AV6 D;  3EPJ A;  5B0Y D;  2NQB A;  4KUD B;  3WTP C;  1P3F D;  4Z66 D;  4H9O B;  5B1L C;  1P3P C;  4H9Q B;  5C3I C;  3MGP D;  5B40 B;  3AZG B;  3AZL B;  5KDM A;  1Z2C B;  5GSU A;  5F99 A;  3KXB A;  1P3A C;  2Y2N A;  5B40 D;  1TZY B;  3LEL A;  3EPL A;  2PYO B;  2YFV B;  4QLC A;  3H0R C;  2NQB C;  5FUG A;  1P3G C;  3UTB A;  3AL0 C;  2PYO D;  2Y2O A;  3F6T A;  3AFA A;  3W96 A;  3X1S A;  4LD9 C;  4J8X C;  4H9P A;  5GSU C;  3WA9 B;  3TU4 D;  5B33 B;  4UUZ B;  1ULY A;  3LEL C;  4CSR B;  3AZK C;  1T3U A;  3AYW B;  3WA9 D;  5E5A D;  1KX4 B;  4G91 C;  5BT1 C;  5B33 D;  3A6N C;  2BG1 A;  1P3M A;  4X23 A;  2Y2M A;  3AFA C;  5CPK A;  2BYM B;  1S32 B;  3V9R A;  4EO5 C;  3W96 C;  2NZD B;  4R8P C;  4J8V D;  1KX4 D;  2J8P A;  4YM6 C;  4J8U B;  3C1B C;  3KWQ A;  5B2I A;  2NZD D;  1S32 D;  1KX5 A;  3WAA B;  1EQZ C;  1R4V A;  3X1V A;  2ZM5 A;  3B0B A;  3WKJ B;  4NE5 A;  4Z66 A;  4J8W C;  3WAA D;  2LY8 A;  5AVC C;  2FJ7 A;  4X23 C;  4KUD A;  2CWE A;  5CPK C;  2BYK B;  4WU9 B;  3W99 B;  3REJ B;  1ID3 C;  3MGR C;  3MVD B;  3X1U B;  5B0Z B;  3C1C B;  3KWQ C;  5B40 A;  3AZG A;  3AZL A;  3AZJ B;  5AY8 A;  5B2I C;  4WU9 D;  3LZ0 D;  3MVD D;  3X1V C;  3X1U D;  5B0Z D;  3UTA B;  2HIO A;  1TZY A;  3AN2 A;  3AZJ D;  3W97 C;  3B0C T;  5B1L D;  2FJ7 C;  3UTA D;  4NE3 A;  2XD5 A;  3UT9 B;  1WWI A;  1TAF B;  1M1A B;  5CP6 B;  4XUJ B;  1P3B C;  5AVB B;  5AV9 B;  3AZH C;  1KX3 B;  5AY8 C;  3AZF B;  1M1A D;  4H9N B;  3REL C;  3O62 A;  1N1J B;  4XUJ D;  5AVB D;  5B33 A;  2HIO C;  5JA4 B;  1KX3 D;  1AOI B;  3AN2 C;  3AYW A;  3AZF D;  4Z2M G;  3A1K A;  4WU8 B;  1ZLA C;  1P3L B;  5GT3 B;  2Y2Q A;  4J8X D;  4Z2M H;  3AZN C;  3B6G A;  3FDD A;  1BH8 B;  2BYM A;  4Z5T B;  2W8S A;  1A7W A;  3VH5 A;  5B31 C;  1U35 A;  1P3L D;  3B0D C;  4J8U A;  4KGC B;  5DNN C;  5GT3 D;  1M19 B;  3O62 C;  3AV1 B;  2Y2I A;  4ZBJ C;  4WNN B;  3AV2 C;  3LZ1 A;  3NQJ B;  3MGQ B;  5BT1 D;  5DNM A;  4KGC D;  5JRG B;  3REK A;  3AV1 D;  3WKJ A;  3B6F C;  4CAY B;  2G5I C;  3MGQ D;  3KUY B;  5BNX B;  1P3F B;  3B6G C;  4WU9 A;  3W99 A;  1B6W A;  3REJ A;  1U35 C;  3REH B;  1WWS A;  3MVD A;  3MGP B;  3X1U A;  3AZE B;  3KUY D;  3C1C A;  1EQZ D;  3W98 B;  3REI B;  4G92 B;  3MNN C;  5B32 C;  3LZ1 C;  3AZI A;  3REH D;  1P3O C;  1JFI B;  5G49 A;  5DNM C;  4J8W D;  3AZE D;  1F66 B;  3REK C;  2HUE B;  4WV4 B;  3W98 D;  3REI D;  2CV5 B;  4XZQ A;  2Y2G A;  2ARO A;  5GT0 B;  1ID3 D;  4M6B A;  3MGS A;  4ZUX A;  1F66 D;  3UT9 A;  5AV8 B;  2CV5 D;  2Y2K A;  5CP6 A;  4YS3 A;  5AVB A;  5AV9 A;  5GXQ A;  5GT0 D;  4JJN A;  5AV5 A;  5BS7 A;  3TU4 B;  1HQ3 A;  5AV8 D; 
#chains in the Genus database with same CATH homology
 1N1J A;  5B2J B;  5JA4 A;  1AOI A;  2UWX A;  5B1M B;  1HTA A;  4XZQ C;  5E5A B;  5F99 C;  3KXB C;  2ARO C;  5B24 B;  4H9R B;  3MGS C;  3NQU B;  4ZUX C;  3P5J B;  4WU8 A;  5B2J D;  1P3L A;  1M18 B;  4QLC C;  1BH9 B;  5B1M D;  4J8V B;  4YS3 C;  4HGA B;  2G5H C;  4Z5T A;  5GXQ C;  5B24 D;  4JJN C;  1M18 D;  5CHL B;  3UTB C;  3X1T B;  5AV5 C;  1M19 A;  1HQ3 C;  3AZI C;  4AWL B;  1P3K B;  3X1S C;  2IO5 B;  3X1T D;  5JRG A;  1P3K D;  2Y2P A;  5AV6 A;  2RVQ C;  5B0Y A;  3AZM B;  5CPJ B;  5BNX A;  1P3F A;  3LJA B;  3AV2 D;  1P34 B;  3MGP A;  3AZM D;  1P3I B;  5CPJ D;  1P3M C;  5CPI B;  3R45 B;  2F8N B;  4KHA B;  4H9O A;  3LZ0 B;  3LJA D;  3B0C W;  4H9Q A;  1P34 D;  1JFI A;  1P3I D;  5CPI D;  3EPH A;  3WTP B;  3VH5 T;  2F8N D;  5AV6 C;  1KX5 C;  4WJ3 C;  5B1L B;  5B0Y C;  1P3P B;  5C3I B;  2PYO A;  4Z66 C;  3WTP D;  2YFV A;  4UPK A;  2ZY4 A;  1P3A B;  1P3P D;  4KUD C;  4NE6 A;  2L5A A;  3TU4 A;  5B40 C;  3AZG C;  3AZL C;  1P3A D;  2NQB B;  1P3G B;  3WA9 A;  5E5A A;  5B24 A;  4H9R A;  3NQU A;  4UUZ A;  4LD9 B;  2XD1 A;  1TZY C;  4CSR A;  5KDM B;  4J8X B;  2NQB D;  2PYO C;  1P3G D;  5GSU B;  4J8V A;  1KX4 A;  3VH6 T;  3KXB B;  2JE5 A;  2RIQ A;  4LD9 D;  3LEL B;  1Q9C A;  3AZK B;  5GSU D;  1S32 A;  2NZD A;  5F99 D;  3KXB D;  4G91 B;  3A6N B;  3LEL D;  3AZK D;  3WA9 C;  4QLC D;  3AFA B;  4EO5 B;  5B33 C;  3W96 B;  4R8P B;  3WAA A;  1KU5 A;  4YM6 B;  2Y2L A;  3AYW C;  3C1B B;  3A6N D;  3AFA D;  1KX4 C;  3LJA A;  3X1S D;  3W96 D;  4R8P D;  5BNV B;  1P34 A;  1EQZ B;  4YM6 D;  3C1B D;  2BYK A;  2NZD C;  1S32 C;  4KHA A;  3LZ0 A;  4J8U C;  5B0Z A;  4J8W B;  4E45 A;  5AVC B;  1F1E A;  3KSY A;  4X23 B;  3AZJ A;  3H0M C;  5CPK B;  3WTP A;  3V9R B;  5B31 G;  1ID3 B;  3WAA C;  3MGR B;  5B1L A;  3VH6 A;  4DRB A;  3UTA A;  3KWQ B;  5AVC D;  1P3M D;  4X23 D;  3WKJ C;  5B2I B;  5CPK D;  3MGR D;  3X1V B;  1TAF A;  3KWQ D;  1M1A A;  4WU9 C;  3W99 C;  2ZY2 A;  5B2I D;  3REJ C;  3MVD C;  4XUJ A;  5BO0 B;  5B0Z C;  3X1U C;  1KX5 D;  3C1C C;  3W97 B;  3X1V D;  1KX3 A;  2FJ7 B;  2F8N G;  3AZJ C;  3AZF A;  4H9N A;  1P3G A;  1P3B B;  3UTA C;  3AZH B;  2F8N H;  3IP4 C;  3W97 D;  4LD9 A;  2FJ7 D;  4J8X A;  4KUD D;  5AY8 B;  5B32 G;  3REL B;  1P3B D;  3AZH D;  3UT9 C;  2HIO B;  2Y2J A;  5GT3 A;  3AZG D;  3AZL D;  3AN2 B;  1M1A C;  3AZK A;  5AY8 D;  5CP6 C;  3REL D;  1BH8 A;  4XUJ C;  5AVB C;  5AV9 C;  1KX3 C;  1ZLA B;  2HIO D;  3AZF C;  5BS7 C;  3A6N A;  4KGC A;  1TZY D;  3AN2 D;  3AV1 A;  3AZN B;  4H9S A;  4WNN A;  5B31 B;  3NQJ A;  4R8P A;  3MGQ A;  1AOI C;  4WZS B;  3B0D B;  3A1I A;  4DQY B;  4YM6 A;  1ZLA D;  4DRA A;  3C1B A;  3H0L C;  5DNN B;  3O62 B;  3AZN D;  4ZBJ B;  2F8N K;  4WU8 C;  1P3L C;  3AV2 B;  4CAY A;  5B31 D;  3KUY A;  5BNV A;  5GT3 C;  1EQZ A;  2DF4 C;  5DNN D;  3VH5 W;  3O62 D;  4Z5T C;  3REH A;  3B6F B;  2YFW B;  3EPK A;  4J8W A;  3AZE A;  4KGC C;  1M19 C;  5AVC A;  3REI A;  3AYW D;  3AV1 C;  3W98 A;  3B6G B;  4H9S C;  1B67 A;  3MGQ C;  1U35 B;  3MGR A;  1ID3 A;  3B6F D;  1F66 A;  5JRG C;  2CV5 A;  3B6G D;  1H3O B;  3MNN B;  5B32 B;  3LZ1 B;  1PZR A;  4NFT A;  5GT0 A;  3KUY C;  1U35 D;  1P3O B;  5DNM B;  4J8U D;  3REK B;  1P3F C;  5AV8 A;  3REH C;  2ZY5 A;  3MNN D;  4E44 A;  5B32 D;  3W97 A;  5BO0 A;  3LZ1 D;  3MGP C;  3AZE C;  1P3O D;  5DNM D;  3W98 C;  3REI C;  3REK D;  4G92 C;  3WKJ D;  2Y2H A;  3VH6 W;  1P3B A;  1F66 C;  5B2J A;  3AZH A;  2HUE C;  2VQR A;  2ZY3 A;  3KFU G;  1BFM A;  5B1M A;  2CV5 C;  3W99 D;  3REL A;  3AZI B;  3REJ D;  5GT0 C;  5G49 B;  1M18 A;  2JCH A;  3C1C D;  1BH9 A;  5AV8 C;  4XZQ B;  2FFF B;  5F99 B;  3AZI D;  2ARO B;  3MGS B;  1ZLA A;  4ZUX B;  3X1T A;  4QLC B;  3TU4 C;  4XZQ D;  3AZN A;  1P3K A;  4YS3 B;  2ARO D;  5GXQ B;  5B2J C;  5B31 A;  3MGS D;  4JJN B;  2F2A C;  4ZUX D;  3WTP E;  5FUG B;  5B1M C;  3UT9 D;  3UTB B;  5AV5 B;  5DNN A;  1HQ3 B;  5E5A C;  5CP6 D;  5B24 C;  1W2E A;  3X1S B;  4YS3 D;  1M18 C;  3AV2 A;  5GXQ D;  5AV9 D;  2DQN C;  4H9P B;  4JJN D;  3AZM A;  5CPJ A;  3UTB D;  5AV5 D;  1HQ3 D;  4J8V C;  4HGA C;  3EG5 B;  3B6F A;  2YFW A;  3X1T C;  1P3I A;  1AOI D;  5CPI A;  3R45 A;  4AWL C;  1P3K C;  2F8N A;  4WU8 D;  2RVQ D;  2IO5 C;  1P3M B;  1H3O A;  4Z5T D;  3MNN A;  5B32 A;  3AZM C;  5CPJ C;  1P3P A;  1P3O A;  2JSS A;  1M19 D;  3LJA C;  5AV6 B;  1KX5 B;  1P34 C;  5B0Y B;  1P3I C;  1P3A A;  5CPI C;  5JRG D;  4Z66 B;  3LZ0 C;  5AV6 D;  3EPJ A;  5B0Y D;  2NQB A;  4KUD B;  3WTP C;  1P3F D;  4Z66 D;  4H9O B;  5B1L C;  1P3P C;  4H9Q B;  5C3I C;  3MGP D;  5B40 B;  3AZG B;  3AZL B;  5KDM A;  1Z2C B;  5GSU A;  5F99 A;  3KXB A;  1P3A C;  2Y2N A;  5B40 D;  1TZY B;  3LEL A;  3EPL A;  2PYO B;  2YFV B;  4QLC A;  3H0R C;  2NQB C;  5FUG A;  1P3G C;  3UTB A;  3AL0 C;  2PYO D;  2Y2O A;  3F6T A;  3AFA A;  3W96 A;  3X1S A;  4LD9 C;  4J8X C;  4H9P A;  5GSU C;  3WA9 B;  3TU4 D;  5B33 B;  4UUZ B;  1ULY A;  3LEL C;  4CSR B;  3AZK C;  1T3U A;  3AYW B;  3WA9 D;  5E5A D;  1KX4 B;  4G91 C;  5BT1 C;  5B33 D;  3A6N C;  2BG1 A;  1P3M A;  4X23 A;  2Y2M A;  3AFA C;  5CPK A;  2BYM B;  1S32 B;  3V9R A;  4EO5 C;  3W96 C;  2NZD B;  4R8P C;  4J8V D;  1KX4 D;  2J8P A;  4YM6 C;  4J8U B;  3C1B C;  3KWQ A;  5B2I A;  2NZD D;  1S32 D;  1KX5 A;  3WAA B;  1EQZ C;  1R4V A;  3X1V A;  2ZM5 A;  3B0B A;  3WKJ B;  4NE5 A;  4Z66 A;  4J8W C;  3WAA D;  2LY8 A;  5AVC C;  2FJ7 A;  4X23 C;  4KUD A;  2CWE A;  5CPK C;  2BYK B;  4WU9 B;  3W99 B;  3REJ B;  1ID3 C;  3MGR C;  3MVD B;  3X1U B;  5B0Z B;  3C1C B;  3KWQ C;  5B40 A;  3AZG A;  3AZL A;  3AZJ B;  5AY8 A;  5B2I C;  4WU9 D;  3LZ0 D;  3MVD D;  3X1V C;  3X1U D;  5B0Z D;  3UTA B;  2HIO A;  1TZY A;  3AN2 A;  3AZJ D;  3W97 C;  3B0C T;  5B1L D;  2FJ7 C;  3UTA D;  4NE3 A;  2XD5 A;  3UT9 B;  1WWI A;  1TAF B;  1M1A B;  5CP6 B;  4XUJ B;  1P3B C;  5AVB B;  5AV9 B;  3AZH C;  1KX3 B;  5AY8 C;  3AZF B;  1M1A D;  4H9N B;  3REL C;  3O62 A;  1N1J B;  4XUJ D;  5AVB D;  5B33 A;  2HIO C;  5JA4 B;  1KX3 D;  1AOI B;  3AN2 C;  3AYW A;  3AZF D;  4Z2M G;  3A1K A;  4WU8 B;  1ZLA C;  1P3L B;  5GT3 B;  2Y2Q A;  4J8X D;  4Z2M H;  3AZN C;  3B6G A;  3FDD A;  1BH8 B;  2BYM A;  4Z5T B;  2W8S A;  1A7W A;  3VH5 A;  5B31 C;  1U35 A;  1P3L D;  3B0D C;  4J8U A;  4KGC B;  5DNN C;  5GT3 D;  1M19 B;  3O62 C;  3AV1 B;  2Y2I A;  4ZBJ C;  4WNN B;  3AV2 C;  3LZ1 A;  3NQJ B;  3MGQ B;  5BT1 D;  5DNM A;  4KGC D;  5JRG B;  3REK A;  3AV1 D;  3WKJ A;  3B6F C;  4CAY B;  2G5I C;  3MGQ D;  3KUY B;  5BNX B;  1P3F B;  3B6G C;  4WU9 A;  3W99 A;  1B6W A;  3REJ A;  1U35 C;  3REH B;  1WWS A;  3MVD A;  3MGP B;  3X1U A;  3AZE B;  3KUY D;  3C1C A;  1EQZ D;  3W98 B;  3REI B;  4G92 B;  3MNN C;  5B32 C;  3LZ1 C;  3AZI A;  3REH D;  1P3O C;  1JFI B;  5G49 A;  5DNM C;  4J8W D;  3AZE D;  1F66 B;  3REK C;  2HUE B;  4WV4 B;  3W98 D;  3REI D;  2CV5 B;  4XZQ A;  2Y2G A;  2ARO A;  5GT0 B;  1ID3 D;  4M6B A;  3MGS A;  4ZUX A;  1F66 D;  3UT9 A;  5AV8 B;  2CV5 D;  2Y2K A;  5CP6 A;  4YS3 A;  5AVB A;  5AV9 A;  5GXQ A;  5GT0 D;  4JJN A;  5AV5 A;  5BS7 A;  3TU4 B;  1HQ3 A;  5AV8 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...