5CP6C

Nucleosome core particle with adducts from the anticancer compound, [(eta6-5,8,9,10-tetrahydroanthracene)ru(ethylenediamine)cl][pf6]
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
106
structure length
106
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords DNA (145-MER)
publication title An Organometallic Compound which Exhibits a DNA Topology-Dependent One-Stranded Intercalation Mode.
pubmed doi rcsb
source organism Xenopus laevis
total genus 32
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5cp6C00
3REKD 1P3PA 2NQBA 5CPKA 3W98D 2L5AA 3UTBD 4WU8D 5B0ZC 3MVDD 4Z66B 4YM6A 1P3IC 3UT9C 3AZGB 1KX5A 3W96D 1Q9CA 4XZQD 3AZLB 1U35D 3W99A 4CAYA 3TU4B 3LZ0A 2CV5C 4J8WC 5B1MC 4R8PB 3VH5W 3AZMD 4Z5TC 4ZBJC 2HIOB 1S32C 2PYOD 5FUGB 4EO5B 3AZJC 1M18B 5B32D 1P3GD 5B31D 3X1VC 4JJND 3RELA 1P3BB 4AWLB 1M19C 5B2IB 3W99C 3MNNB 3AFAD 1P3LB 1KX4D 3O62A 3LELB 5FUGA 3KUYA 5AVCA 1M18A 4Z66C 5DNNB 3VH6W 1TAFB 3AZGC 3B6GD 3AZLC 3AZND 3TU4C 3MNNA 5E5AB 1P3LA 3C1CB 1ZLAB 4R8PC 5AV5D 4WU9B 3REIB 2HIOC 3R45A 4H9NB 3W96A 3AV1D 4XZQA 4KUDD 1U35A 4WNNB 4ZUXB 3WKJC 1TAFA 4XUJA 3UTAB 5BS7A 4EO5C 1JFIB 4UUZB 5E5AA 1P3BC 3C1CA 1ZLAA 4AWLC 5B2IC 3REJA 5B24B 3AZIB 2RVQC 5CPID 3LELC 3LZ1A 5B2JD 4WNNA 5B0ZD 4ZUXA 3X1TC 1P3GA 2F8NK 2HUEB 2F8NH 3KXBB 5DNNC 4H9SC 4M6BA 4G92C 3AFAA 3C1BB 3AZIA 4J8XD 5E5AC 4Z5TD 5AV6C 1HQ3A 4WU9C 3REIC 1S32D 5BNVB 3B6GA 3AZEA 3AV2B 2NZDB 3UTAC 4YM6D 3MGQC 3X1VD 4KGCC 3W99D 1P3AB 1EQZA 3AV1A 5B24C 1BH9B 2F8NB 5BNVA 3UT9B 4Z2MG 5B33B 3AYWB 3VH5A 1P3FB 2NZDA 4Z66D 2HUEC 2BYMA 3KXBC 2CV5B 4J8WB 5CP6C 4CSRB 3MGPB 3AZLD 2AROB 3C1BC 3RELD 4ZBJB 4R8PD 2IO5B 2F8NA 1P3IA 3UT9A 3AYWA 2HIOD 5G49A 3WTPB 3O62D 3AZFB 5GSUB 1TZYC 4WV4B 2CV5A 3REHB 4QLCB 3KUYD 4J8WA 5B1MA 5GT3C 4CSRA 3AV2C 2NZDC 3A6NB 5GXQB 5CPJC 4YS3B 1P3OC 1M19B 1M18D 5F99B 3W97B 3KSYA 5B2ID 1P3AC 3VH6A 4H9PB 1S32A 3MNND 5B0YC 1P3LD 3AZFA 3AZJA 3LELD 2LY8A 3REHA 3X1VA 3AYWC 5B33C 1P3FC 5GXQA 4YS3A 1M19A 5JRGB 4XUJD 3MGPC 2AROC 5GT0B 5E5AD 3AZHB 4H9RB 3C1CD 1ZLAD 2IO5C 3AZKB 5AY8B 4Z66A 3REJD 2FJ7C 4WU9D 3WAAB 3WKJB 3WTPC 3AZFC 3AZGA 3WA9B 3LZ1D 5JRGA 3AZLA 5GSUC 4ZUXD 4E44A 3TU4A 4LD9B 3REHC 4QLCC 5AV8C 5AV9C 1M1AB 1A7WA 4R8PA 3A6NC 5GXQC 3W97C 4YS3C 5F99C 5B1LB 4H9RA 2HIOA 5B24D 3AZID 3WKJA 3X1TB 3B0DB 5CHLB 1P34C 1P3KB 1HQ3D 1AOIB 3NQJB 4J8UC 4G92B 1P3BA 5B2IA 5JRGC 3AZED 4X23C 2BYKB 4NE3A 1P3MC 5C3IB 3X1UC 3V9RB 3C1BD 3LELA 3REKB 5AV6B 1WWIA 5GT0C 3X1TA 3AZHC 1KX3B 3W98B 1EQZD 3AZKC 5AY8C 1P3KA 3VH5T 5DNNA 4H9SA 3WAAC 3WA9C 3MGQB 4DRAA 3AV2D 4H9QB 4KGCB 2NZDD 4LD9C 4WZSB 5B40B 1M1AC 5AV6A 3X1SB 5JA4B 5B1LC 4WU9A 2CWEA 3REIA 4H9NA 1H3OB 4Z2MH 3UTAA 3B0DC 1JFIA 2F8ND 1P3ID 3MGQA 3UT9D 3AYWD 3AN2C 1P3KC 2PYOB 4UUZA 1AOIC 4KGCA 5BO0B 5CP6B 5B32B 5JA4A 2CV5D 1F66C 4J8WD 5B1MD 5B24A 3MGPD 2AROD 5C3IC 3VH6T 5B32G 1ID3B 5B31G 3REKC 1H3OA 4E45A 1KX4B 1KX3C 3W98C 1TZYB 4HGAB 4J8VB 3KXBA 4WU8C 3WTPD 3AZFD 3AZJD 5GT3B 5CP6A 1B6WA 5CPJB 5GSUD 3MVDC 1P3OB 3C1BA 3REHD 3A6ND 5GXQD 4YS3D 1M19D 3AZNB 5F99D 5B40C 3KWQB 3X1SC 4KHAB 5B0YB 1ULYA 1N1JB 3AZMC 1TZYA 5AV5B 3AV2A 5GT3A 5CPJA 1P3OA 4KUDB 3MGRB 2PYOC 3AZGD 5JRGD 3TU4D 1P3AA 5B32C 4KHAA 5B31C 4JJNC 5B0YA 1BH9A 3B6FB 2FJ7B 1ID3C 5GT0D 4G91C 1HTAA 5B33A 1P3FA 5CPIB 1KX4C 3AZKD 5AY8D 3MGSB 3MGRA 4HGAC 4J8VC 3WKJD 5AVBB 5AV8B 5AV9B 3WA9D 3MGPA 2AROA 4LD9D 1P3BD 2YFWB 1M1AD 3B6FA 3AZNC 2FJ7A 5B1LD 3KWQC 2RVQD 4J8XB 3WTPA 1P3PB 2NQBB 5GSUA 1P34B 5AV5C 5CPKB 3X1TD 4QLCA 5AV8A 4J8UB 5AV9A 5BNXB 3W97A 3A6NA 1P3KD 4KUDC 3MGRC 1AOID 5F99A 5DNND 4X23B 2YFWA 1P3MB 4YM6B 3X1UB 4NE6A 4H9PA 1KX5B 4DRBA 4CAYB 5AV6D 3LZ0B 3B6FC 1P34A 4J8UA 1KX3D 3REID 5CPIC 5BNXA 3MGSC 5B2JC 4X23A 5AVBC 3UTAD 1P3MA 3X1UA 3MGQD 4KGCD 5DNMB 5GT0A 3AZHA 5B40D 3X1SD 3AZKA 5AY8A 3RELB 4J8XC 3WAAA 1B67A 3WA9A 1P3PC 2NQBC 3AN2B 5CPKC 5BT1C 4LD9A 3O62B 1M1AA 3KXBD 5DNMA 5AVCB 5B1LA 5CP6D 3LJAB 3KUYB 1F66B 3B0BA 4YM6C 1KX5C 4NFTA 1ID3D 3LZ0C 1BFMA 3AN2A 1AOIA 4WU8B 3UTBB 3NQJA 3MVDB 1KU5A 1TZYD 4J8VD 1F66A 2BYKA 5GT3D 3LJAA 3R45B 5CPJD 3W96B 4XZQB 1P3OD 1U35B 3V9RA 3REKA 4XUJB 5DNMC 1KX3A 3W98A 1P3AD 3KWQD 3AZMB 5B0YD 3RELC 4WU8A 3UTBA 3MVDA 3REJB 4H9QA 5B33D 1P3FD 3WTPE 1F1EA 3B0CW 3O62C 4H9OB 3LZ1B 3MGRD 5B40A 3X1SA 1P3GB 5B31B 4JJNB 3KUYC 5AVCC 3LJAC 1M18C 3AZMA 4G91B 3AFAB 3B6FD 2FJ7D 5KDMB 3MNNC 1P3LC 2PYOA 3UTBC 5BO0A 4H9OA 3MGSD 1HQ3B 5B32A 5AVBD 5B31A 4QLCD 5AV8D 4JJNA 5AV9D 3W96C 3W97D 2JSSA 4XZQC 3B6GB 1U35C 3AZEB 1ID3A 4XUJC 5BS7C 1KX4A 3NQUB 5KDMA 4J8VA 4NE5A 3C1CC 1ZLAC 1P3PD 1EQZB 2NQBD 3AV1B 1P34D 3REJC 5CPKD 5BT1D 4J8UD 3LZ1C 3AZNA 4X23D 4ZUXC 3KWQA 1P3GC 1P3MD 3X1UD 3NQUA 1N1JA 2BYMB 3B0CT 2YFVB 5AV5A 1KX5D 3AZHD 3AFAC 3LZ0D 1BH8B 4KUDA 5B2JB 3AZIC 5B0ZB 1WWSA 3WAAD 1P3IB 1HQ3C 5G49B 2F8NG 3B6GC 2YFVA 5DNMD 3AZEC 5B1MB 5CPIA 4Z5TB 1BH8A 3MGSA 5B2JA 5B0ZA 5AVBA 1EQZC 1S32B 3AV1C 3AN2D 3AZJB 3X1VB 1F66D 1R4VA 5AVCD 3LJAD 4J8XA 4Z5TA 3W99B
chains in the Genus database with same CATH superfamily
3REKD 1P3PA 2NQBA 5CPKA 2JE5A 3W98D 2L5AA 3UTBD 4WU8D 5B0ZC 3MVDD 4Z66B 4YM6A 2J8PA 1P3IC 3UT9C 3FDDA 3AZGB 1KX5A 3W96D 1Q9CA 4XZQD 3AZLB 1U35D 3W99A 4CAYA 3TU4B 3LZ0A 2CV5C 4J8WC 5B1MC 4R8PB 3VH5W 3AZMD 4Z5TC 2Y2GA 4ZBJC 2VQRA 2HIOB 1S32C 2PYOD 5FUGB 4EO5B 3AZJC 1M18B 5B32D 1P3GD 5B31D 3X1VC 4JJND 3RELA 1P3BB 4AWLB 1M19C 5B2IB 3W99C 2ZY3A 1T3UA 3MNNB 3AFAD 1P3LB 1KX4D 3O62A 3LELB 2XD5A 5FUGA 3KUYA 5AVCA 1PZRA 1M18A 4Z66C 3EPJA 5DNNB 3VH6W 1TAFB 3AZGC 3B6GD 3AZLC 3AZND 3TU4C 3MNNA 5E5AB 1P3LA 3C1CB 1ZLAB 4R8PC 5AV5D 4WU9B 2ZY5A 3REIB 2HIOC 3R45A 4H9NB 3W96A 3AV1D 4XZQA 4KUDD 1U35A 4WNNB 4ZUXB 3WKJC 1TAFA 4XUJA 3UTAB 5BS7A 4EO5C 1JFIB 4UUZB 5E5AA 1P3BC 3C1CA 1ZLAA 4AWLC 5B2IC 3REJA 5B24B 3AZIB 2RVQC 5CPID 3LELC 3LZ1A 4UPKA 5B2JD 4WNNA 1W2EA 5B0ZD 4ZUXA 3X1TC 1P3GA 2F8NK 4WJ3C 2HUEB 2F8NH 3KXBB 5DNNC 4H9SC 4M6BA 4G92C 3AFAA 3C1BB 3AZIA 4J8XD 5E5AC 2F2AC 4Z5TD 5AV6C 1HQ3A 4WU9C 3REIC 1S32D 5BNVB 3B6GA 2ZM5A 3AZEA 3AV2B 2NZDB 3UTAC 3A1IA 4YM6D 3MGQC 3X1VD 4KGCC 3W99D 1P3AB 1EQZA 3AV1A 5B24C 1BH9B 3EPKA 2F8NB 5BNVA 3UT9B 4Z2MG 5B33B 3AYWB 3VH5A 1P3FB 2NZDA 4Z66D 2HUEC 2BYMA 3KXBC 2CV5B 4J8WB 5CP6C 4CSRB 3MGPB 3AZLD 2AROB 3C1BC 2Y2LA 3RELD 4ZBJB 4R8PD 2IO5B 2F8NA 1P3IA 3UT9A 3AYWA 2HIOD 5G49A 3WTPB 2JCHA 3O62D 3AZFB 5GSUB 1TZYC 1Z2CB 4WV4B 2CV5A 2Y2MA 4QLCB 3KUYD 4J8WA 5B1MA 5GT3C 4CSRA 3REHB 3AV2C 2NZDC 3A6NB 5GXQB 5CPJC 4YS3B 1P3OC 1M19B 1M18D 5F99B 3W97B 2W8SA 2G5HC 3KSYA 5B2ID 1P3AC 3VH6A 4H9PB 1S32A 2Y2IA 3MNND 5B0YC 1P3LD 3AZFA 3AZJA 3LELD 2Y2KA 2LY8A 3REHA 3X1VA 3AYWC 5B33C 1P3FC 5GXQA 4YS3A 1M19A 5JRGB 2Y2JA 4XUJD 3MGPC 2AROC 5GT0B 5E5AD 3AZHB 4H9RB 3C1CD 1ZLAD 2IO5C 3AZKB 5AY8B 4Z66A 3REJD 2FJ7C 4WU9D 2Y2QA 3WAAB 3WKJB 3WTPC 3AZFC 3AZGA 3WA9B 3LZ1D 5JRGA 3AZLA 5GSUC 4ZUXD 4E44A 3TU4A 4LD9B 3REHC 4QLCC 5AV8C 5AV9C 1M1AB 1A7WA 4R8PA 3A6NC 5GXQC 3W97C 4YS3C 5F99C 5B1LB 4H9RA 2HIOA 5B24D 3AZID 3WKJA 3X1TB 3B0DB 5CHLB 1P34C 1P3KB 1HQ3D 1AOIB 3NQJB 4J8UC 4G92B 1P3BA 2G5IC 5B2IA 5JRGC 3AZED 4X23C 2BYKB 4NE3A 2BG1A 2Y2PA 1P3MC 5C3IB 3X1UC 3V9RB 3C1BD 3LELA 3REKB 5AV6B 1WWIA 5GT0C 3X1TA 3AZHC 1KX3B 3W98B 1EQZD 3AZKC 5AY8C 1P3KA 3VH5T 5DNNA 4H9SA 3WAAC 3WA9C 3MGQB 4DRAA 3AV2D 4H9QB 4KGCB 2NZDD 4LD9C 4WZSB 5B40B 1M1AC 5AV6A 3X1SB 5JA4B 5B1LC 4WU9A 2CWEA 3REIA 4H9NA 1H3OB 2DF4C 4Z2MH 3KFUG 3UTAA 3B0DC 1JFIA 2F8ND 1P3ID 3MGQA 3UT9D 3AYWD 3AN2C 1P3KC 2PYOB 4UUZA 1AOIC 4KGCA 5BO0B 3H0LC 5CP6B 5B32B 5JA4A 2CV5D 1F66C 4J8WD 5B1MD 5B24A 3MGPD 2AROD 5C3IC 3VH6T 5B32G 1ID3B 5B31G 4DQYB 1H3OA 3REKC 4E45A 1KX4B 1KX3C 3W98C 1TZYB 4HGAB 4J8VB 3KXBA 4WU8C 3WTPD 3AZFD 3AZJD 5GT3B 5CP6A 1B6WA 5CPJB 5GSUD 3MVDC 1P3OB 3C1BA 3REHD 3A6ND 5GXQD 4YS3D 1M19D 3AZNB 5F99D 5B40C 3KWQB 3X1SC 4KHAB 5B0YB 1ULYA 1N1JB 3AZMC 1TZYA 5AV5B 3AV2A 5GT3A 5CPJA 1P3OA 4KUDB 3MGRB 3A1KA 2PYOC 3AZGD 5JRGD 3TU4D 1P3AA 5B32C 2UWXA 4KHAA 5B31C 4JJNC 5B0YA 1BH9A 3B6FB 2FJ7B 1ID3C 5GT0D 4G91C 1HTAA 5B33A 1P3FA 5CPIB 1KX4C 3AZKD 5AY8D 3MGSB 3MGRA 4HGAC 4J8VC 3WKJD 5AVBB 5AV8B 5AV9B 3WA9D 3MGPA 2AROA 4LD9D 2Y2OA 3EPLA 1P3BD 2YFWB 1M1AD 3B6FA 3AZNC 2FJ7A 5B1LD 3KWQC 2RVQD 4J8XB 3WTPA 3H0RC 1P3PB 2NQBB 5GSUA 1P34B 5AV5C 5CPKB 3X1TD 4QLCA 5AV8A 4J8UB 5AV9A 5BNXB 3W97A 3A6NA 1P3KD 4KUDC 3MGRC 1AOID 5F99A 5DNND 4X23B 2YFWA 1P3MB 4YM6B 3X1UB 4NE6A 4H9PA 1KX5B 4DRBA 4CAYB 5AV6D 3LZ0B 3B6FC 1P34A 4J8UA 1KX3D 3REID 5CPIC 5BNXA 3MGSC 5B2JC 4X23A 5AVBC 3UTAD 1P3MA 3X1UA 3MGQD 4KGCD 3F6TA 5DNMB 5GT0A 3AZHA 5B40D 2XD1A 3X1SD 3AZKA 5AY8A 3RELB 4J8XC 3WAAA 1B67A 3WA9A 1P3PC 3H0MC 2NQBC 3AN2B 5CPKC 5BT1C 4LD9A 3O62B 1M1AA 3KXBD 5DNMA 5AVCB 5B1LA 5CP6D 3LJAB 3KUYB 1F66B 3B0BA 3EPHA 4YM6C 1KX5C 4NFTA 1ID3D 3LZ0C 1BFMA 3AN2A 1AOIA 4WU8B 3UTBB 3NQJA 3P5JB 3MVDB 1KU5A 1TZYD 4J8VD 2FFFB 3IP4C 1F66A 2BYKA 5GT3D 3LJAA 3R45B 5CPJD 3W96B 4XZQB 1P3OD 1U35B 3V9RA 3REKA 4XUJB 5DNMC 1KX3A 3AL0C 3W98A 1P3AD 3KWQD 3AZMB 5B0YD 3RELC 4WU8A 3UTBA 3EG5B 2RIQA 3MVDA 3REJB 4H9QA 5B33D 1P3FD 3B0CW 1F1EA 3WTPE 3O62C 4H9OB 3LZ1B 3MGRD 5B40A 3X1SA 1P3GB 5B31B 4JJNB 3KUYC 5AVCC 3LJAC 1M18C 3AZMA 4G91B 3AFAB 3B6FD 2FJ7D 5KDMB 3MNNC 1P3LC 2PYOA 3UTBC 5BO0A 4H9OA 3MGSD 1HQ3B 5B32A 5AVBD 5B31A 4QLCD 5AV8D 4JJNA 5AV9D 3W96C 3W97D 2JSSA 4XZQC 3B6GB 1U35C 3AZEB 1ID3A 4XUJC 5BS7C 1KX4A 3NQUB 5KDMA 4J8VA 4NE5A 3C1CC 1ZLAC 1P3PD 1EQZB 2NQBD 3AV1B 1P34D 3REJC 5CPKD 5BT1D 4J8UD 2DQNC 3LZ1C 3AZNA 4X23D 4ZUXC 3KWQA 1P3GC 1P3MD 3NQUA 3X1UD 1N1JA 2BYMB 3B0CT 2YFVB 5AV5A 1KX5D 3AZHD 2Y2NA 3AFAC 3LZ0D 1BH8B 4KUDA 5B2JB 3AZIC 5B0ZB 1WWSA 3WAAD 2Y2HA 1P3IB 1HQ3C 5G49B 2F8NG 3B6GC 2YFVA 5DNMD 3AZEC 5B1MB 2ZY4A 5CPIA 4Z5TB 1BH8A 3MGSA 5B2JA 5B0ZA 5AVBA 1EQZC 1S32B 3AV1C 3AN2D 3AZJB 2ZY2A 3X1VB 1F66D 1R4VA 5AVCD 3LJAD 4J8XA 4Z5TA 3W99B
chains in the Genus database with same CATH topology
3REKD 1P3PA 2NQBA 5CPKA 2JE5A 3W98D 2L5AA 3UTBD 4WU8D 5B0ZC 3MVDD 4Z66B 4YM6A 2J8PA 1P3IC 3UT9C 3FDDA 3AZGB 1KX5A 3W96D 1Q9CA 4XZQD 3AZLB 1U35D 3W99A 4CAYA 3TU4B 3LZ0A 2CV5C 4J8WC 5B1MC 4R8PB 3VH5W 3AZMD 4Z5TC 2Y2GA 4ZBJC 2VQRA 2HIOB 1S32C 2PYOD 5FUGB 4EO5B 3AZJC 1M18B 5B32D 1P3GD 5B31D 3X1VC 4JJND 3RELA 1P3BB 4AWLB 1M19C 5B2IB 3W99C 2ZY3A 1T3UA 3MNNB 3AFAD 1P3LB 1KX4D 3O62A 3LELB 2XD5A 5FUGA 3KUYA 5AVCA 1PZRA 1M18A 4Z66C 3EPJA 5DNNB 3VH6W 1TAFB 3AZGC 3B6GD 3AZLC 3AZND 3TU4C 3MNNA 5E5AB 1P3LA 3C1CB 1ZLAB 4R8PC 5AV5D 4WU9B 2ZY5A 3REIB 2HIOC 3R45A 4H9NB 3W96A 3AV1D 4XZQA 4KUDD 1U35A 4WNNB 4ZUXB 3WKJC 1TAFA 4XUJA 3UTAB 5BS7A 4EO5C 1JFIB 4UUZB 5E5AA 1P3BC 3C1CA 1ZLAA 4AWLC 5B2IC 3REJA 5B24B 3AZIB 2RVQC 5CPID 3LELC 3LZ1A 4UPKA 5B2JD 4WNNA 1W2EA 5B0ZD 4ZUXA 3X1TC 1P3GA 2F8NK 4WJ3C 2HUEB 2F8NH 3KXBB 5DNNC 4H9SC 4M6BA 4G92C 3AFAA 3C1BB 3AZIA 4J8XD 5E5AC 2F2AC 4Z5TD 5AV6C 1HQ3A 4WU9C 3REIC 1S32D 5BNVB 3B6GA 2ZM5A 3AZEA 3AV2B 2NZDB 3UTAC 3A1IA 4YM6D 3MGQC 3X1VD 4KGCC 3W99D 1P3AB 1EQZA 3AV1A 5B24C 1BH9B 3EPKA 2F8NB 5BNVA 3UT9B 4Z2MG 5B33B 3AYWB 3VH5A 1P3FB 2NZDA 4Z66D 2HUEC 2BYMA 3KXBC 2CV5B 4J8WB 5CP6C 4CSRB 3MGPB 3AZLD 2AROB 3C1BC 2Y2LA 3RELD 4ZBJB 4R8PD 2IO5B 2F8NA 1P3IA 3UT9A 3AYWA 2HIOD 5G49A 3WTPB 2JCHA 3O62D 3AZFB 5GSUB 1TZYC 1Z2CB 4WV4B 2CV5A 2Y2MA 4QLCB 3KUYD 4J8WA 5B1MA 5GT3C 4CSRA 3REHB 3AV2C 2NZDC 3A6NB 5GXQB 5CPJC 4YS3B 1P3OC 1M19B 1M18D 5F99B 3W97B 2W8SA 2G5HC 3KSYA 5B2ID 1P3AC 3VH6A 4H9PB 1S32A 2Y2IA 3MNND 5B0YC 1P3LD 3AZFA 3AZJA 3LELD 2Y2KA 2LY8A 3REHA 3X1VA 3AYWC 5B33C 1P3FC 5GXQA 4YS3A 1M19A 5JRGB 2Y2JA 4XUJD 3MGPC 2AROC 5GT0B 5E5AD 3AZHB 4H9RB 3C1CD 1ZLAD 2IO5C 3AZKB 5AY8B 4Z66A 3REJD 2FJ7C 4WU9D 2Y2QA 3WAAB 3WKJB 3WTPC 3AZFC 3AZGA 3WA9B 3LZ1D 5JRGA 3AZLA 5GSUC 4ZUXD 4E44A 3TU4A 4LD9B 3REHC 4QLCC 5AV8C 5AV9C 1M1AB 1A7WA 4R8PA 3A6NC 5GXQC 3W97C 4YS3C 5F99C 5B1LB 4H9RA 2HIOA 5B24D 3AZID 3WKJA 3X1TB 3B0DB 5CHLB 1P34C 1P3KB 1HQ3D 1AOIB 3NQJB 4J8UC 4G92B 1P3BA 2G5IC 5B2IA 5JRGC 3AZED 4X23C 2BYKB 4NE3A 2BG1A 2Y2PA 1P3MC 5C3IB 3X1UC 3V9RB 3C1BD 3LELA 3REKB 5AV6B 1WWIA 5GT0C 3X1TA 3AZHC 1KX3B 3W98B 1EQZD 3AZKC 5AY8C 1P3KA 3VH5T 5DNNA 4H9SA 3WAAC 3WA9C 3MGQB 4DRAA 3AV2D 4H9QB 4KGCB 2NZDD 4LD9C 4WZSB 5B40B 1M1AC 5AV6A 3X1SB 5JA4B 5B1LC 4WU9A 2CWEA 3REIA 4H9NA 1H3OB 2DF4C 4Z2MH 3KFUG 3UTAA 3B0DC 1JFIA 2F8ND 1P3ID 3MGQA 3UT9D 3AYWD 3AN2C 1P3KC 2PYOB 4UUZA 1AOIC 4KGCA 5BO0B 3H0LC 5CP6B 5B32B 5JA4A 2CV5D 1F66C 4J8WD 5B1MD 5B24A 3MGPD 2AROD 5C3IC 3VH6T 5B32G 1ID3B 5B31G 4DQYB 1H3OA 3REKC 4E45A 1KX4B 1KX3C 3W98C 1TZYB 4HGAB 4J8VB 3KXBA 4WU8C 3WTPD 3AZFD 3AZJD 5GT3B 5CP6A 1B6WA 5CPJB 5GSUD 3MVDC 1P3OB 3C1BA 3REHD 3A6ND 5GXQD 4YS3D 1M19D 3AZNB 5F99D 5B40C 3KWQB 3X1SC 4KHAB 5B0YB 1ULYA 1N1JB 3AZMC 1TZYA 5AV5B 3AV2A 5GT3A 5CPJA 1P3OA 4KUDB 3MGRB 3A1KA 2PYOC 3AZGD 5JRGD 3TU4D 1P3AA 5B32C 2UWXA 4KHAA 5B31C 4JJNC 5B0YA 1BH9A 3B6FB 2FJ7B 1ID3C 5GT0D 4G91C 1HTAA 5B33A 1P3FA 5CPIB 1KX4C 3AZKD 5AY8D 3MGSB 3MGRA 4HGAC 4J8VC 3WKJD 5AVBB 5AV8B 5AV9B 3WA9D 3MGPA 2AROA 4LD9D 2Y2OA 3EPLA 1P3BD 2YFWB 1M1AD 3B6FA 3AZNC 2FJ7A 5B1LD 3KWQC 2RVQD 4J8XB 3WTPA 3H0RC 1P3PB 2NQBB 5GSUA 1P34B 5AV5C 5CPKB 3X1TD 4QLCA 5AV8A 4J8UB 5AV9A 5BNXB 3W97A 3A6NA 1P3KD 4KUDC 3MGRC 1AOID 5F99A 5DNND 4X23B 2YFWA 1P3MB 4YM6B 3X1UB 4NE6A 4H9PA 1KX5B 4DRBA 4CAYB 5AV6D 3LZ0B 3B6FC 1P34A 4J8UA 1KX3D 3REID 5CPIC 5BNXA 3MGSC 5B2JC 4X23A 5AVBC 3UTAD 1P3MA 3X1UA 3MGQD 4KGCD 3F6TA 5DNMB 5GT0A 3AZHA 5B40D 2XD1A 3X1SD 3AZKA 5AY8A 3RELB 4J8XC 3WAAA 1B67A 3WA9A 1P3PC 3H0MC 2NQBC 3AN2B 5CPKC 5BT1C 4LD9A 3O62B 1M1AA 3KXBD 5DNMA 5AVCB 5B1LA 5CP6D 3LJAB 3KUYB 1F66B 3B0BA 3EPHA 4YM6C 1KX5C 4NFTA 1ID3D 3LZ0C 1BFMA 3AN2A 1AOIA 4WU8B 3UTBB 3NQJA 3P5JB 3MVDB 1KU5A 1TZYD 4J8VD 2FFFB 3IP4C 1F66A 2BYKA 5GT3D 3LJAA 3R45B 5CPJD 3W96B 4XZQB 1P3OD 1U35B 3V9RA 3REKA 4XUJB 5DNMC 1KX3A 3AL0C 3W98A 1P3AD 3KWQD 3AZMB 5B0YD 3RELC 4WU8A 3UTBA 3EG5B 2RIQA 3MVDA 3REJB 4H9QA 5B33D 1P3FD 3B0CW 1F1EA 3WTPE 3O62C 4H9OB 3LZ1B 3MGRD 5B40A 3X1SA 1P3GB 5B31B 4JJNB 3KUYC 5AVCC 3LJAC 1M18C 3AZMA 4G91B 3AFAB 3B6FD 2FJ7D 5KDMB 3MNNC 1P3LC 2PYOA 3UTBC 5BO0A 4H9OA 3MGSD 1HQ3B 5B32A 5AVBD 5B31A 4QLCD 5AV8D 4JJNA 5AV9D 3W96C 3W97D 2JSSA 4XZQC 3B6GB 1U35C 3AZEB 1ID3A 4XUJC 5BS7C 1KX4A 3NQUB 5KDMA 4J8VA 4NE5A 3C1CC 1ZLAC 1P3PD 1EQZB 2NQBD 3AV1B 1P34D 3REJC 5CPKD 5BT1D 4J8UD 2DQNC 3LZ1C 3AZNA 4X23D 4ZUXC 3KWQA 1P3GC 1P3MD 3NQUA 3X1UD 1N1JA 2BYMB 3B0CT 2YFVB 5AV5A 1KX5D 3AZHD 2Y2NA 3AFAC 3LZ0D 1BH8B 4KUDA 5B2JB 3AZIC 5B0ZB 1WWSA 3WAAD 2Y2HA 1P3IB 1HQ3C 5G49B 2F8NG 3B6GC 2YFVA 5DNMD 3AZEC 5B1MB 2ZY4A 5CPIA 4Z5TB 1BH8A 3MGSA 5B2JA 5B0ZA 5AVBA 1EQZC 1S32B 3AV1C 3AN2D 3AZJB 2ZY2A 3X1VB 1F66D 1R4VA 5AVCD 3LJAD 4J8XA 4Z5TA 3W99B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3REK D;  1P3P A;  2NQB A;  5CPK A;  3W98 D;  2L5A A;  3UTB D;  4WU8 D;  5B0Z C;  3MVD D;  4Z66 B;  4YM6 A;  1P3I C;  3UT9 C;  3AZG B;  1KX5 A;  3W96 D;  1Q9C A;  4XZQ D;  3AZL B;  1U35 D;  3W99 A;  4CAY A;  3TU4 B;  3LZ0 A;  2CV5 C;  4J8W C;  5B1M C;  4R8P B;  3VH5 W;  3AZM D;  4Z5T C;  4ZBJ C;  2HIO B;  1S32 C;  2PYO D;  5FUG B;  4EO5 B;  3AZJ C;  1M18 B;  5B32 D;  1P3G D;  5B31 D;  3X1V C;  4JJN D;  3REL A;  1P3B B;  4AWL B;  1M19 C;  5B2I B;  3W99 C;  3MNN B;  3AFA D;  1P3L B;  1KX4 D;  3O62 A;  3LEL B;  5FUG A;  3KUY A;  5AVC A;  1M18 A;  4Z66 C;  5DNN B;  3VH6 W;  1TAF B;  3AZG C;  3B6G D;  3AZL C;  3AZN D;  3TU4 C;  3MNN A;  5E5A B;  1P3L A;  3C1C B;  1ZLA B;  4R8P C;  5AV5 D;  4WU9 B;  3REI B;  2HIO C;  3R45 A;  4H9N B;  3W96 A;  3AV1 D;  4XZQ A;  4KUD D;  1U35 A;  4WNN B;  4ZUX B;  3WKJ C;  1TAF A;  4XUJ A;  3UTA B;  5BS7 A;  4EO5 C;  1JFI B;  4UUZ B;  5E5A A;  1P3B C;  3C1C A;  1ZLA A;  4AWL C;  5B2I C;  3REJ A;  5B24 B;  3AZI B;  2RVQ C;  5CPI D;  3LEL C;  3LZ1 A;  5B2J D;  4WNN A;  5B0Z D;  4ZUX A;  3X1T C;  1P3G A;  2F8N K;  2HUE B;  2F8N H;  3KXB B;  5DNN C;  4H9S C;  4M6B A;  4G92 C;  3AFA A;  3C1B B;  3AZI A;  4J8X D;  5E5A C;  4Z5T D;  5AV6 C;  1HQ3 A;  4WU9 C;  3REI C;  1S32 D;  5BNV B;  3B6G A;  3AZE A;  3AV2 B;  2NZD B;  3UTA C;  4YM6 D;  3MGQ C;  3X1V D;  4KGC C;  3W99 D;  1P3A B;  1EQZ A;  3AV1 A;  5B24 C;  1BH9 B;  2F8N B;  5BNV A;  3UT9 B;  4Z2M G;  5B33 B;  3AYW B;  3VH5 A;  1P3F B;  2NZD A;  4Z66 D;  2HUE C;  2BYM A;  3KXB C;  2CV5 B;  4J8W B;  5CP6 C;  4CSR B;  3MGP B;  3AZL D;  2ARO B;  3C1B C;  3REL D;  4ZBJ B;  4R8P D;  2IO5 B;  2F8N A;  1P3I A;  3UT9 A;  3AYW A;  2HIO D;  5G49 A;  3WTP B;  3O62 D;  3AZF B;  5GSU B;  1TZY C;  4WV4 B;  2CV5 A;  3REH B;  4QLC B;  3KUY D;  4J8W A;  5B1M A;  5GT3 C;  4CSR A;  3AV2 C;  2NZD C;  3A6N B;  5GXQ B;  5CPJ C;  4YS3 B;  1P3O C;  1M19 B;  1M18 D;  5F99 B;  3W97 B;  3KSY A;  5B2I D;  1P3A C;  3VH6 A;  4H9P B;  1S32 A;  3MNN D;  5B0Y C;  1P3L D;  3AZF A;  3AZJ A;  3LEL D;  2LY8 A;  3REH A;  3X1V A;  3AYW C;  5B33 C;  1P3F C;  5GXQ A;  4YS3 A;  1M19 A;  5JRG B;  4XUJ D;  3MGP C;  2ARO C;  5GT0 B;  5E5A D;  3AZH B;  4H9R B;  3C1C D;  1ZLA D;  2IO5 C;  3AZK B;  5AY8 B;  4Z66 A;  3REJ D;  2FJ7 C;  4WU9 D;  3WAA B;  3WKJ B;  3WTP C;  3AZF C;  3AZG A;  3WA9 B;  3LZ1 D;  5JRG A;  3AZL A;  5GSU C;  4ZUX D;  4E44 A;  3TU4 A;  4LD9 B;  3REH C;  4QLC C;  5AV8 C;  5AV9 C;  1M1A B;  1A7W A;  4R8P A;  3A6N C;  5GXQ C;  3W97 C;  4YS3 C;  5F99 C;  5B1L B;  4H9R A;  2HIO A;  5B24 D;  3AZI D;  3WKJ A;  3X1T B;  3B0D B;  5CHL B;  1P34 C;  1P3K B;  1HQ3 D;  1AOI B;  3NQJ B;  4J8U C;  4G92 B;  1P3B A;  5B2I A;  5JRG C;  3AZE D;  4X23 C;  2BYK B;  4NE3 A;  1P3M C;  5C3I B;  3X1U C;  3V9R B;  3C1B D;  3LEL A;  3REK B;  5AV6 B;  1WWI A;  5GT0 C;  3X1T A;  3AZH C;  1KX3 B;  3W98 B;  1EQZ D;  3AZK C;  5AY8 C;  1P3K A;  3VH5 T;  5DNN A;  4H9S A;  3WAA C;  3WA9 C;  3MGQ B;  4DRA A;  3AV2 D;  4H9Q B;  4KGC B;  2NZD D;  4LD9 C;  4WZS B;  5B40 B;  1M1A C;  5AV6 A;  3X1S B;  5JA4 B;  5B1L C;  4WU9 A;  2CWE A;  3REI A;  4H9N A;  1H3O B;  4Z2M H;  3UTA A;  3B0D C;  1JFI A;  2F8N D;  1P3I D;  3MGQ A;  3UT9 D;  3AYW D;  3AN2 C;  1P3K C;  2PYO B;  4UUZ A;  1AOI C;  4KGC A;  5BO0 B;  5CP6 B;  5B32 B;  5JA4 A;  2CV5 D;  1F66 C;  4J8W D;  5B1M D;  5B24 A;  3MGP D;  2ARO D;  5C3I C;  3VH6 T;  5B32 G;  1ID3 B;  5B31 G;  3REK C;  1H3O A;  4E45 A;  1KX4 B;  1KX3 C;  3W98 C;  1TZY B;  4HGA B;  4J8V B;  3KXB A;  4WU8 C;  3WTP D;  3AZF D;  3AZJ D;  5GT3 B;  5CP6 A;  1B6W A;  5CPJ B;  5GSU D;  3MVD C;  1P3O B;  3C1B A;  3REH D;  3A6N D;  5GXQ D;  4YS3 D;  1M19 D;  3AZN B;  5F99 D;  5B40 C;  3KWQ B;  3X1S C;  4KHA B;  5B0Y B;  1ULY A;  1N1J B;  3AZM C;  1TZY A;  5AV5 B;  3AV2 A;  5GT3 A;  5CPJ A;  1P3O A;  4KUD B;  3MGR B;  2PYO C;  3AZG D;  5JRG D;  3TU4 D;  1P3A A;  5B32 C;  4KHA A;  5B31 C;  4JJN C;  5B0Y A;  1BH9 A;  3B6F B;  2FJ7 B;  1ID3 C;  5GT0 D;  4G91 C;  1HTA A;  5B33 A;  1P3F A;  5CPI B;  1KX4 C;  3AZK D;  5AY8 D;  3MGS B;  3MGR A;  4HGA C;  4J8V C;  3WKJ D;  5AVB B;  5AV8 B;  5AV9 B;  3WA9 D;  3MGP A;  2ARO A;  4LD9 D;  1P3B D;  2YFW B;  1M1A D;  3B6F A;  3AZN C;  2FJ7 A;  5B1L D;  3KWQ C;  2RVQ D;  4J8X B;  3WTP A;  1P3P B;  2NQB B;  5GSU A;  1P34 B;  5AV5 C;  5CPK B;  3X1T D;  4QLC A;  5AV8 A;  4J8U B;  5AV9 A;  5BNX B;  3W97 A;  3A6N A;  1P3K D;  4KUD C;  3MGR C;  1AOI D;  5F99 A;  5DNN D;  4X23 B;  2YFW A;  1P3M B;  4YM6 B;  3X1U B;  4NE6 A;  4H9P A;  1KX5 B;  4DRB A;  4CAY B;  5AV6 D;  3LZ0 B;  3B6F C;  1P34 A;  4J8U A;  1KX3 D;  3REI D;  5CPI C;  5BNX A;  3MGS C;  5B2J C;  4X23 A;  5AVB C;  3UTA D;  1P3M A;  3X1U A;  3MGQ D;  4KGC D;  5DNM B;  5GT0 A;  3AZH A;  5B40 D;  3X1S D;  3AZK A;  5AY8 A;  3REL B;  4J8X C;  3WAA A;  1B67 A;  3WA9 A;  1P3P C;  2NQB C;  3AN2 B;  5CPK C;  5BT1 C;  4LD9 A;  3O62 B;  1M1A A;  3KXB D;  5DNM A;  5AVC B;  5B1L A;  5CP6 D;  3LJA B;  3KUY B;  1F66 B;  3B0B A;  4YM6 C;  1KX5 C;  4NFT A;  1ID3 D;  3LZ0 C;  1BFM A;  3AN2 A;  1AOI A;  4WU8 B;  3UTB B;  3NQJ A;  3MVD B;  1KU5 A;  1TZY D;  4J8V D;  1F66 A;  2BYK A;  5GT3 D;  3LJA A;  3R45 B;  5CPJ D;  3W96 B;  4XZQ B;  1P3O D;  1U35 B;  3V9R A;  3REK A;  4XUJ B;  5DNM C;  1KX3 A;  3W98 A;  1P3A D;  3KWQ D;  3AZM B;  5B0Y D;  3REL C;  4WU8 A;  3UTB A;  3MVD A;  3REJ B;  4H9Q A;  5B33 D;  1P3F D;  3WTP E;  1F1E A;  3B0C W;  3O62 C;  4H9O B;  3LZ1 B;  3MGR D;  5B40 A;  3X1S A;  1P3G B;  5B31 B;  4JJN B;  3KUY C;  5AVC C;  3LJA C;  1M18 C;  3AZM A;  4G91 B;  3AFA B;  3B6F D;  2FJ7 D;  5KDM B;  3MNN C;  1P3L C;  2PYO A;  3UTB C;  5BO0 A;  4H9O A;  3MGS D;  1HQ3 B;  5B32 A;  5AVB D;  5B31 A;  4QLC D;  5AV8 D;  4JJN A;  5AV9 D;  3W96 C;  3W97 D;  2JSS A;  4XZQ C;  3B6G B;  1U35 C;  3AZE B;  1ID3 A;  4XUJ C;  5BS7 C;  1KX4 A;  3NQU B;  5KDM A;  4J8V A;  4NE5 A;  3C1C C;  1ZLA C;  1P3P D;  1EQZ B;  2NQB D;  3AV1 B;  1P34 D;  3REJ C;  5CPK D;  5BT1 D;  4J8U D;  3LZ1 C;  3AZN A;  4X23 D;  4ZUX C;  3KWQ A;  1P3G C;  1P3M D;  3X1U D;  3NQU A;  1N1J A;  2BYM B;  3B0C T;  2YFV B;  5AV5 A;  1KX5 D;  3AZH D;  3AFA C;  3LZ0 D;  1BH8 B;  4KUD A;  5B2J B;  3AZI C;  5B0Z B;  1WWS A;  3WAA D;  1P3I B;  1HQ3 C;  5G49 B;  2F8N G;  3B6G C;  2YFV A;  5DNM D;  3AZE C;  5B1M B;  5CPI A;  4Z5T B;  1BH8 A;  3MGS A;  5B2J A;  5B0Z A;  5AVB A;  1EQZ C;  1S32 B;  3AV1 C;  3AN2 D;  3AZJ B;  3X1V B;  1F66 D;  1R4V A;  5AVC D;  3LJA D;  4J8X A;  4Z5T A;  3W99 B; 
#chains in the Genus database with same CATH topology
 3REK D;  1P3P A;  2NQB A;  5CPK A;  2JE5 A;  3W98 D;  2L5A A;  3UTB D;  4WU8 D;  5B0Z C;  3MVD D;  4Z66 B;  4YM6 A;  2J8P A;  1P3I C;  3UT9 C;  3FDD A;  3AZG B;  1KX5 A;  3W96 D;  1Q9C A;  4XZQ D;  3AZL B;  1U35 D;  3W99 A;  4CAY A;  3TU4 B;  3LZ0 A;  2CV5 C;  4J8W C;  5B1M C;  4R8P B;  3VH5 W;  3AZM D;  4Z5T C;  2Y2G A;  4ZBJ C;  2VQR A;  2HIO B;  1S32 C;  2PYO D;  5FUG B;  4EO5 B;  3AZJ C;  1M18 B;  5B32 D;  1P3G D;  5B31 D;  3X1V C;  4JJN D;  3REL A;  1P3B B;  4AWL B;  1M19 C;  5B2I B;  3W99 C;  2ZY3 A;  1T3U A;  3MNN B;  3AFA D;  1P3L B;  1KX4 D;  3O62 A;  3LEL B;  2XD5 A;  5FUG A;  3KUY A;  5AVC A;  1PZR A;  1M18 A;  4Z66 C;  3EPJ A;  5DNN B;  3VH6 W;  1TAF B;  3AZG C;  3B6G D;  3AZL C;  3AZN D;  3TU4 C;  3MNN A;  5E5A B;  1P3L A;  3C1C B;  1ZLA B;  4R8P C;  5AV5 D;  4WU9 B;  2ZY5 A;  3REI B;  2HIO C;  3R45 A;  4H9N B;  3W96 A;  3AV1 D;  4XZQ A;  4KUD D;  1U35 A;  4WNN B;  4ZUX B;  3WKJ C;  1TAF A;  4XUJ A;  3UTA B;  5BS7 A;  4EO5 C;  1JFI B;  4UUZ B;  5E5A A;  1P3B C;  3C1C A;  1ZLA A;  4AWL C;  5B2I C;  3REJ A;  5B24 B;  3AZI B;  2RVQ C;  5CPI D;  3LEL C;  3LZ1 A;  4UPK A;  5B2J D;  4WNN A;  1W2E A;  5B0Z D;  4ZUX A;  3X1T C;  1P3G A;  2F8N K;  4WJ3 C;  2HUE B;  2F8N H;  3KXB B;  5DNN C;  4H9S C;  4M6B A;  4G92 C;  3AFA A;  3C1B B;  3AZI A;  4J8X D;  5E5A C;  2F2A C;  4Z5T D;  5AV6 C;  1HQ3 A;  4WU9 C;  3REI C;  1S32 D;  5BNV B;  3B6G A;  2ZM5 A;  3AZE A;  3AV2 B;  2NZD B;  3UTA C;  3A1I A;  4YM6 D;  3MGQ C;  3X1V D;  4KGC C;  3W99 D;  1P3A B;  1EQZ A;  3AV1 A;  5B24 C;  1BH9 B;  3EPK A;  2F8N B;  5BNV A;  3UT9 B;  4Z2M G;  5B33 B;  3AYW B;  3VH5 A;  1P3F B;  2NZD A;  4Z66 D;  2HUE C;  2BYM A;  3KXB C;  2CV5 B;  4J8W B;  5CP6 C;  4CSR B;  3MGP B;  3AZL D;  2ARO B;  3C1B C;  2Y2L A;  3REL D;  4ZBJ B;  4R8P D;  2IO5 B;  2F8N A;  1P3I A;  3UT9 A;  3AYW A;  2HIO D;  5G49 A;  3WTP B;  2JCH A;  3O62 D;  3AZF B;  5GSU B;  1TZY C;  1Z2C B;  4WV4 B;  2CV5 A;  2Y2M A;  4QLC B;  3KUY D;  4J8W A;  5B1M A;  5GT3 C;  4CSR A;  3REH B;  3AV2 C;  2NZD C;  3A6N B;  5GXQ B;  5CPJ C;  4YS3 B;  1P3O C;  1M19 B;  1M18 D;  5F99 B;  3W97 B;  2W8S A;  2G5H C;  3KSY A;  5B2I D;  1P3A C;  3VH6 A;  4H9P B;  1S32 A;  2Y2I A;  3MNN D;  5B0Y C;  1P3L D;  3AZF A;  3AZJ A;  3LEL D;  2Y2K A;  2LY8 A;  3REH A;  3X1V A;  3AYW C;  5B33 C;  1P3F C;  5GXQ A;  4YS3 A;  1M19 A;  5JRG B;  2Y2J A;  4XUJ D;  3MGP C;  2ARO C;  5GT0 B;  5E5A D;  3AZH B;  4H9R B;  3C1C D;  1ZLA D;  2IO5 C;  3AZK B;  5AY8 B;  4Z66 A;  3REJ D;  2FJ7 C;  4WU9 D;  2Y2Q A;  3WAA B;  3WKJ B;  3WTP C;  3AZF C;  3AZG A;  3WA9 B;  3LZ1 D;  5JRG A;  3AZL A;  5GSU C;  4ZUX D;  4E44 A;  3TU4 A;  4LD9 B;  3REH C;  4QLC C;  5AV8 C;  5AV9 C;  1M1A B;  1A7W A;  4R8P A;  3A6N C;  5GXQ C;  3W97 C;  4YS3 C;  5F99 C;  5B1L B;  4H9R A;  2HIO A;  5B24 D;  3AZI D;  3WKJ A;  3X1T B;  3B0D B;  5CHL B;  1P34 C;  1P3K B;  1HQ3 D;  1AOI B;  3NQJ B;  4J8U C;  4G92 B;  1P3B A;  2G5I C;  5B2I A;  5JRG C;  3AZE D;  4X23 C;  2BYK B;  4NE3 A;  2BG1 A;  2Y2P A;  1P3M C;  5C3I B;  3X1U C;  3V9R B;  3C1B D;  3LEL A;  3REK B;  5AV6 B;  1WWI A;  5GT0 C;  3X1T A;  3AZH C;  1KX3 B;  3W98 B;  1EQZ D;  3AZK C;  5AY8 C;  1P3K A;  3VH5 T;  5DNN A;  4H9S A;  3WAA C;  3WA9 C;  3MGQ B;  4DRA A;  3AV2 D;  4H9Q B;  4KGC B;  2NZD D;  4LD9 C;  4WZS B;  5B40 B;  1M1A C;  5AV6 A;  3X1S B;  5JA4 B;  5B1L C;  4WU9 A;  2CWE A;  3REI A;  4H9N A;  1H3O B;  2DF4 C;  4Z2M H;  3KFU G;  3UTA A;  3B0D C;  1JFI A;  2F8N D;  1P3I D;  3MGQ A;  3UT9 D;  3AYW D;  3AN2 C;  1P3K C;  2PYO B;  4UUZ A;  1AOI C;  4KGC A;  5BO0 B;  3H0L C;  5CP6 B;  5B32 B;  5JA4 A;  2CV5 D;  1F66 C;  4J8W D;  5B1M D;  5B24 A;  3MGP D;  2ARO D;  5C3I C;  3VH6 T;  5B32 G;  1ID3 B;  5B31 G;  4DQY B;  1H3O A;  3REK C;  4E45 A;  1KX4 B;  1KX3 C;  3W98 C;  1TZY B;  4HGA B;  4J8V B;  3KXB A;  4WU8 C;  3WTP D;  3AZF D;  3AZJ D;  5GT3 B;  5CP6 A;  1B6W A;  5CPJ B;  5GSU D;  3MVD C;  1P3O B;  3C1B A;  3REH D;  3A6N D;  5GXQ D;  4YS3 D;  1M19 D;  3AZN B;  5F99 D;  5B40 C;  3KWQ B;  3X1S C;  4KHA B;  5B0Y B;  1ULY A;  1N1J B;  3AZM C;  1TZY A;  5AV5 B;  3AV2 A;  5GT3 A;  5CPJ A;  1P3O A;  4KUD B;  3MGR B;  3A1K A;  2PYO C;  3AZG D;  5JRG D;  3TU4 D;  1P3A A;  5B32 C;  2UWX A;  4KHA A;  5B31 C;  4JJN C;  5B0Y A;  1BH9 A;  3B6F B;  2FJ7 B;  1ID3 C;  5GT0 D;  4G91 C;  1HTA A;  5B33 A;  1P3F A;  5CPI B;  1KX4 C;  3AZK D;  5AY8 D;  3MGS B;  3MGR A;  4HGA C;  4J8V C;  3WKJ D;  5AVB B;  5AV8 B;  5AV9 B;  3WA9 D;  3MGP A;  2ARO A;  4LD9 D;  2Y2O A;  3EPL A;  1P3B D;  2YFW B;  1M1A D;  3B6F A;  3AZN C;  2FJ7 A;  5B1L D;  3KWQ C;  2RVQ D;  4J8X B;  3WTP A;  3H0R C;  1P3P B;  2NQB B;  5GSU A;  1P34 B;  5AV5 C;  5CPK B;  3X1T D;  4QLC A;  5AV8 A;  4J8U B;  5AV9 A;  5BNX B;  3W97 A;  3A6N A;  1P3K D;  4KUD C;  3MGR C;  1AOI D;  5F99 A;  5DNN D;  4X23 B;  2YFW A;  1P3M B;  4YM6 B;  3X1U B;  4NE6 A;  4H9P A;  1KX5 B;  4DRB A;  4CAY B;  5AV6 D;  3LZ0 B;  3B6F C;  1P34 A;  4J8U A;  1KX3 D;  3REI D;  5CPI C;  5BNX A;  3MGS C;  5B2J C;  4X23 A;  5AVB C;  3UTA D;  1P3M A;  3X1U A;  3MGQ D;  4KGC D;  3F6T A;  5DNM B;  5GT0 A;  3AZH A;  5B40 D;  2XD1 A;  3X1S D;  3AZK A;  5AY8 A;  3REL B;  4J8X C;  3WAA A;  1B67 A;  3WA9 A;  1P3P C;  3H0M C;  2NQB C;  3AN2 B;  5CPK C;  5BT1 C;  4LD9 A;  3O62 B;  1M1A A;  3KXB D;  5DNM A;  5AVC B;  5B1L A;  5CP6 D;  3LJA B;  3KUY B;  1F66 B;  3B0B A;  3EPH A;  4YM6 C;  1KX5 C;  4NFT A;  1ID3 D;  3LZ0 C;  1BFM A;  3AN2 A;  1AOI A;  4WU8 B;  3UTB B;  3NQJ A;  3P5J B;  3MVD B;  1KU5 A;  1TZY D;  4J8V D;  2FFF B;  3IP4 C;  1F66 A;  2BYK A;  5GT3 D;  3LJA A;  3R45 B;  5CPJ D;  3W96 B;  4XZQ B;  1P3O D;  1U35 B;  3V9R A;  3REK A;  4XUJ B;  5DNM C;  1KX3 A;  3AL0 C;  3W98 A;  1P3A D;  3KWQ D;  3AZM B;  5B0Y D;  3REL C;  4WU8 A;  3UTB A;  3EG5 B;  2RIQ A;  3MVD A;  3REJ B;  4H9Q A;  5B33 D;  1P3F D;  3B0C W;  1F1E A;  3WTP E;  3O62 C;  4H9O B;  3LZ1 B;  3MGR D;  5B40 A;  3X1S A;  1P3G B;  5B31 B;  4JJN B;  3KUY C;  5AVC C;  3LJA C;  1M18 C;  3AZM A;  4G91 B;  3AFA B;  3B6F D;  2FJ7 D;  5KDM B;  3MNN C;  1P3L C;  2PYO A;  3UTB C;  5BO0 A;  4H9O A;  3MGS D;  1HQ3 B;  5B32 A;  5AVB D;  5B31 A;  4QLC D;  5AV8 D;  4JJN A;  5AV9 D;  3W96 C;  3W97 D;  2JSS A;  4XZQ C;  3B6G B;  1U35 C;  3AZE B;  1ID3 A;  4XUJ C;  5BS7 C;  1KX4 A;  3NQU B;  5KDM A;  4J8V A;  4NE5 A;  3C1C C;  1ZLA C;  1P3P D;  1EQZ B;  2NQB D;  3AV1 B;  1P34 D;  3REJ C;  5CPK D;  5BT1 D;  4J8U D;  2DQN C;  3LZ1 C;  3AZN A;  4X23 D;  4ZUX C;  3KWQ A;  1P3G C;  1P3M D;  3NQU A;  3X1U D;  1N1J A;  2BYM B;  3B0C T;  2YFV B;  5AV5 A;  1KX5 D;  3AZH D;  2Y2N A;  3AFA C;  3LZ0 D;  1BH8 B;  4KUD A;  5B2J B;  3AZI C;  5B0Z B;  1WWS A;  3WAA D;  2Y2H A;  1P3I B;  1HQ3 C;  5G49 B;  2F8N G;  3B6G C;  2YFV A;  5DNM D;  3AZE C;  5B1M B;  2ZY4 A;  5CPI A;  4Z5T B;  1BH8 A;  3MGS A;  5B2J A;  5B0Z A;  5AVB A;  1EQZ C;  1S32 B;  3AV1 C;  3AN2 D;  3AZJ B;  2ZY2 A;  3X1V B;  1F66 D;  1R4V A;  5AVC D;  3LJA D;  4J8X A;  4Z5T A;  3W99 B; 
#chains in the Genus database with same CATH homology
 3REK D;  1P3P A;  2NQB A;  5CPK A;  2JE5 A;  3W98 D;  2L5A A;  3UTB D;  4WU8 D;  5B0Z C;  3MVD D;  4Z66 B;  4YM6 A;  2J8P A;  1P3I C;  3UT9 C;  3FDD A;  3AZG B;  1KX5 A;  3W96 D;  1Q9C A;  4XZQ D;  3AZL B;  1U35 D;  3W99 A;  4CAY A;  3TU4 B;  3LZ0 A;  2CV5 C;  4J8W C;  5B1M C;  4R8P B;  3VH5 W;  3AZM D;  4Z5T C;  2Y2G A;  4ZBJ C;  2VQR A;  2HIO B;  1S32 C;  2PYO D;  5FUG B;  4EO5 B;  3AZJ C;  1M18 B;  5B32 D;  1P3G D;  5B31 D;  3X1V C;  4JJN D;  3REL A;  1P3B B;  4AWL B;  1M19 C;  5B2I B;  3W99 C;  2ZY3 A;  1T3U A;  3MNN B;  3AFA D;  1P3L B;  1KX4 D;  3O62 A;  3LEL B;  2XD5 A;  5FUG A;  3KUY A;  5AVC A;  1PZR A;  1M18 A;  4Z66 C;  3EPJ A;  5DNN B;  3VH6 W;  1TAF B;  3AZG C;  3B6G D;  3AZL C;  3AZN D;  3TU4 C;  3MNN A;  5E5A B;  1P3L A;  3C1C B;  1ZLA B;  4R8P C;  5AV5 D;  4WU9 B;  2ZY5 A;  3REI B;  2HIO C;  3R45 A;  4H9N B;  3W96 A;  3AV1 D;  4XZQ A;  4KUD D;  1U35 A;  4WNN B;  4ZUX B;  3WKJ C;  1TAF A;  4XUJ A;  3UTA B;  5BS7 A;  4EO5 C;  1JFI B;  4UUZ B;  5E5A A;  1P3B C;  3C1C A;  1ZLA A;  4AWL C;  5B2I C;  3REJ A;  5B24 B;  3AZI B;  2RVQ C;  5CPI D;  3LEL C;  3LZ1 A;  4UPK A;  5B2J D;  4WNN A;  1W2E A;  5B0Z D;  4ZUX A;  3X1T C;  1P3G A;  2F8N K;  4WJ3 C;  2HUE B;  2F8N H;  3KXB B;  5DNN C;  4H9S C;  4M6B A;  4G92 C;  3AFA A;  3C1B B;  3AZI A;  4J8X D;  5E5A C;  2F2A C;  4Z5T D;  5AV6 C;  1HQ3 A;  4WU9 C;  3REI C;  1S32 D;  5BNV B;  3B6G A;  2ZM5 A;  3AZE A;  3AV2 B;  2NZD B;  3UTA C;  3A1I A;  4YM6 D;  3MGQ C;  3X1V D;  4KGC C;  3W99 D;  1P3A B;  1EQZ A;  3AV1 A;  5B24 C;  1BH9 B;  3EPK A;  2F8N B;  5BNV A;  3UT9 B;  4Z2M G;  5B33 B;  3AYW B;  3VH5 A;  1P3F B;  2NZD A;  4Z66 D;  2HUE C;  2BYM A;  3KXB C;  2CV5 B;  4J8W B;  5CP6 C;  4CSR B;  3MGP B;  3AZL D;  2ARO B;  3C1B C;  2Y2L A;  3REL D;  4ZBJ B;  4R8P D;  2IO5 B;  2F8N A;  1P3I A;  3UT9 A;  3AYW A;  2HIO D;  5G49 A;  3WTP B;  2JCH A;  3O62 D;  3AZF B;  5GSU B;  1TZY C;  1Z2C B;  4WV4 B;  2CV5 A;  2Y2M A;  4QLC B;  3KUY D;  4J8W A;  5B1M A;  5GT3 C;  4CSR A;  3REH B;  3AV2 C;  2NZD C;  3A6N B;  5GXQ B;  5CPJ C;  4YS3 B;  1P3O C;  1M19 B;  1M18 D;  5F99 B;  3W97 B;  2W8S A;  2G5H C;  3KSY A;  5B2I D;  1P3A C;  3VH6 A;  4H9P B;  1S32 A;  2Y2I A;  3MNN D;  5B0Y C;  1P3L D;  3AZF A;  3AZJ A;  3LEL D;  2Y2K A;  2LY8 A;  3REH A;  3X1V A;  3AYW C;  5B33 C;  1P3F C;  5GXQ A;  4YS3 A;  1M19 A;  5JRG B;  2Y2J A;  4XUJ D;  3MGP C;  2ARO C;  5GT0 B;  5E5A D;  3AZH B;  4H9R B;  3C1C D;  1ZLA D;  2IO5 C;  3AZK B;  5AY8 B;  4Z66 A;  3REJ D;  2FJ7 C;  4WU9 D;  2Y2Q A;  3WAA B;  3WKJ B;  3WTP C;  3AZF C;  3AZG A;  3WA9 B;  3LZ1 D;  5JRG A;  3AZL A;  5GSU C;  4ZUX D;  4E44 A;  3TU4 A;  4LD9 B;  3REH C;  4QLC C;  5AV8 C;  5AV9 C;  1M1A B;  1A7W A;  4R8P A;  3A6N C;  5GXQ C;  3W97 C;  4YS3 C;  5F99 C;  5B1L B;  4H9R A;  2HIO A;  5B24 D;  3AZI D;  3WKJ A;  3X1T B;  3B0D B;  5CHL B;  1P34 C;  1P3K B;  1HQ3 D;  1AOI B;  3NQJ B;  4J8U C;  4G92 B;  1P3B A;  2G5I C;  5B2I A;  5JRG C;  3AZE D;  4X23 C;  2BYK B;  4NE3 A;  2BG1 A;  2Y2P A;  1P3M C;  5C3I B;  3X1U C;  3V9R B;  3C1B D;  3LEL A;  3REK B;  5AV6 B;  1WWI A;  5GT0 C;  3X1T A;  3AZH C;  1KX3 B;  3W98 B;  1EQZ D;  3AZK C;  5AY8 C;  1P3K A;  3VH5 T;  5DNN A;  4H9S A;  3WAA C;  3WA9 C;  3MGQ B;  4DRA A;  3AV2 D;  4H9Q B;  4KGC B;  2NZD D;  4LD9 C;  4WZS B;  5B40 B;  1M1A C;  5AV6 A;  3X1S B;  5JA4 B;  5B1L C;  4WU9 A;  2CWE A;  3REI A;  4H9N A;  1H3O B;  2DF4 C;  4Z2M H;  3KFU G;  3UTA A;  3B0D C;  1JFI A;  2F8N D;  1P3I D;  3MGQ A;  3UT9 D;  3AYW D;  3AN2 C;  1P3K C;  2PYO B;  4UUZ A;  1AOI C;  4KGC A;  5BO0 B;  3H0L C;  5CP6 B;  5B32 B;  5JA4 A;  2CV5 D;  1F66 C;  4J8W D;  5B1M D;  5B24 A;  3MGP D;  2ARO D;  5C3I C;  3VH6 T;  5B32 G;  1ID3 B;  5B31 G;  4DQY B;  1H3O A;  3REK C;  4E45 A;  1KX4 B;  1KX3 C;  3W98 C;  1TZY B;  4HGA B;  4J8V B;  3KXB A;  4WU8 C;  3WTP D;  3AZF D;  3AZJ D;  5GT3 B;  5CP6 A;  1B6W A;  5CPJ B;  5GSU D;  3MVD C;  1P3O B;  3C1B A;  3REH D;  3A6N D;  5GXQ D;  4YS3 D;  1M19 D;  3AZN B;  5F99 D;  5B40 C;  3KWQ B;  3X1S C;  4KHA B;  5B0Y B;  1ULY A;  1N1J B;  3AZM C;  1TZY A;  5AV5 B;  3AV2 A;  5GT3 A;  5CPJ A;  1P3O A;  4KUD B;  3MGR B;  3A1K A;  2PYO C;  3AZG D;  5JRG D;  3TU4 D;  1P3A A;  5B32 C;  2UWX A;  4KHA A;  5B31 C;  4JJN C;  5B0Y A;  1BH9 A;  3B6F B;  2FJ7 B;  1ID3 C;  5GT0 D;  4G91 C;  1HTA A;  5B33 A;  1P3F A;  5CPI B;  1KX4 C;  3AZK D;  5AY8 D;  3MGS B;  3MGR A;  4HGA C;  4J8V C;  3WKJ D;  5AVB B;  5AV8 B;  5AV9 B;  3WA9 D;  3MGP A;  2ARO A;  4LD9 D;  2Y2O A;  3EPL A;  1P3B D;  2YFW B;  1M1A D;  3B6F A;  3AZN C;  2FJ7 A;  5B1L D;  3KWQ C;  2RVQ D;  4J8X B;  3WTP A;  3H0R C;  1P3P B;  2NQB B;  5GSU A;  1P34 B;  5AV5 C;  5CPK B;  3X1T D;  4QLC A;  5AV8 A;  4J8U B;  5AV9 A;  5BNX B;  3W97 A;  3A6N A;  1P3K D;  4KUD C;  3MGR C;  1AOI D;  5F99 A;  5DNN D;  4X23 B;  2YFW A;  1P3M B;  4YM6 B;  3X1U B;  4NE6 A;  4H9P A;  1KX5 B;  4DRB A;  4CAY B;  5AV6 D;  3LZ0 B;  3B6F C;  1P34 A;  4J8U A;  1KX3 D;  3REI D;  5CPI C;  5BNX A;  3MGS C;  5B2J C;  4X23 A;  5AVB C;  3UTA D;  1P3M A;  3X1U A;  3MGQ D;  4KGC D;  3F6T A;  5DNM B;  5GT0 A;  3AZH A;  5B40 D;  2XD1 A;  3X1S D;  3AZK A;  5AY8 A;  3REL B;  4J8X C;  3WAA A;  1B67 A;  3WA9 A;  1P3P C;  3H0M C;  2NQB C;  3AN2 B;  5CPK C;  5BT1 C;  4LD9 A;  3O62 B;  1M1A A;  3KXB D;  5DNM A;  5AVC B;  5B1L A;  5CP6 D;  3LJA B;  3KUY B;  1F66 B;  3B0B A;  3EPH A;  4YM6 C;  1KX5 C;  4NFT A;  1ID3 D;  3LZ0 C;  1BFM A;  3AN2 A;  1AOI A;  4WU8 B;  3UTB B;  3NQJ A;  3P5J B;  3MVD B;  1KU5 A;  1TZY D;  4J8V D;  2FFF B;  3IP4 C;  1F66 A;  2BYK A;  5GT3 D;  3LJA A;  3R45 B;  5CPJ D;  3W96 B;  4XZQ B;  1P3O D;  1U35 B;  3V9R A;  3REK A;  4XUJ B;  5DNM C;  1KX3 A;  3AL0 C;  3W98 A;  1P3A D;  3KWQ D;  3AZM B;  5B0Y D;  3REL C;  4WU8 A;  3UTB A;  3EG5 B;  2RIQ A;  3MVD A;  3REJ B;  4H9Q A;  5B33 D;  1P3F D;  3B0C W;  1F1E A;  3WTP E;  3O62 C;  4H9O B;  3LZ1 B;  3MGR D;  5B40 A;  3X1S A;  1P3G B;  5B31 B;  4JJN B;  3KUY C;  5AVC C;  3LJA C;  1M18 C;  3AZM A;  4G91 B;  3AFA B;  3B6F D;  2FJ7 D;  5KDM B;  3MNN C;  1P3L C;  2PYO A;  3UTB C;  5BO0 A;  4H9O A;  3MGS D;  1HQ3 B;  5B32 A;  5AVB D;  5B31 A;  4QLC D;  5AV8 D;  4JJN A;  5AV9 D;  3W96 C;  3W97 D;  2JSS A;  4XZQ C;  3B6G B;  1U35 C;  3AZE B;  1ID3 A;  4XUJ C;  5BS7 C;  1KX4 A;  3NQU B;  5KDM A;  4J8V A;  4NE5 A;  3C1C C;  1ZLA C;  1P3P D;  1EQZ B;  2NQB D;  3AV1 B;  1P34 D;  3REJ C;  5CPK D;  5BT1 D;  4J8U D;  2DQN C;  3LZ1 C;  3AZN A;  4X23 D;  4ZUX C;  3KWQ A;  1P3G C;  1P3M D;  3NQU A;  3X1U D;  1N1J A;  2BYM B;  3B0C T;  2YFV B;  5AV5 A;  1KX5 D;  3AZH D;  2Y2N A;  3AFA C;  3LZ0 D;  1BH8 B;  4KUD A;  5B2J B;  3AZI C;  5B0Z B;  1WWS A;  3WAA D;  2Y2H A;  1P3I B;  1HQ3 C;  5G49 B;  2F8N G;  3B6G C;  2YFV A;  5DNM D;  3AZE C;  5B1M B;  2ZY4 A;  5CPI A;  4Z5T B;  1BH8 A;  3MGS A;  5B2J A;  5B0Z A;  5AVB A;  1EQZ C;  1S32 B;  3AV1 C;  3AN2 D;  3AZJ B;  2ZY2 A;  3X1V B;  1F66 D;  1R4V A;  5AVC D;  3LJA D;  4J8X A;  4Z5T A;  3W99 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...