5CP6C

Nucleosome core particle with adducts from the anticancer compound, [(eta6-5,8,9,10-tetrahydroanthracene)ru(ethylenediamine)cl][pf6]
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
106
structure length
106
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (145-MER)
publication title An Organometallic Compound which Exhibits a DNA Topology-Dependent One-Stranded Intercalation Mode.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 32
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5cp6C00
3AZMD 5B2IC 2HIOA 3NQJB 5KDMA 4XUJD 3MVDA 2FJ7C 5GT0C 3KUYA 1KX3D 4CAYA 1Q9CA 3KXBB 5F99A 4H9OA 4QLCD 4Z66A 2AROA 1B6WA 3REKC 3AZID 3AV1A 2JSSA 5CP6D 4LD9D 1P3BB 4KUDA 2L5AA 3REJB 4WNNB 5AV5D 1ID3C 3LZ0B 5B33C 3AZLA 1M1AA 1U35D 3WA9C 1F1EA 4YS3C 3V9RA 5AVBD 3W96A 3KUYC 3W97B 5F99C 3TU4D 5DNND 4WU8A 4Z66C 4AWLB 4X23C 3KWQB 5CPKB 3AFAB 1P3AC 3WKJD 2RVQD 3AYWD 3AZJB 5B24C 3WAAB 1TAFA 4E45A 3B0CW 1S32A 3X1SD 3WTPE 5B40C 3AN2D 5GT3D 3VH6T 1KX5D 2NZDC 5DNMA 3W98B 1EQZB 3X1UA 4WU8C 4KGCA 4Z5TA 5BNXB 3AZFA 1P34A 4CSRA 3REHB 3WTPB 3A6NC 5AY8C 4G91B 4DRAA 3X1TD 5GXQA 3LJAD 5B1MD 1M19B 4EO5C 3C1BC 4H9NA 2F8NA 4XZQB 3NQUA 5G49B 1S32C 3MNNA 1H3OB 3KXBC 3UTAB 1F66D 4J8UA 2BYKA 3LZ1B 5B31G 2CV5B 3MGPB 5BS7C 3X1UC 1HTAA 4KGCC 1P3PB 5JRGA 5CPJB 1P3BC 1P3FB 3B6GA 1P34C 3MGRB 1P3KD 5E5AB 5C3IC 5GXQC 3LZ0C 2IO5B 5AVCD 4YM6D 3AZKA 1P3MA 5AV6A 3LELB 5FUGB 5B2IB 2FJ7B 3AZED 4J8UC 1ZLAA 3B0BA 3AZHD 4JJNA 1P3LA 5JRGC 3O62B 3B0DC 3B6GC 5B0ZB 4J8XA 3AZJC 1P3IA 3WAAC 3C1CA 1JFIA 4J8WB 1P3MC 1ID3B 2HUEB 5B33B 3WA9B 5AV6C 1P3GA 2HIOB 3B6FD 5CPIA 4KHAA 3VH6W 2PYOD 3W98C 1AOIA 3KUYB 4CAYB 5F99B 3AV2D 4H9OB 3WTPC 3UT9D 4Z66B 1P3LC 4X23B 3W97D 2AROB 4G91C 1M18D 3KWQD 5CPKD 3AV1B 3AZGA 3VH5A 1P3IC 1KX4C 1P3AB 4XZQC 4XUJA 3VH6A 5B24B 4H9RB 1KX3A 1P3GC 1P3OC 5GSUD 4QLCA 3V9RB 3UTBD 2CV5C 5BT1C 1AOIC 3MGPC 3AZIA 5AV8D 1P3PC 5CP6A 4LD9A 1A7WA 1HQ3D 4WU8B 2BYMB 2IO5C 5AV5A 3AZGC 1U35A 5AY8B 3REHD 5AVBA 3LELC 4XUJC 4WU9D 4EO5B 3C1BB 1BH9A 1TAFB 4QLCC 5DNNA 3TU4A 1S32B 3AZIC 5B31D 3KSYA 4UUZB 3O62C 4NE3A 1TZYD 5DNMB 3WKJA 5B0ZC 3X1UB 3AYWA 4KGCB 4Z5TB 5AV5C 1P34B 4CSRB 4R8PD 4H9QA 4J8WC 5C3IB 3MGRD 2HUEC 5GXQB 2HIOC 3AN2A 5GT3A 5B32D 3MGSD 1KX5A 4H9NB 4J8VD 2F8NB 3MVDC 3W99D 2F8NH 5DNNC 5B2ID 3X1VD 3MNNB 4J8UB 2FJ7D 5BO0A 2AROC 5GT0D 2NQBD 3WKJC 2RVQC 3AV1C 3X1TA 3LJAA 5B1MA 3RELD 3AYWC 5JRGB 2YFVA 3B0DB 3B6GB 5B2JD 4KUDC 3REKD 3AZLC 1M1AC 1F66A 3AZND 3AN2C 5GT3C 1KX5C 1P3MB 5AV6B 5B33D 3W96C 2YFWB 4YS3D 5AV9D 1N1JA 1P3KA 3X1TC 5AVCA 4YM6A 1P3LB 1BFMA 4X23D 4J8XB 1P3IB 1KX4B 1P3AD 1ULYA 1JFIB 3AZEA 5B24D 1P3GB 1P3OB 3AZHA 5JA4A 5CPIB 5B1LD 4KHAB 5DNMC 1AOIB 5B0YD 5B40D 1P3KC 4Z5TC 2NZDD 3AZFC 4ZUXD 3AZGB 3MGQD 3B6FA 3A6ND 5AY8D 2PYOA 4XUJB 4HGAB 3AZEC 1KX3B 3MNNC 3C1BD 3AV2A 4QLCB 3UT9A 1B67A 1M18A 3KWQA 3AZIB 5BNVA 5CP6B 3KXBD 4LD9B 1WWIA 3REIA 4G92C 5AV5B 1P3BD 3AZKC 5GSUA 3B6FC 3REJD 3UTBA 2LY8A 2PYOC 3LZ0D 5AV8A 5KDMB 1BH9B 3MVDB 1HQ3A 3UT9C 5DNNB 1ZLAC 1M18C 4JJNC 2F8NK 4J8UD 3REHA 3WKJB 3REIC 3AFAD 4J8XC 3AYWB 3AZMA 4WU9A 3C1CC 4WZSB 5JRGD 4KUDB 4H9QB 3UTBC 3AZJD 3WAAD 3AZLB 1M1AB 5CPIC 5GT3B 5AV8C 3AN2B 1KX5B 5B31A 4H9SA 1TZYA 1HQ3C 3W96B 1BH8A 4M6BA 3W98D 5BO0B 4R8PA 1EQZD 3MGRA 3X1TB 3AZMC 3WTPD 2YFVB 5B32A 3MGSA 4J8VA 3W99A 4DRBA 4HGAC 1M19D 1KX3C 5FUGA 5B2IA 3X1VA 1KX4D 1F66B 4XZQD 2FJ7A 4H9SC 5GT0A 1TZYC 2NQBA 3UTAD 5CP6C 3RELA 1P3OD 4H9PA 4LD9C 3LZ1D 2CV5D 5BT1D 5B2JA 3MGPD 3REKA 1P3KB 1P3PD 5CPJD 3AZFB 3R45A 5AVCB 1P3FD 1U35C 4YM6B 3AZNA 5E5AD 5AVBC 5B32C 4J8VC 3X1SA 5B33A 2CWEA 3X1VC 4YS3A 5AV9A 3NQUB 2F8NG 3TU4C 3LELD 3AZEB 2NQBC 3AZHB 5JA4B 2BYKB 3RELC 4X23A 5B2JC 3O62D 1P3AA 4G92B 5B0ZD 3AZNC 4NE5A 3X1SC 5B24A 3AZKB 3B6FB 4J8WD 5B1LA 2PYOB 1ID3D 5AV9C 5B0YA 3WA9D 5B40A 2HIOD 2NZDA 3AV2B 3MVDD 3UT9B 4ZBJB 1ZLAB 3KUYD 2BYMA 4ZUXA 1M18B 3LJAC 4JJNB 5B1MC 5BNVB 5F99D 3MGQA 4Z66D 3A6NA 2AROD 5AY8A 3REIB 4H9RA 3AV1D 3C1CB 3NQJA 3C1BA 1F66C 5GSUB 4KUDD 5B1LC 3UTBB 3VH5T 4E44A 5B0YC 3AZLD 5AV8B 1M1AD 3KXBA 4UUZA 1HQ3B 5BS7A 3W96D 4ZUXC 5AVCC 1P3BA 4YM6C 3MGQC 4WU8D 3REJA 4WNNA 1KU5A 3AZMB 4WU9B 3LZ0A 3AZHC 3W97A 5B31B 1S32D 1TZYB 5CPKA 3AFAA 1BH8B 1WWSA 5DNMD 4R8PB 3X1UD 4KGCD 4Z5TD 3REJC 3AZJA 3WAAA 1U35B 3AZFD 1P34D 5B32B 5AVBB 3MGSB 4J8VB 5GXQD 5B32G 3W99B 3X1VB 2F8ND 2YFWA 3AV2C 3TU4B 3W98A 4ZBJC 3W97C 1EQZA 5GT0B 4AWLC 2NQBB 3KWQC 5CPKC 3MNND 3AFAC 3RELB 5BNXA 4H9PB 4Z2MH 3WTPA 4Z2MG 5B2JB 3REKB 1M19A 1KX4A 3R45B 3B6GD 5GSUC 4XZQA 3AZNB 5G49A 3X1SB 5CHLB 4WV4B 3UTAA 1H3OA 3VH5W 3AZKD 1P3OA 4YS3B 3LZ1A 5AV9B 2CV5A 1P3MD 5AV6D 3MGPA 1EQZC 1P3PA 5CPJA 4NFTA 1P3FA 3REHC 5E5AA 1ZLAD 3LJAB 5B1MB 4WU9C 4JJND 1M19C 1P3LD 3REID 4J8XD 3LELA 1P3ID 3C1CD 3B0CT 3UTAC 5B31C 5B1LB 3LZ1C 5B0YB 5B40B 1P3GD 5CPID 3O62A 5CPJC 2NZDB 1AOID 1P3FC 1N1JB 4R8PC 3MGRC 5B0ZA 5E5AC 4ZUXB 3MGQB 3MGSC 4J8WA 3A6NB 4NE6A 3W99C 1ID3A 1R4VA 3WA9A 3AZGD
chains in the Genus database with same CATH superfamily
3AZMD 5B2IC 2HIOA 3NQJB 5KDMA 2JCHA 4XUJD 3MVDA 2FJ7C 2DQNC 3H0RC 5GT0C 3KUYA 1KX3D 4CAYA 1Q9CA 3KXBB 5F99A 4H9OA 4QLCD 4Z66A 2AROA 1B6WA 3REKC 3AZID 3AV1A 2JSSA 5CP6D 2Y2JA 4LD9D 1P3BB 2ZM5A 4KUDA 2L5AA 3REJB 4WNNB 5AV5D 1ID3C 3LZ0B 5B33C 3AZLA 1M1AA 1U35D 1PZRA 3WA9C 1F1EA 4YS3C 3V9RA 5AVBD 3W96A 3KUYC 3W97B 5F99C 3TU4D 5DNND 2ZY4A 4WU8A 4Z66C 4X23C 4AWLB 3KWQB 5CPKB 3AFAB 2ZY2A 1P3AC 3WKJD 2RVQD 3AYWD 3AZJB 5B24C 3WAAB 1TAFA 4E45A 3B0CW 3H0LC 1S32A 3X1SD 3WTPE 5B40C 3EPLA 3AN2D 5GT3D 3VH6T 1KX5D 2NZDC 5DNMA 3W98B 1EQZB 3X1UA 4WU8C 4KGCA 4Z5TA 5BNXB 3AZFA 1P34A 4CSRA 3REHB 3FDDA 3WTPB 3A6NC 5AY8C 4G91B 4DRAA 3X1TD 5GXQA 3LJAD 5B1MD 1M19B 4EO5C 3C1BC 4H9NA 2F8NA 4XZQB 3NQUA 5G49B 1S32C 2VQRA 3MNNA 1H3OB 3KXBC 3UTAB 1F66D 3H0MC 4J8UA 2BYKA 3LZ1B 5B31G 2CV5B 3MGPB 5BS7C 3X1UC 1HTAA 4KGCC 1P3PB 5JRGA 5CPJB 1P3BC 1P3FB 3B6GA 1P34C 3MGRB 1P3KD 5E5AB 5C3IC 5GXQC 3LZ0C 2IO5B 3A1KA 5AVCD 4YM6D 3AZKA 1P3MA 5AV6A 3LELB 5FUGB 5B2IB 2F2AC 2FJ7B 3AZED 4J8UC 1ZLAA 3B0BA 3AZHD 4JJNA 1P3LA 5JRGC 3O62B 3B0DC 3B6GC 5B0ZB 4J8XA 3AZJC 1P3IA 3WAAC 3C1CA 1JFIA 4J8WB 1P3MC 1ID3B 2HUEB 3F6TA 5B33B 5AV6C 1P3GA 3WA9B 2HIOB 3B6FD 5CPIA 4KHAA 3VH6W 2PYOD 3W98C 1AOIA 3KUYB 4CAYB 5F99B 2ZY3A 4H9OB 3WTPC 3UT9D 4Z66B 3AV2D 4X23B 1P3LC 2AROB 4G91C 3W97D 1M18D 3KWQD 5CPKD 3AV1B 3AZGA 3VH5A 1P3IC 1KX4C 1P3AB 4XZQC 4XUJA 3VH6A 5B24B 4DQYB 2Y2OA 1KX3A 1P3GC 1P3OC 5GSUD 4QLCA 3V9RB 3UTBD 2CV5C 5BT1C 1AOIC 3MGPC 3AZIA 5AV8D 1P3PC 5CP6A 4LD9A 1A7WA 2W8SA 1HQ3D 4WU8B 2BYMB 1W2EA 2IO5C 5AV5A 3AZGC 1U35A 5AY8B 3REHD 2RIQA 5AVBA 3LELC 4XUJC 4WU9D 4EO5B 3C1BB 1BH9A 1TAFB 2DF4C 4QLCC 5DNNA 3TU4A 1S32B 3AZIC 5B31D 3KSYA 4UUZB 3O62C 4NE3A 1TZYD 5DNMB 3WKJA 5B0ZC 2XD1A 3X1UB 3AYWA 4KGCB 4Z5TB 5AV5C 1P34B 4CSRB 4R8PD 4H9QA 4J8WC 5C3IB 3MGRD 2HUEC 5GXQB 2HIOC 2FFFB 3AN2A 5GT3A 5B32D 3MGSD 1KX5A 4H9NB 4J8VD 2F8NB 3MVDC 3W99D 2F8NH 5DNNC 5B2ID 3X1VD 3MNNB 4J8UB 2FJ7D 5BO0A 2AROC 5GT0D 2NQBD 3WKJC 2RVQC 3AV1C 3X1TA 3LJAA 5B1MA 3RELD 3AYWC 5JRGB 2YFVA 3B0DB 3B6GB 5B2JD 4KUDC 3REKD 3AZLC 1M1AC 1F66A 2BG1A 3AZND 3AN2C 5GT3C 1KX5C 1P3MB 5AV6B 5B33D 3W96C 2YFWB 4YS3D 5AV9D 2Y2PA 1N1JA 3P5JB 1P3KA 3X1TC 5AVCA 4YM6A 1P3LB 1BFMA 4X23D 4J8XB 1P3IB 1KX4B 1P3AD 1ULYA 1JFIB 3KFUG 3EPJA 3AZEA 5B24D 1P3GB 1P3OB 3AZHA 5JA4A 2UWXA 5CPIB 5B1LD 4KHAB 5DNMC 1AOIB 5B0YD 5B40D 1P3KC 4Z5TC 2Y2HA 3AZFC 2NZDD 2Y2MA 4ZUXD 4UPKA 3AZGB 3MGQD 3B6FA 3A6ND 5AY8D 2PYOA 4XUJB 4HGAB 3AZEC 1KX3B 3MNNC 3C1BD 3AV2A 4QLCB 3UT9A 1B67A 2ZY5A 1M18A 3KWQA 3AZIB 5BNVA 5CP6B 3KXBD 4LD9B 1WWIA 3REIA 4G92C 5AV5B 1P3BD 3AZKC 5GSUA 3B6FC 3REJD 3UTBA 2LY8A 2PYOC 3LZ0D 3EG5B 5AV8A 5KDMB 1R4VA 1BH9B 3MVDB 1HQ3A 3UT9C 5DNNB 1ZLAC 1M18C 4JJNC 2F8NK 4J8UD 3REHA 1Z2CB 3WKJB 3REIC 3AFAD 4J8XC 3AYWB 3AZMA 4WU9A 3C1CC 4WZSB 2G5IC 5JRGD 4KUDB 4H9QB 3UTBC 3AZJD 3WAAD 3AZLB 1M1AB 5CPIC 5GT3B 5AV8C 3AN2B 1KX5B 5B31A 4H9SA 1TZYA 1HQ3C 3W96B 1BH8A 4M6BA 3W98D 5BO0B 4R8PA 1EQZD 3MGRA 3X1TB 3AZMC 3WTPD 2YFVB 5B32A 3MGSA 4J8VA 3W99A 4DRBA 4HGAC 1M19D 1KX3C 5FUGA 5B2IA 3EPKA 3X1VA 1KX4D 1F66B 4XZQD 2FJ7A 4H9SC 5GT0A 1TZYC 2NQBA 3UTAD 5CP6C 3RELA 1P3OD 4H9PA 4LD9C 3LZ1D 2CV5D 5BT1D 5B2JA 3MGPD 3REKA 1P3KB 1P3PD 5CPJD 3AZFB 3R45A 5AVCB 1P3FD 1U35C 4YM6B 3AZNA 5E5AD 5AVBC 5B32C 4J8VC 3X1SA 5B33A 2Y2KA 2CWEA 3X1VC 4YS3A 5AV9A 3NQUB 2F8NG 3TU4C 3LELD 3AZEB 2Y2NA 2NQBC 3AZHB 5JA4B 2BYKB 3RELC 2Y2LA 4X23A 5B2JC 3O62D 1P3AA 4G92B 5B0ZD 3AZNC 4NE5A 3X1SC 5B24A 3AZKB 3B6FB 4J8WD 5B1LA 2PYOB 1ID3D 5AV9C 5B0YA 3WA9D 5B40A 2HIOD 2J8PA 2NZDA 3AV2B 3MVDD 3UT9B 4ZBJB 2JE5A 1ZLAB 3KUYD 2BYMA 4ZUXA 1M18B 3LJAC 4JJNB 5B1MC 5BNVB 5F99D 3MGQA 4Z66D 3A6NA 2AROD 5AY8A 3REIB 4H9RA 3AV1D 3C1CB 1T3UA 3NQJA 3C1BA 1F66C 5GSUB 4KUDD 5B1LC 3UTBB 3VH5T 4E44A 5B0YC 3AZLD 5AV8B 1M1AD 3KXBA 3AL0C 4UUZA 1HQ3B 5BS7A 3W96D 4ZUXC 5AVCC 1P3BA 4YM6C 3MGQC 4WU8D 3REJA 4WNNA 1KU5A 3AZMB 4WU9B 3LZ0A 3AZHC 3W97A 5B31B 1S32D 1TZYB 5CPKA 3AFAA 1BH8B 1WWSA 5DNMD 4R8PB 3X1UD 4KGCD 4Z5TD 3REJC 3AZJA 3WAAA 1U35B 3AZFD 1P34D 5B32B 5AVBB 3MGSB 4J8VB 5GXQD 5B32G 3W99B 3EPHA 3X1VB 2F8ND 2YFWA 3AV2C 3TU4B 3W98A 4ZBJC 3W97C 1EQZA 5GT0B 4AWLC 2NQBB 3KWQC 5CPKC 3MNND 3AFAC 3RELB 5BNXA 4H9PB 4Z2MH 3WTPA 4Z2MG 3IP4C 5B2JB 3REKB 1M19A 1KX4A 3R45B 3B6GD 5GSUC 4XZQA 3AZNB 5G49A 3X1SB 5CHLB 4WV4B 3UTAA 1H3OA 2Y2GA 3VH5W 3AZKD 1P3OA 4YS3B 3LZ1A 5AV9B 2CV5A 1P3MD 5AV6D 3MGPA 1EQZC 2Y2IA 1P3PA 5CPJA 4NFTA 1P3FA 3REHC 5E5AA 1ZLAD 3LJAB 5B1MB 4WU9C 2Y2QA 4JJND 1M19C 3A1IA 1P3LD 3REID 4J8XD 3LELA 1P3ID 2XD5A 3C1CD 3B0CT 3UTAC 5B31C 5B1LB 4WJ3C 3LZ1C 5B0YB 5B40B 1P3GD 5CPID 3O62A 5CPJC 2NZDB 1AOID 1P3FC 1N1JB 4R8PC 3MGRC 5B0ZA 2G5HC 5E5AC 4ZUXB 3MGQB 3MGSC 4J8WA 3A6NB 4NE6A 3W99C 1ID3A 4H9RB 3WA9A 3AZGD
chains in the Genus database with same CATH topology
3AZMD 5B2IC 2HIOA 3NQJB 5KDMA 2JCHA 4XUJD 3MVDA 2FJ7C 2DQNC 3H0RC 5GT0C 3KUYA 1KX3D 4CAYA 1Q9CA 3KXBB 5F99A 4H9OA 4QLCD 4Z66A 2AROA 1B6WA 3REKC 3AZID 3AV1A 2JSSA 5CP6D 2Y2JA 4LD9D 1P3BB 2ZM5A 4KUDA 2L5AA 3REJB 4WNNB 5AV5D 1ID3C 3LZ0B 5B33C 3AZLA 1M1AA 1U35D 1PZRA 3WA9C 1F1EA 4YS3C 3V9RA 5AVBD 3W96A 3KUYC 3W97B 5F99C 3TU4D 5DNND 2ZY4A 4WU8A 4Z66C 4X23C 4AWLB 3KWQB 5CPKB 3AFAB 2ZY2A 1P3AC 3WKJD 2RVQD 3AYWD 3AZJB 5B24C 3WAAB 1TAFA 4E45A 3B0CW 3H0LC 1S32A 3X1SD 3WTPE 5B40C 3EPLA 3AN2D 5GT3D 3VH6T 1KX5D 2NZDC 5DNMA 3W98B 1EQZB 3X1UA 4WU8C 4KGCA 4Z5TA 5BNXB 3AZFA 1P34A 4CSRA 3REHB 3FDDA 3WTPB 3A6NC 5AY8C 4G91B 4DRAA 3X1TD 5GXQA 3LJAD 5B1MD 1M19B 4EO5C 3C1BC 4H9NA 2F8NA 4XZQB 3NQUA 5G49B 1S32C 2VQRA 3MNNA 1H3OB 3KXBC 3UTAB 1F66D 3H0MC 4J8UA 2BYKA 3LZ1B 5B31G 2CV5B 3MGPB 5BS7C 3X1UC 1HTAA 4KGCC 1P3PB 5JRGA 5CPJB 1P3BC 1P3FB 3B6GA 1P34C 3MGRB 1P3KD 5E5AB 5C3IC 5GXQC 3LZ0C 2IO5B 3A1KA 5AVCD 4YM6D 3AZKA 1P3MA 5AV6A 3LELB 5FUGB 5B2IB 2F2AC 2FJ7B 3AZED 4J8UC 1ZLAA 3B0BA 3AZHD 4JJNA 1P3LA 5JRGC 3O62B 3B0DC 3B6GC 5B0ZB 4J8XA 3AZJC 1P3IA 3WAAC 3C1CA 1JFIA 4J8WB 1P3MC 1ID3B 2HUEB 3F6TA 5B33B 5AV6C 1P3GA 3WA9B 2HIOB 3B6FD 5CPIA 4KHAA 3VH6W 2PYOD 3W98C 1AOIA 3KUYB 4CAYB 5F99B 2ZY3A 4H9OB 3WTPC 3UT9D 4Z66B 3AV2D 4X23B 1P3LC 2AROB 4G91C 3W97D 1M18D 3KWQD 5CPKD 3AV1B 3AZGA 3VH5A 1P3IC 1KX4C 1P3AB 4XZQC 4XUJA 3VH6A 5B24B 4DQYB 2Y2OA 1KX3A 1P3GC 1P3OC 5GSUD 4QLCA 3V9RB 3UTBD 2CV5C 5BT1C 1AOIC 3MGPC 3AZIA 5AV8D 1P3PC 5CP6A 4LD9A 1A7WA 2W8SA 1HQ3D 4WU8B 2BYMB 1W2EA 2IO5C 5AV5A 3AZGC 1U35A 5AY8B 3REHD 2RIQA 5AVBA 3LELC 4XUJC 4WU9D 4EO5B 3C1BB 1BH9A 1TAFB 2DF4C 4QLCC 5DNNA 3TU4A 1S32B 3AZIC 5B31D 3KSYA 4UUZB 3O62C 4NE3A 1TZYD 5DNMB 3WKJA 5B0ZC 2XD1A 3X1UB 3AYWA 4KGCB 4Z5TB 5AV5C 1P34B 4CSRB 4R8PD 4H9QA 4J8WC 5C3IB 3MGRD 2HUEC 5GXQB 2HIOC 2FFFB 3AN2A 5GT3A 5B32D 3MGSD 1KX5A 4H9NB 4J8VD 2F8NB 3MVDC 3W99D 2F8NH 5DNNC 5B2ID 3X1VD 3MNNB 4J8UB 2FJ7D 5BO0A 2AROC 5GT0D 2NQBD 3WKJC 2RVQC 3AV1C 3X1TA 3LJAA 5B1MA 3RELD 3AYWC 5JRGB 2YFVA 3B0DB 3B6GB 5B2JD 4KUDC 3REKD 3AZLC 1M1AC 1F66A 2BG1A 3AZND 3AN2C 5GT3C 1KX5C 1P3MB 5AV6B 5B33D 3W96C 2YFWB 4YS3D 5AV9D 2Y2PA 1N1JA 3P5JB 1P3KA 3X1TC 5AVCA 4YM6A 1P3LB 1BFMA 4X23D 4J8XB 1P3IB 1KX4B 1P3AD 1ULYA 1JFIB 3KFUG 3EPJA 3AZEA 5B24D 1P3GB 1P3OB 3AZHA 5JA4A 2UWXA 5CPIB 5B1LD 4KHAB 5DNMC 1AOIB 5B0YD 5B40D 1P3KC 4Z5TC 2Y2HA 3AZFC 2NZDD 2Y2MA 4ZUXD 4UPKA 3AZGB 3MGQD 3B6FA 3A6ND 5AY8D 2PYOA 4XUJB 4HGAB 3AZEC 1KX3B 3MNNC 3C1BD 3AV2A 4QLCB 3UT9A 1B67A 2ZY5A 1M18A 3KWQA 3AZIB 5BNVA 5CP6B 3KXBD 4LD9B 1WWIA 3REIA 4G92C 5AV5B 1P3BD 3AZKC 5GSUA 3B6FC 3REJD 3UTBA 2LY8A 2PYOC 3LZ0D 3EG5B 5AV8A 5KDMB 1R4VA 1BH9B 3MVDB 1HQ3A 3UT9C 5DNNB 1ZLAC 1M18C 4JJNC 2F8NK 4J8UD 3REHA 1Z2CB 3WKJB 3REIC 3AFAD 4J8XC 3AYWB 3AZMA 4WU9A 3C1CC 4WZSB 2G5IC 5JRGD 4KUDB 4H9QB 3UTBC 3AZJD 3WAAD 3AZLB 1M1AB 5CPIC 5GT3B 5AV8C 3AN2B 1KX5B 5B31A 4H9SA 1TZYA 1HQ3C 3W96B 1BH8A 4M6BA 3W98D 5BO0B 4R8PA 1EQZD 3MGRA 3X1TB 3AZMC 3WTPD 2YFVB 5B32A 3MGSA 4J8VA 3W99A 4DRBA 4HGAC 1M19D 1KX3C 5FUGA 5B2IA 3EPKA 3X1VA 1KX4D 1F66B 4XZQD 2FJ7A 4H9SC 5GT0A 1TZYC 2NQBA 3UTAD 5CP6C 3RELA 1P3OD 4H9PA 4LD9C 3LZ1D 2CV5D 5BT1D 5B2JA 3MGPD 3REKA 1P3KB 1P3PD 5CPJD 3AZFB 3R45A 5AVCB 1P3FD 1U35C 4YM6B 3AZNA 5E5AD 5AVBC 5B32C 4J8VC 3X1SA 5B33A 2Y2KA 2CWEA 3X1VC 4YS3A 5AV9A 3NQUB 2F8NG 3TU4C 3LELD 3AZEB 2Y2NA 2NQBC 3AZHB 5JA4B 2BYKB 3RELC 2Y2LA 4X23A 5B2JC 3O62D 1P3AA 4G92B 5B0ZD 3AZNC 4NE5A 3X1SC 5B24A 3AZKB 3B6FB 4J8WD 5B1LA 2PYOB 1ID3D 5AV9C 5B0YA 3WA9D 5B40A 2HIOD 2J8PA 2NZDA 3AV2B 3MVDD 3UT9B 4ZBJB 2JE5A 1ZLAB 3KUYD 2BYMA 4ZUXA 1M18B 3LJAC 4JJNB 5B1MC 5BNVB 5F99D 3MGQA 4Z66D 3A6NA 2AROD 5AY8A 3REIB 4H9RA 3AV1D 3C1CB 1T3UA 3NQJA 3C1BA 1F66C 5GSUB 4KUDD 5B1LC 3UTBB 3VH5T 4E44A 5B0YC 3AZLD 5AV8B 1M1AD 3KXBA 3AL0C 4UUZA 1HQ3B 5BS7A 3W96D 4ZUXC 5AVCC 1P3BA 4YM6C 3MGQC 4WU8D 3REJA 4WNNA 1KU5A 3AZMB 4WU9B 3LZ0A 3AZHC 3W97A 5B31B 1S32D 1TZYB 5CPKA 3AFAA 1BH8B 1WWSA 5DNMD 4R8PB 3X1UD 4KGCD 4Z5TD 3REJC 3AZJA 3WAAA 1U35B 3AZFD 1P34D 5B32B 5AVBB 3MGSB 4J8VB 5GXQD 5B32G 3W99B 3EPHA 3X1VB 2F8ND 2YFWA 3AV2C 3TU4B 3W98A 4ZBJC 3W97C 1EQZA 5GT0B 4AWLC 2NQBB 3KWQC 5CPKC 3MNND 3AFAC 3RELB 5BNXA 4H9PB 4Z2MH 3WTPA 4Z2MG 3IP4C 5B2JB 3REKB 1M19A 1KX4A 3R45B 3B6GD 5GSUC 4XZQA 3AZNB 5G49A 3X1SB 5CHLB 4WV4B 3UTAA 1H3OA 2Y2GA 3VH5W 3AZKD 1P3OA 4YS3B 3LZ1A 5AV9B 2CV5A 1P3MD 5AV6D 3MGPA 1EQZC 2Y2IA 1P3PA 5CPJA 4NFTA 1P3FA 3REHC 5E5AA 1ZLAD 3LJAB 5B1MB 4WU9C 2Y2QA 4JJND 1M19C 3A1IA 1P3LD 3REID 4J8XD 3LELA 1P3ID 2XD5A 3C1CD 3B0CT 3UTAC 5B31C 5B1LB 4WJ3C 3LZ1C 5B0YB 5B40B 1P3GD 5CPID 3O62A 5CPJC 2NZDB 1AOID 1P3FC 1N1JB 4R8PC 3MGRC 5B0ZA 2G5HC 5E5AC 4ZUXB 3MGQB 3MGSC 4J8WA 3A6NB 4NE6A 3W99C 1ID3A 4H9RB 3WA9A 3AZGD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZM D;  5B2I C;  2HIO A;  3NQJ B;  5KDM A;  4XUJ D;  3MVD A;  2FJ7 C;  5GT0 C;  3KUY A;  1KX3 D;  4CAY A;  1Q9C A;  3KXB B;  5F99 A;  4H9O A;  4QLC D;  4Z66 A;  2ARO A;  1B6W A;  3REK C;  3AZI D;  3AV1 A;  2JSS A;  5CP6 D;  4LD9 D;  1P3B B;  4KUD A;  2L5A A;  3REJ B;  4WNN B;  5AV5 D;  1ID3 C;  3LZ0 B;  5B33 C;  3AZL A;  1M1A A;  1U35 D;  3WA9 C;  1F1E A;  4YS3 C;  3V9R A;  5AVB D;  3W96 A;  3KUY C;  3W97 B;  5F99 C;  3TU4 D;  5DNN D;  4WU8 A;  4Z66 C;  4AWL B;  4X23 C;  3KWQ B;  5CPK B;  3AFA B;  1P3A C;  3WKJ D;  2RVQ D;  3AYW D;  3AZJ B;  5B24 C;  3WAA B;  1TAF A;  4E45 A;  3B0C W;  1S32 A;  3X1S D;  3WTP E;  5B40 C;  3AN2 D;  5GT3 D;  3VH6 T;  1KX5 D;  2NZD C;  5DNM A;  3W98 B;  1EQZ B;  3X1U A;  4WU8 C;  4KGC A;  4Z5T A;  5BNX B;  3AZF A;  1P34 A;  4CSR A;  3REH B;  3WTP B;  3A6N C;  5AY8 C;  4G91 B;  4DRA A;  3X1T D;  5GXQ A;  3LJA D;  5B1M D;  1M19 B;  4EO5 C;  3C1B C;  4H9N A;  2F8N A;  4XZQ B;  3NQU A;  5G49 B;  1S32 C;  3MNN A;  1H3O B;  3KXB C;  3UTA B;  1F66 D;  4J8U A;  2BYK A;  3LZ1 B;  5B31 G;  2CV5 B;  3MGP B;  5BS7 C;  3X1U C;  1HTA A;  4KGC C;  1P3P B;  5JRG A;  5CPJ B;  1P3B C;  1P3F B;  3B6G A;  1P34 C;  3MGR B;  1P3K D;  5E5A B;  5C3I C;  5GXQ C;  3LZ0 C;  2IO5 B;  5AVC D;  4YM6 D;  3AZK A;  1P3M A;  5AV6 A;  3LEL B;  5FUG B;  5B2I B;  2FJ7 B;  3AZE D;  4J8U C;  1ZLA A;  3B0B A;  3AZH D;  4JJN A;  1P3L A;  5JRG C;  3O62 B;  3B0D C;  3B6G C;  5B0Z B;  4J8X A;  3AZJ C;  1P3I A;  3WAA C;  3C1C A;  1JFI A;  4J8W B;  1P3M C;  1ID3 B;  2HUE B;  5B33 B;  3WA9 B;  5AV6 C;  1P3G A;  2HIO B;  3B6F D;  5CPI A;  4KHA A;  3VH6 W;  2PYO D;  3W98 C;  1AOI A;  3KUY B;  4CAY B;  5F99 B;  3AV2 D;  4H9O B;  3WTP C;  3UT9 D;  4Z66 B;  1P3L C;  4X23 B;  3W97 D;  2ARO B;  4G91 C;  1M18 D;  3KWQ D;  5CPK D;  3AV1 B;  3AZG A;  3VH5 A;  1P3I C;  1KX4 C;  1P3A B;  4XZQ C;  4XUJ A;  3VH6 A;  5B24 B;  4H9R B;  1KX3 A;  1P3G C;  1P3O C;  5GSU D;  4QLC A;  3V9R B;  3UTB D;  2CV5 C;  5BT1 C;  1AOI C;  3MGP C;  3AZI A;  5AV8 D;  1P3P C;  5CP6 A;  4LD9 A;  1A7W A;  1HQ3 D;  4WU8 B;  2BYM B;  2IO5 C;  5AV5 A;  3AZG C;  1U35 A;  5AY8 B;  3REH D;  5AVB A;  3LEL C;  4XUJ C;  4WU9 D;  4EO5 B;  3C1B B;  1BH9 A;  1TAF B;  4QLC C;  5DNN A;  3TU4 A;  1S32 B;  3AZI C;  5B31 D;  3KSY A;  4UUZ B;  3O62 C;  4NE3 A;  1TZY D;  5DNM B;  3WKJ A;  5B0Z C;  3X1U B;  3AYW A;  4KGC B;  4Z5T B;  5AV5 C;  1P34 B;  4CSR B;  4R8P D;  4H9Q A;  4J8W C;  5C3I B;  3MGR D;  2HUE C;  5GXQ B;  2HIO C;  3AN2 A;  5GT3 A;  5B32 D;  3MGS D;  1KX5 A;  4H9N B;  4J8V D;  2F8N B;  3MVD C;  3W99 D;  2F8N H;  5DNN C;  5B2I D;  3X1V D;  3MNN B;  4J8U B;  2FJ7 D;  5BO0 A;  2ARO C;  5GT0 D;  2NQB D;  3WKJ C;  2RVQ C;  3AV1 C;  3X1T A;  3LJA A;  5B1M A;  3REL D;  3AYW C;  5JRG B;  2YFV A;  3B0D B;  3B6G B;  5B2J D;  4KUD C;  3REK D;  3AZL C;  1M1A C;  1F66 A;  3AZN D;  3AN2 C;  5GT3 C;  1KX5 C;  1P3M B;  5AV6 B;  5B33 D;  3W96 C;  2YFW B;  4YS3 D;  5AV9 D;  1N1J A;  1P3K A;  3X1T C;  5AVC A;  4YM6 A;  1P3L B;  1BFM A;  4X23 D;  4J8X B;  1P3I B;  1KX4 B;  1P3A D;  1ULY A;  1JFI B;  3AZE A;  5B24 D;  1P3G B;  1P3O B;  3AZH A;  5JA4 A;  5CPI B;  5B1L D;  4KHA B;  5DNM C;  1AOI B;  5B0Y D;  5B40 D;  1P3K C;  4Z5T C;  2NZD D;  3AZF C;  4ZUX D;  3AZG B;  3MGQ D;  3B6F A;  3A6N D;  5AY8 D;  2PYO A;  4XUJ B;  4HGA B;  3AZE C;  1KX3 B;  3MNN C;  3C1B D;  3AV2 A;  4QLC B;  3UT9 A;  1B67 A;  1M18 A;  3KWQ A;  3AZI B;  5BNV A;  5CP6 B;  3KXB D;  4LD9 B;  1WWI A;  3REI A;  4G92 C;  5AV5 B;  1P3B D;  3AZK C;  5GSU A;  3B6F C;  3REJ D;  3UTB A;  2LY8 A;  2PYO C;  3LZ0 D;  5AV8 A;  5KDM B;  1BH9 B;  3MVD B;  1HQ3 A;  3UT9 C;  5DNN B;  1ZLA C;  1M18 C;  4JJN C;  2F8N K;  4J8U D;  3REH A;  3WKJ B;  3REI C;  3AFA D;  4J8X C;  3AYW B;  3AZM A;  4WU9 A;  3C1C C;  4WZS B;  5JRG D;  4KUD B;  4H9Q B;  3UTB C;  3AZJ D;  3WAA D;  3AZL B;  1M1A B;  5CPI C;  5GT3 B;  5AV8 C;  3AN2 B;  1KX5 B;  5B31 A;  4H9S A;  1TZY A;  1HQ3 C;  3W96 B;  1BH8 A;  4M6B A;  3W98 D;  5BO0 B;  4R8P A;  1EQZ D;  3MGR A;  3X1T B;  3AZM C;  3WTP D;  2YFV B;  5B32 A;  3MGS A;  4J8V A;  3W99 A;  4DRB A;  4HGA C;  1M19 D;  1KX3 C;  5FUG A;  5B2I A;  3X1V A;  1KX4 D;  1F66 B;  4XZQ D;  2FJ7 A;  4H9S C;  5GT0 A;  1TZY C;  2NQB A;  3UTA D;  5CP6 C;  3REL A;  1P3O D;  4H9P A;  4LD9 C;  3LZ1 D;  2CV5 D;  5BT1 D;  5B2J A;  3MGP D;  3REK A;  1P3K B;  1P3P D;  5CPJ D;  3AZF B;  3R45 A;  5AVC B;  1P3F D;  1U35 C;  4YM6 B;  3AZN A;  5E5A D;  5AVB C;  5B32 C;  4J8V C;  3X1S A;  5B33 A;  2CWE A;  3X1V C;  4YS3 A;  5AV9 A;  3NQU B;  2F8N G;  3TU4 C;  3LEL D;  3AZE B;  2NQB C;  3AZH B;  5JA4 B;  2BYK B;  3REL C;  4X23 A;  5B2J C;  3O62 D;  1P3A A;  4G92 B;  5B0Z D;  3AZN C;  4NE5 A;  3X1S C;  5B24 A;  3AZK B;  3B6F B;  4J8W D;  5B1L A;  2PYO B;  1ID3 D;  5AV9 C;  5B0Y A;  3WA9 D;  5B40 A;  2HIO D;  2NZD A;  3AV2 B;  3MVD D;  3UT9 B;  4ZBJ B;  1ZLA B;  3KUY D;  2BYM A;  4ZUX A;  1M18 B;  3LJA C;  4JJN B;  5B1M C;  5BNV B;  5F99 D;  3MGQ A;  4Z66 D;  3A6N A;  2ARO D;  5AY8 A;  3REI B;  4H9R A;  3AV1 D;  3C1C B;  3NQJ A;  3C1B A;  1F66 C;  5GSU B;  4KUD D;  5B1L C;  3UTB B;  3VH5 T;  4E44 A;  5B0Y C;  3AZL D;  5AV8 B;  1M1A D;  3KXB A;  4UUZ A;  1HQ3 B;  5BS7 A;  3W96 D;  4ZUX C;  5AVC C;  1P3B A;  4YM6 C;  3MGQ C;  4WU8 D;  3REJ A;  4WNN A;  1KU5 A;  3AZM B;  4WU9 B;  3LZ0 A;  3AZH C;  3W97 A;  5B31 B;  1S32 D;  1TZY B;  5CPK A;  3AFA A;  1BH8 B;  1WWS A;  5DNM D;  4R8P B;  3X1U D;  4KGC D;  4Z5T D;  3REJ C;  3AZJ A;  3WAA A;  1U35 B;  3AZF D;  1P34 D;  5B32 B;  5AVB B;  3MGS B;  4J8V B;  5GXQ D;  5B32 G;  3W99 B;  3X1V B;  2F8N D;  2YFW A;  3AV2 C;  3TU4 B;  3W98 A;  4ZBJ C;  3W97 C;  1EQZ A;  5GT0 B;  4AWL C;  2NQB B;  3KWQ C;  5CPK C;  3MNN D;  3AFA C;  3REL B;  5BNX A;  4H9P B;  4Z2M H;  3WTP A;  4Z2M G;  5B2J B;  3REK B;  1M19 A;  1KX4 A;  3R45 B;  3B6G D;  5GSU C;  4XZQ A;  3AZN B;  5G49 A;  3X1S B;  5CHL B;  4WV4 B;  3UTA A;  1H3O A;  3VH5 W;  3AZK D;  1P3O A;  4YS3 B;  3LZ1 A;  5AV9 B;  2CV5 A;  1P3M D;  5AV6 D;  3MGP A;  1EQZ C;  1P3P A;  5CPJ A;  4NFT A;  1P3F A;  3REH C;  5E5A A;  1ZLA D;  3LJA B;  5B1M B;  4WU9 C;  4JJN D;  1M19 C;  1P3L D;  3REI D;  4J8X D;  3LEL A;  1P3I D;  3C1C D;  3B0C T;  3UTA C;  5B31 C;  5B1L B;  3LZ1 C;  5B0Y B;  5B40 B;  1P3G D;  5CPI D;  3O62 A;  5CPJ C;  2NZD B;  1AOI D;  1P3F C;  1N1J B;  4R8P C;  3MGR C;  5B0Z A;  5E5A C;  4ZUX B;  3MGQ B;  3MGS C;  4J8W A;  3A6N B;  4NE6 A;  3W99 C;  1ID3 A;  1R4V A;  3WA9 A;  3AZG D; 
#chains in the Genus database with same CATH topology
 3AZM D;  5B2I C;  2HIO A;  3NQJ B;  5KDM A;  2JCH A;  4XUJ D;  3MVD A;  2FJ7 C;  2DQN C;  3H0R C;  5GT0 C;  3KUY A;  1KX3 D;  4CAY A;  1Q9C A;  3KXB B;  5F99 A;  4H9O A;  4QLC D;  4Z66 A;  2ARO A;  1B6W A;  3REK C;  3AZI D;  3AV1 A;  2JSS A;  5CP6 D;  2Y2J A;  4LD9 D;  1P3B B;  2ZM5 A;  4KUD A;  2L5A A;  3REJ B;  4WNN B;  5AV5 D;  1ID3 C;  3LZ0 B;  5B33 C;  3AZL A;  1M1A A;  1U35 D;  1PZR A;  3WA9 C;  1F1E A;  4YS3 C;  3V9R A;  5AVB D;  3W96 A;  3KUY C;  3W97 B;  5F99 C;  3TU4 D;  5DNN D;  2ZY4 A;  4WU8 A;  4Z66 C;  4X23 C;  4AWL B;  3KWQ B;  5CPK B;  3AFA B;  2ZY2 A;  1P3A C;  3WKJ D;  2RVQ D;  3AYW D;  3AZJ B;  5B24 C;  3WAA B;  1TAF A;  4E45 A;  3B0C W;  3H0L C;  1S32 A;  3X1S D;  3WTP E;  5B40 C;  3EPL A;  3AN2 D;  5GT3 D;  3VH6 T;  1KX5 D;  2NZD C;  5DNM A;  3W98 B;  1EQZ B;  3X1U A;  4WU8 C;  4KGC A;  4Z5T A;  5BNX B;  3AZF A;  1P34 A;  4CSR A;  3REH B;  3FDD A;  3WTP B;  3A6N C;  5AY8 C;  4G91 B;  4DRA A;  3X1T D;  5GXQ A;  3LJA D;  5B1M D;  1M19 B;  4EO5 C;  3C1B C;  4H9N A;  2F8N A;  4XZQ B;  3NQU A;  5G49 B;  1S32 C;  2VQR A;  3MNN A;  1H3O B;  3KXB C;  3UTA B;  1F66 D;  3H0M C;  4J8U A;  2BYK A;  3LZ1 B;  5B31 G;  2CV5 B;  3MGP B;  5BS7 C;  3X1U C;  1HTA A;  4KGC C;  1P3P B;  5JRG A;  5CPJ B;  1P3B C;  1P3F B;  3B6G A;  1P34 C;  3MGR B;  1P3K D;  5E5A B;  5C3I C;  5GXQ C;  3LZ0 C;  2IO5 B;  3A1K A;  5AVC D;  4YM6 D;  3AZK A;  1P3M A;  5AV6 A;  3LEL B;  5FUG B;  5B2I B;  2F2A C;  2FJ7 B;  3AZE D;  4J8U C;  1ZLA A;  3B0B A;  3AZH D;  4JJN A;  1P3L A;  5JRG C;  3O62 B;  3B0D C;  3B6G C;  5B0Z B;  4J8X A;  3AZJ C;  1P3I A;  3WAA C;  3C1C A;  1JFI A;  4J8W B;  1P3M C;  1ID3 B;  2HUE B;  3F6T A;  5B33 B;  5AV6 C;  1P3G A;  3WA9 B;  2HIO B;  3B6F D;  5CPI A;  4KHA A;  3VH6 W;  2PYO D;  3W98 C;  1AOI A;  3KUY B;  4CAY B;  5F99 B;  2ZY3 A;  4H9O B;  3WTP C;  3UT9 D;  4Z66 B;  3AV2 D;  4X23 B;  1P3L C;  2ARO B;  4G91 C;  3W97 D;  1M18 D;  3KWQ D;  5CPK D;  3AV1 B;  3AZG A;  3VH5 A;  1P3I C;  1KX4 C;  1P3A B;  4XZQ C;  4XUJ A;  3VH6 A;  5B24 B;  4DQY B;  2Y2O A;  1KX3 A;  1P3G C;  1P3O C;  5GSU D;  4QLC A;  3V9R B;  3UTB D;  2CV5 C;  5BT1 C;  1AOI C;  3MGP C;  3AZI A;  5AV8 D;  1P3P C;  5CP6 A;  4LD9 A;  1A7W A;  2W8S A;  1HQ3 D;  4WU8 B;  2BYM B;  1W2E A;  2IO5 C;  5AV5 A;  3AZG C;  1U35 A;  5AY8 B;  3REH D;  2RIQ A;  5AVB A;  3LEL C;  4XUJ C;  4WU9 D;  4EO5 B;  3C1B B;  1BH9 A;  1TAF B;  2DF4 C;  4QLC C;  5DNN A;  3TU4 A;  1S32 B;  3AZI C;  5B31 D;  3KSY A;  4UUZ B;  3O62 C;  4NE3 A;  1TZY D;  5DNM B;  3WKJ A;  5B0Z C;  2XD1 A;  3X1U B;  3AYW A;  4KGC B;  4Z5T B;  5AV5 C;  1P34 B;  4CSR B;  4R8P D;  4H9Q A;  4J8W C;  5C3I B;  3MGR D;  2HUE C;  5GXQ B;  2HIO C;  2FFF B;  3AN2 A;  5GT3 A;  5B32 D;  3MGS D;  1KX5 A;  4H9N B;  4J8V D;  2F8N B;  3MVD C;  3W99 D;  2F8N H;  5DNN C;  5B2I D;  3X1V D;  3MNN B;  4J8U B;  2FJ7 D;  5BO0 A;  2ARO C;  5GT0 D;  2NQB D;  3WKJ C;  2RVQ C;  3AV1 C;  3X1T A;  3LJA A;  5B1M A;  3REL D;  3AYW C;  5JRG B;  2YFV A;  3B0D B;  3B6G B;  5B2J D;  4KUD C;  3REK D;  3AZL C;  1M1A C;  1F66 A;  2BG1 A;  3AZN D;  3AN2 C;  5GT3 C;  1KX5 C;  1P3M B;  5AV6 B;  5B33 D;  3W96 C;  2YFW B;  4YS3 D;  5AV9 D;  2Y2P A;  1N1J A;  3P5J B;  1P3K A;  3X1T C;  5AVC A;  4YM6 A;  1P3L B;  1BFM A;  4X23 D;  4J8X B;  1P3I B;  1KX4 B;  1P3A D;  1ULY A;  1JFI B;  3KFU G;  3EPJ A;  3AZE A;  5B24 D;  1P3G B;  1P3O B;  3AZH A;  5JA4 A;  2UWX A;  5CPI B;  5B1L D;  4KHA B;  5DNM C;  1AOI B;  5B0Y D;  5B40 D;  1P3K C;  4Z5T C;  2Y2H A;  3AZF C;  2NZD D;  2Y2M A;  4ZUX D;  4UPK A;  3AZG B;  3MGQ D;  3B6F A;  3A6N D;  5AY8 D;  2PYO A;  4XUJ B;  4HGA B;  3AZE C;  1KX3 B;  3MNN C;  3C1B D;  3AV2 A;  4QLC B;  3UT9 A;  1B67 A;  2ZY5 A;  1M18 A;  3KWQ A;  3AZI B;  5BNV A;  5CP6 B;  3KXB D;  4LD9 B;  1WWI A;  3REI A;  4G92 C;  5AV5 B;  1P3B D;  3AZK C;  5GSU A;  3B6F C;  3REJ D;  3UTB A;  2LY8 A;  2PYO C;  3LZ0 D;  3EG5 B;  5AV8 A;  5KDM B;  1R4V A;  1BH9 B;  3MVD B;  1HQ3 A;  3UT9 C;  5DNN B;  1ZLA C;  1M18 C;  4JJN C;  2F8N K;  4J8U D;  3REH A;  1Z2C B;  3WKJ B;  3REI C;  3AFA D;  4J8X C;  3AYW B;  3AZM A;  4WU9 A;  3C1C C;  4WZS B;  2G5I C;  5JRG D;  4KUD B;  4H9Q B;  3UTB C;  3AZJ D;  3WAA D;  3AZL B;  1M1A B;  5CPI C;  5GT3 B;  5AV8 C;  3AN2 B;  1KX5 B;  5B31 A;  4H9S A;  1TZY A;  1HQ3 C;  3W96 B;  1BH8 A;  4M6B A;  3W98 D;  5BO0 B;  4R8P A;  1EQZ D;  3MGR A;  3X1T B;  3AZM C;  3WTP D;  2YFV B;  5B32 A;  3MGS A;  4J8V A;  3W99 A;  4DRB A;  4HGA C;  1M19 D;  1KX3 C;  5FUG A;  5B2I A;  3EPK A;  3X1V A;  1KX4 D;  1F66 B;  4XZQ D;  2FJ7 A;  4H9S C;  5GT0 A;  1TZY C;  2NQB A;  3UTA D;  5CP6 C;  3REL A;  1P3O D;  4H9P A;  4LD9 C;  3LZ1 D;  2CV5 D;  5BT1 D;  5B2J A;  3MGP D;  3REK A;  1P3K B;  1P3P D;  5CPJ D;  3AZF B;  3R45 A;  5AVC B;  1P3F D;  1U35 C;  4YM6 B;  3AZN A;  5E5A D;  5AVB C;  5B32 C;  4J8V C;  3X1S A;  5B33 A;  2Y2K A;  2CWE A;  3X1V C;  4YS3 A;  5AV9 A;  3NQU B;  2F8N G;  3TU4 C;  3LEL D;  3AZE B;  2Y2N A;  2NQB C;  3AZH B;  5JA4 B;  2BYK B;  3REL C;  2Y2L A;  4X23 A;  5B2J C;  3O62 D;  1P3A A;  4G92 B;  5B0Z D;  3AZN C;  4NE5 A;  3X1S C;  5B24 A;  3AZK B;  3B6F B;  4J8W D;  5B1L A;  2PYO B;  1ID3 D;  5AV9 C;  5B0Y A;  3WA9 D;  5B40 A;  2HIO D;  2J8P A;  2NZD A;  3AV2 B;  3MVD D;  3UT9 B;  4ZBJ B;  2JE5 A;  1ZLA B;  3KUY D;  2BYM A;  4ZUX A;  1M18 B;  3LJA C;  4JJN B;  5B1M C;  5BNV B;  5F99 D;  3MGQ A;  4Z66 D;  3A6N A;  2ARO D;  5AY8 A;  3REI B;  4H9R A;  3AV1 D;  3C1C B;  1T3U A;  3NQJ A;  3C1B A;  1F66 C;  5GSU B;  4KUD D;  5B1L C;  3UTB B;  3VH5 T;  4E44 A;  5B0Y C;  3AZL D;  5AV8 B;  1M1A D;  3KXB A;  3AL0 C;  4UUZ A;  1HQ3 B;  5BS7 A;  3W96 D;  4ZUX C;  5AVC C;  1P3B A;  4YM6 C;  3MGQ C;  4WU8 D;  3REJ A;  4WNN A;  1KU5 A;  3AZM B;  4WU9 B;  3LZ0 A;  3AZH C;  3W97 A;  5B31 B;  1S32 D;  1TZY B;  5CPK A;  3AFA A;  1BH8 B;  1WWS A;  5DNM D;  4R8P B;  3X1U D;  4KGC D;  4Z5T D;  3REJ C;  3AZJ A;  3WAA A;  1U35 B;  3AZF D;  1P34 D;  5B32 B;  5AVB B;  3MGS B;  4J8V B;  5GXQ D;  5B32 G;  3W99 B;  3EPH A;  3X1V B;  2F8N D;  2YFW A;  3AV2 C;  3TU4 B;  3W98 A;  4ZBJ C;  3W97 C;  1EQZ A;  5GT0 B;  4AWL C;  2NQB B;  3KWQ C;  5CPK C;  3MNN D;  3AFA C;  3REL B;  5BNX A;  4H9P B;  4Z2M H;  3WTP A;  4Z2M G;  3IP4 C;  5B2J B;  3REK B;  1M19 A;  1KX4 A;  3R45 B;  3B6G D;  5GSU C;  4XZQ A;  3AZN B;  5G49 A;  3X1S B;  5CHL B;  4WV4 B;  3UTA A;  1H3O A;  2Y2G A;  3VH5 W;  3AZK D;  1P3O A;  4YS3 B;  3LZ1 A;  5AV9 B;  2CV5 A;  1P3M D;  5AV6 D;  3MGP A;  1EQZ C;  2Y2I A;  1P3P A;  5CPJ A;  4NFT A;  1P3F A;  3REH C;  5E5A A;  1ZLA D;  3LJA B;  5B1M B;  4WU9 C;  2Y2Q A;  4JJN D;  1M19 C;  3A1I A;  1P3L D;  3REI D;  4J8X D;  3LEL A;  1P3I D;  2XD5 A;  3C1C D;  3B0C T;  3UTA C;  5B31 C;  5B1L B;  4WJ3 C;  3LZ1 C;  5B0Y B;  5B40 B;  1P3G D;  5CPI D;  3O62 A;  5CPJ C;  2NZD B;  1AOI D;  1P3F C;  1N1J B;  4R8P C;  3MGR C;  5B0Z A;  2G5H C;  5E5A C;  4ZUX B;  3MGQ B;  3MGS C;  4J8W A;  3A6N B;  4NE6 A;  3W99 C;  1ID3 A;  4H9R B;  3WA9 A;  3AZG D; 
#chains in the Genus database with same CATH homology
 3AZM D;  5B2I C;  2HIO A;  3NQJ B;  5KDM A;  2JCH A;  4XUJ D;  3MVD A;  2FJ7 C;  2DQN C;  3H0R C;  5GT0 C;  3KUY A;  1KX3 D;  4CAY A;  1Q9C A;  3KXB B;  5F99 A;  4H9O A;  4QLC D;  4Z66 A;  2ARO A;  1B6W A;  3REK C;  3AZI D;  3AV1 A;  2JSS A;  5CP6 D;  2Y2J A;  4LD9 D;  1P3B B;  2ZM5 A;  4KUD A;  2L5A A;  3REJ B;  4WNN B;  5AV5 D;  1ID3 C;  3LZ0 B;  5B33 C;  3AZL A;  1M1A A;  1U35 D;  1PZR A;  3WA9 C;  1F1E A;  4YS3 C;  3V9R A;  5AVB D;  3W96 A;  3KUY C;  3W97 B;  5F99 C;  3TU4 D;  5DNN D;  2ZY4 A;  4WU8 A;  4Z66 C;  4X23 C;  4AWL B;  3KWQ B;  5CPK B;  3AFA B;  2ZY2 A;  1P3A C;  3WKJ D;  2RVQ D;  3AYW D;  3AZJ B;  5B24 C;  3WAA B;  1TAF A;  4E45 A;  3B0C W;  3H0L C;  1S32 A;  3X1S D;  3WTP E;  5B40 C;  3EPL A;  3AN2 D;  5GT3 D;  3VH6 T;  1KX5 D;  2NZD C;  5DNM A;  3W98 B;  1EQZ B;  3X1U A;  4WU8 C;  4KGC A;  4Z5T A;  5BNX B;  3AZF A;  1P34 A;  4CSR A;  3REH B;  3FDD A;  3WTP B;  3A6N C;  5AY8 C;  4G91 B;  4DRA A;  3X1T D;  5GXQ A;  3LJA D;  5B1M D;  1M19 B;  4EO5 C;  3C1B C;  4H9N A;  2F8N A;  4XZQ B;  3NQU A;  5G49 B;  1S32 C;  2VQR A;  3MNN A;  1H3O B;  3KXB C;  3UTA B;  1F66 D;  3H0M C;  4J8U A;  2BYK A;  3LZ1 B;  5B31 G;  2CV5 B;  3MGP B;  5BS7 C;  3X1U C;  1HTA A;  4KGC C;  1P3P B;  5JRG A;  5CPJ B;  1P3B C;  1P3F B;  3B6G A;  1P34 C;  3MGR B;  1P3K D;  5E5A B;  5C3I C;  5GXQ C;  3LZ0 C;  2IO5 B;  3A1K A;  5AVC D;  4YM6 D;  3AZK A;  1P3M A;  5AV6 A;  3LEL B;  5FUG B;  5B2I B;  2F2A C;  2FJ7 B;  3AZE D;  4J8U C;  1ZLA A;  3B0B A;  3AZH D;  4JJN A;  1P3L A;  5JRG C;  3O62 B;  3B0D C;  3B6G C;  5B0Z B;  4J8X A;  3AZJ C;  1P3I A;  3WAA C;  3C1C A;  1JFI A;  4J8W B;  1P3M C;  1ID3 B;  2HUE B;  3F6T A;  5B33 B;  5AV6 C;  1P3G A;  3WA9 B;  2HIO B;  3B6F D;  5CPI A;  4KHA A;  3VH6 W;  2PYO D;  3W98 C;  1AOI A;  3KUY B;  4CAY B;  5F99 B;  2ZY3 A;  4H9O B;  3WTP C;  3UT9 D;  4Z66 B;  3AV2 D;  4X23 B;  1P3L C;  2ARO B;  4G91 C;  3W97 D;  1M18 D;  3KWQ D;  5CPK D;  3AV1 B;  3AZG A;  3VH5 A;  1P3I C;  1KX4 C;  1P3A B;  4XZQ C;  4XUJ A;  3VH6 A;  5B24 B;  4DQY B;  2Y2O A;  1KX3 A;  1P3G C;  1P3O C;  5GSU D;  4QLC A;  3V9R B;  3UTB D;  2CV5 C;  5BT1 C;  1AOI C;  3MGP C;  3AZI A;  5AV8 D;  1P3P C;  5CP6 A;  4LD9 A;  1A7W A;  2W8S A;  1HQ3 D;  4WU8 B;  2BYM B;  1W2E A;  2IO5 C;  5AV5 A;  3AZG C;  1U35 A;  5AY8 B;  3REH D;  2RIQ A;  5AVB A;  3LEL C;  4XUJ C;  4WU9 D;  4EO5 B;  3C1B B;  1BH9 A;  1TAF B;  2DF4 C;  4QLC C;  5DNN A;  3TU4 A;  1S32 B;  3AZI C;  5B31 D;  3KSY A;  4UUZ B;  3O62 C;  4NE3 A;  1TZY D;  5DNM B;  3WKJ A;  5B0Z C;  2XD1 A;  3X1U B;  3AYW A;  4KGC B;  4Z5T B;  5AV5 C;  1P34 B;  4CSR B;  4R8P D;  4H9Q A;  4J8W C;  5C3I B;  3MGR D;  2HUE C;  5GXQ B;  2HIO C;  2FFF B;  3AN2 A;  5GT3 A;  5B32 D;  3MGS D;  1KX5 A;  4H9N B;  4J8V D;  2F8N B;  3MVD C;  3W99 D;  2F8N H;  5DNN C;  5B2I D;  3X1V D;  3MNN B;  4J8U B;  2FJ7 D;  5BO0 A;  2ARO C;  5GT0 D;  2NQB D;  3WKJ C;  2RVQ C;  3AV1 C;  3X1T A;  3LJA A;  5B1M A;  3REL D;  3AYW C;  5JRG B;  2YFV A;  3B0D B;  3B6G B;  5B2J D;  4KUD C;  3REK D;  3AZL C;  1M1A C;  1F66 A;  2BG1 A;  3AZN D;  3AN2 C;  5GT3 C;  1KX5 C;  1P3M B;  5AV6 B;  5B33 D;  3W96 C;  2YFW B;  4YS3 D;  5AV9 D;  2Y2P A;  1N1J A;  3P5J B;  1P3K A;  3X1T C;  5AVC A;  4YM6 A;  1P3L B;  1BFM A;  4X23 D;  4J8X B;  1P3I B;  1KX4 B;  1P3A D;  1ULY A;  1JFI B;  3KFU G;  3EPJ A;  3AZE A;  5B24 D;  1P3G B;  1P3O B;  3AZH A;  5JA4 A;  2UWX A;  5CPI B;  5B1L D;  4KHA B;  5DNM C;  1AOI B;  5B0Y D;  5B40 D;  1P3K C;  4Z5T C;  2Y2H A;  3AZF C;  2NZD D;  2Y2M A;  4ZUX D;  4UPK A;  3AZG B;  3MGQ D;  3B6F A;  3A6N D;  5AY8 D;  2PYO A;  4XUJ B;  4HGA B;  3AZE C;  1KX3 B;  3MNN C;  3C1B D;  3AV2 A;  4QLC B;  3UT9 A;  1B67 A;  2ZY5 A;  1M18 A;  3KWQ A;  3AZI B;  5BNV A;  5CP6 B;  3KXB D;  4LD9 B;  1WWI A;  3REI A;  4G92 C;  5AV5 B;  1P3B D;  3AZK C;  5GSU A;  3B6F C;  3REJ D;  3UTB A;  2LY8 A;  2PYO C;  3LZ0 D;  3EG5 B;  5AV8 A;  5KDM B;  1R4V A;  1BH9 B;  3MVD B;  1HQ3 A;  3UT9 C;  5DNN B;  1ZLA C;  1M18 C;  4JJN C;  2F8N K;  4J8U D;  3REH A;  1Z2C B;  3WKJ B;  3REI C;  3AFA D;  4J8X C;  3AYW B;  3AZM A;  4WU9 A;  3C1C C;  4WZS B;  2G5I C;  5JRG D;  4KUD B;  4H9Q B;  3UTB C;  3AZJ D;  3WAA D;  3AZL B;  1M1A B;  5CPI C;  5GT3 B;  5AV8 C;  3AN2 B;  1KX5 B;  5B31 A;  4H9S A;  1TZY A;  1HQ3 C;  3W96 B;  1BH8 A;  4M6B A;  3W98 D;  5BO0 B;  4R8P A;  1EQZ D;  3MGR A;  3X1T B;  3AZM C;  3WTP D;  2YFV B;  5B32 A;  3MGS A;  4J8V A;  3W99 A;  4DRB A;  4HGA C;  1M19 D;  1KX3 C;  5FUG A;  5B2I A;  3EPK A;  3X1V A;  1KX4 D;  1F66 B;  4XZQ D;  2FJ7 A;  4H9S C;  5GT0 A;  1TZY C;  2NQB A;  3UTA D;  5CP6 C;  3REL A;  1P3O D;  4H9P A;  4LD9 C;  3LZ1 D;  2CV5 D;  5BT1 D;  5B2J A;  3MGP D;  3REK A;  1P3K B;  1P3P D;  5CPJ D;  3AZF B;  3R45 A;  5AVC B;  1P3F D;  1U35 C;  4YM6 B;  3AZN A;  5E5A D;  5AVB C;  5B32 C;  4J8V C;  3X1S A;  5B33 A;  2Y2K A;  2CWE A;  3X1V C;  4YS3 A;  5AV9 A;  3NQU B;  2F8N G;  3TU4 C;  3LEL D;  3AZE B;  2Y2N A;  2NQB C;  3AZH B;  5JA4 B;  2BYK B;  3REL C;  2Y2L A;  4X23 A;  5B2J C;  3O62 D;  1P3A A;  4G92 B;  5B0Z D;  3AZN C;  4NE5 A;  3X1S C;  5B24 A;  3AZK B;  3B6F B;  4J8W D;  5B1L A;  2PYO B;  1ID3 D;  5AV9 C;  5B0Y A;  3WA9 D;  5B40 A;  2HIO D;  2J8P A;  2NZD A;  3AV2 B;  3MVD D;  3UT9 B;  4ZBJ B;  2JE5 A;  1ZLA B;  3KUY D;  2BYM A;  4ZUX A;  1M18 B;  3LJA C;  4JJN B;  5B1M C;  5BNV B;  5F99 D;  3MGQ A;  4Z66 D;  3A6N A;  2ARO D;  5AY8 A;  3REI B;  4H9R A;  3AV1 D;  3C1C B;  1T3U A;  3NQJ A;  3C1B A;  1F66 C;  5GSU B;  4KUD D;  5B1L C;  3UTB B;  3VH5 T;  4E44 A;  5B0Y C;  3AZL D;  5AV8 B;  1M1A D;  3KXB A;  3AL0 C;  4UUZ A;  1HQ3 B;  5BS7 A;  3W96 D;  4ZUX C;  5AVC C;  1P3B A;  4YM6 C;  3MGQ C;  4WU8 D;  3REJ A;  4WNN A;  1KU5 A;  3AZM B;  4WU9 B;  3LZ0 A;  3AZH C;  3W97 A;  5B31 B;  1S32 D;  1TZY B;  5CPK A;  3AFA A;  1BH8 B;  1WWS A;  5DNM D;  4R8P B;  3X1U D;  4KGC D;  4Z5T D;  3REJ C;  3AZJ A;  3WAA A;  1U35 B;  3AZF D;  1P34 D;  5B32 B;  5AVB B;  3MGS B;  4J8V B;  5GXQ D;  5B32 G;  3W99 B;  3EPH A;  3X1V B;  2F8N D;  2YFW A;  3AV2 C;  3TU4 B;  3W98 A;  4ZBJ C;  3W97 C;  1EQZ A;  5GT0 B;  4AWL C;  2NQB B;  3KWQ C;  5CPK C;  3MNN D;  3AFA C;  3REL B;  5BNX A;  4H9P B;  4Z2M H;  3WTP A;  4Z2M G;  3IP4 C;  5B2J B;  3REK B;  1M19 A;  1KX4 A;  3R45 B;  3B6G D;  5GSU C;  4XZQ A;  3AZN B;  5G49 A;  3X1S B;  5CHL B;  4WV4 B;  3UTA A;  1H3O A;  2Y2G A;  3VH5 W;  3AZK D;  1P3O A;  4YS3 B;  3LZ1 A;  5AV9 B;  2CV5 A;  1P3M D;  5AV6 D;  3MGP A;  1EQZ C;  2Y2I A;  1P3P A;  5CPJ A;  4NFT A;  1P3F A;  3REH C;  5E5A A;  1ZLA D;  3LJA B;  5B1M B;  4WU9 C;  2Y2Q A;  4JJN D;  1M19 C;  3A1I A;  1P3L D;  3REI D;  4J8X D;  3LEL A;  1P3I D;  2XD5 A;  3C1C D;  3B0C T;  3UTA C;  5B31 C;  5B1L B;  4WJ3 C;  3LZ1 C;  5B0Y B;  5B40 B;  1P3G D;  5CPI D;  3O62 A;  5CPJ C;  2NZD B;  1AOI D;  1P3F C;  1N1J B;  4R8P C;  3MGR C;  5B0Z A;  2G5H C;  5E5A C;  4ZUX B;  3MGQ B;  3MGS C;  4J8W A;  3A6N B;  4NE6 A;  3W99 C;  1ID3 A;  4H9R B;  3WA9 A;  3AZG D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...