4NE5A

Human mhf1-mhf2 complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
93
structure length
93
Chain Sequence
SYQQRLKAAVHYTVGCLCEEVALDKAMQFSKQTIAAISELTFRQCENFAKDLEMFARHAKRTTINTEDVKLLARRSNSLLKYITDKSEEIAQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Centromere protein S
publication title The MHF complex senses branched DNA by binding a pair of crossover DNA duplexes.
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 93
sequence length 93
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2013-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15630 CENP-S CENP-S protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4ne5A00
1M1AD 4EO5C 4Z2MH 3AZIA 1F66B 3KXBC 3AV1A 1KX4D 2YFVA 3KUYD 2NQBC 3B6FB 1M19D 3B6GD 1S32D 5AY8D 1BH8A 3X1VD 5B32A 3MNNA 5CPKB 5DNNA 5DNMA 1B6WA 3W98B 5AV5D 3RELA 1P3BD 4J8WD 4CAYB 1P3LC 3W96A 4KUDD 5BNXA 1P3GA 3X1SA 3MGSB 5GT3B 4G92B 4NE6A 1ZLAD 3NQUA 3W97B 4WNNA 4H9QA 5B31D 3WAAB 3UTBB 5B0YB 3A6ND 5B32C 3MNNC 3MGPA 2F8NB 5DNMC 5B2JA 4WU9B 1BFMA 3AZHC 3AV2B 3LJAC 3W96C 4JJNA 2HIOB 1P3GC 4Z5TB 4G91B 3X1SC 4YS3C 3W99D 3AZJA 5E5AD 5CPIA 4H9RB 3AZKB 5AV9B 3LELD 5AV8B 3AZMA 3MGPC 5JRGD 3NQJA 1JFIA 1P3AD 3VH6W 3WKJC 5CP6A 3REHA 3REJD 4AWLC 4EO5B 3KXBB 2FJ7A 3TU4C 4XUJA 2AROA 1BH9B 4J8UB 4H9PA 3LZ1A 3X1UA 1P3KD 5BT1D 2NQBB 4H9SA 5AVCA 3AZMC 1WWSA 1KX3D 1KX5D 4J8XA 4X23D 1M18D 1TZYD 5CP6C 5AV6D 3AFAA 3UT9D 1M1AA 3O62D 3WA9C 1P3LB 1KX4A 3KUYA 2AROC 3AZGD 4R8PD 3LZ1C 5B40D 4H9SC 1M19A 3B6GA 3KWQD 5JA4A 5AY8A 1BH8B 4UUZB 5B32B 3MNNB 3UTAC 3AFAC 5DNMB 1M1AC 2PYOD 5BO0A 5AV5A 3VH6T 5CPJD 4J8WA 1P3BA 3AZHB 2YFWA 1KX4C 3LJAB 3WTPD 3W96B 4KUDA 1P3GB 3X1SB 3MVDC 1ZLAA 3NQUB 4H9OB 4YS3B 1P3FC 2F8NH 1M19C 1ID3D 4H9QB 5F99D 2NZDD 3B6GC 5B31A 3AZLC 5AY8C 3A6NA 5B24D 3REIC 3MGPB 4ZUXD 5AV5C 3MGRD 3WKJB 4QLCD 4AWLB 1HQ3C 3MGQD 3TU4B 5B33D 3C1BD 3W99A 4KGCD 3VH5A 4H9NA 5GT0B 4WV4B 3LELA 5BS7A 3A6NC 5B1LC 3AZMB 1JFIB 2CV5B 3AN2C 1P3AA 5CP6B 3WTPE 4HGAC 5B1MD 3REJA 2BYMA 5G49A 3WA9B 4NFTA 1P3ID 2AROB 5BNVA 2LY8A 4H9PB 3LZ1B 1P3KA 5B2ID 3LELC 1KX3A 1KX5A 4XZQC 5B32G 4X23A 3AYWC 1P3AC 1M18A 3UTAB 1TZYA 3UT9A 5AV6A 3V9RB 3AFAB 3REJC 1M1AB 3AZNB 1A7WA 3AZED 1EQZC 3AZGA 4R8PA 1P3PD 5B40A 3MVDB 1AOIC 5BT1C 2BYKA 1P3FB 1P3OD 1M19B 3KWQA 3B6GB 4YM6C 1KX3C 1KX5C 3AZLB 5AY8B 3AZIC 1M18C 3AV1C 3REIB 5AV6C 2PYOA 4LD9A 5BO0B 5AV5B 5CPJA 2YFWB 1Q9CA 3WTPA 1HQ3B 2HUEC 1ID3A 2NZDA 3KWQC 4M6BA 5DNNC 3R45B 3RELC 3A6NB 5B1LB 5B24A 2F8NK 3W98D 2IO5B 4CSRB 2PYOC 4LD9C 3MGRA 3AN2B 5GXQD 5CPJC 4QLCA 1N1JA 4HGAB 3WTPC 3MGSD 5GT3D 3MGQA 5B33A 3C1BA 4KGCA 4H9NB 3AZFA 5B0YD 5FUGB 3LELB 5B2JC 2F8ND 5B24C 4WU9D 3AV2D 4XZQB 4JJNC 3MGRC 3AYWB 1P3AB 1H3OB 2HIOD 5B1MA 3REJB 4J8VD 3REKD 5G49B 3AZJC 3MGQC 5CPIC 5BNVB 1EQZB 4E45A 3AZFC 1AOIB 4YM6B 3REHC 1KX5B 3KSYA 3AZIB 1M18B 1WWIA 3AV1B 2YFVB 2FJ7C 5AV6B 4XUJC 5B1MC 3KXBD 3AZEA 3X1UC 4J8UD 1P3PA 5AVCC 1U35D 2NQBD 1S32A 1P3OA 3X1VA 4J8XC 4Z66D 5B31G 4DRAA 5DNNB 3KWQB 5C3IC 3RELB 3KUYC 2PYOB 1P3LD 5BNXB 4LD9B 5CPJB 3AZEC 3WTPB 4WNNB 2CWEA 4ZBJC 3C1CD 1S32C 5B0ZD 4NE5A 3X1VC 1TAFA 5AVBD 4E44A 1P3BC 5B2JB 5DNMD 4J8WC 3W98A 5B24B 3AZHD 4CAYA 4KUDC 4JJNB 3LJAD 5GXQA 3MGRB 5GSUD 1N1JB 1ZLAC 5GT3A 3AZJB 3MGQB 5E5AA 4YS3D 5CPIB 5B31C 4WU8D 3VH6A 3AZFB 3X1TD 5B0YA 5JRGA 3NQJB 2F8NA 3REHB 4WU9A 3WKJD 5GXQC 1F1EA 2FJ7B 2HIOA 4XUJB 3REKA 4J8VA 3W99C 3LZ0D 3TU4D 2L5AA 1KU5A 5E5AC 3X1UB 1P3MD 2JSSA 5CHLB 5AVCB 5GT0D 5BS7C 5JRGC 4J8XB 2CV5D 5C3IB 3O62A 1P34D 1KX4B 3WA9D 3KUYB 3REKC 4G91C 4J8VC 3AZEB 4J8UA 1P3KC 1U35A 4Z2MG 2NQBA 4ZBJB 5JA4B 1S32B 3X1VB 4Z66A 4X23C 1TZYC 3UT9C 1F66D 3UTAD 3O62C 3AFAD 4KHAA 4J8WB 1P3BB 3AZND 4KUDB 1P3LA 3AZGC 4R8PC 5B40C 1ZLAB 3B6FD 4J8UC 3MVDD 1U35C 5F99A 1P3FD 3C1CA 5KDMA 5B31B 5B0ZA 5CPKD 4Z66C 3AZLD 1TAFB 4ZUXA 4UUZA 5AVBA 3REID 3AZHA 3B0DC 2RVQD 3LJAA 5GXQB 5GSUA 3W97D 1HQ3D 3W99B 4H9OA 4YS3A 5E5AB 1ID3C 5F99C 3WAAD 2NZDC 3C1CC 3UTBD 5B0ZC 4WU8A 3X1TA 5JRGB 5B1LD 4ZUXC 5AVBC 4QLCC 3AN2D 3WKJA 4Z5TD 2BYMB 5GSUC 3C1BC 5B33C 3REKB 4J8VB 3LZ0A 1ULYA 3TU4A 1P3IA 4KGCC 1P3KB 3AZKD 5AV9D 5B2IA 1P3MA 5AV8D 5GT0A 4WU8C 3X1TC 3VH5W 1KX3B 4NE3A 4X23B 2CV5A 4XZQD 1TZYB 3UT9B 3AYWD 3O62B 1P34A 3B0CW 3WA9A 1P3IC 3LZ0C 3AZGB 4R8PB 1EQZD 5B40B 5B2IC 1P3MC 2BYKB 1AOID 1U35B 2HUEB 5GT0C 4YM6D 4Z66B 2CV5C 3AZID 1F66A 3UTAA 3AV1D 3V9RA 1P34C 4KHAB 3AZNA 3B0DB 1P3PC 3B6FA 3MVDA 1P3OC 1ID3B 5F99B 1P3FA 2NZDB 3C1CB 5KDMB 5B0ZB 5B32D 3MNND 5CPKA 5DNND 3AZLA 3VH5T 3RELD 4ZUXB 1F66C 5AVBB 3REIA 2F8NG 1R4VA 3W96D 4QLCB 4LD9D 3AZNC 1P3GD 3X1SD 3MGSA 3B0CT 5GSUB 3W97A 1HQ3A 5B33B 3C1BB 3B6FC 4KGCB 3WAAA 3UTBA 5CPKC 4WU8B 3MGPD 3X1TB 3R45A 3W98C 5B2JD 5B1LA 3AV2A 4CSRA 4JJND 3AN2A 5B1MB 4Z5TA 3MGSC 2RVQC 5GT3C 4G92C 3AZJD 3W97C 1P3IB 4H9RA 3LZ0B 5CPID 3WAAC 3AZKA 4DRBA 5AV9A 5B2IB 5AV8A 5B0YC 3UTBC 3AZFD 1P3MB 3AZMD 5FUGA 4WU9C 3AV2C 5CP6D 3REHD 1HTAA 2IO5C 4XZQA 3B0BA 3AYWA 2HIOC 1H3OA 4Z5TC 3KXBA 2FJ7D 1P34B 4XUJD 2AROD 1BH9A 3LZ1D 3X1UD 1P3PB 1EQZA 5AVCD 3AZKC 5AV9C 5AV8C 4WZSB 1AOIA 1P3OB 1B67A 4J8XD 4YM6A
chains in the Genus database with same CATH superfamily
1M1AD 4EO5C 4Z2MH 3AZIA 1F66B 3KXBC 3AV1A 1KX4D 2YFVA 3KUYD 3EPLA 2NQBC 3B6FB 1M19D 3B6GD 1S32D 5AY8D 1BH8A 3X1VD 5B32A 3MNNA 5CPKB 5DNNA 5DNMA 1B6WA 3W98B 5AV5D 3RELA 1P3BD 4J8WD 4CAYB 1P3LC 3W96A 4KUDD 5BNXA 1P3GA 3X1SA 3MGSB 5GT3B 4G92B 4NE6A 1ZLAD 3NQUA 3W97B 4WNNA 4H9QA 5B31D 3WAAB 3UTBB 5B0YB 3A6ND 5B32C 3MNNC 2ZY4A 3MGPA 2F8NB 5DNMC 5B2JA 4WU9B 1BFMA 3AZHC 3AV2B 3LJAC 3W96C 4JJNA 2HIOB 1P3GC 4Z5TB 4G91B 3X1SC 4YS3C 3W99D 3AZJA 5E5AD 5CPIA 4H9RB 2W8SA 1Z2CB 2Y2HA 2Y2JA 3AZKB 5AV9B 2G5HC 3LELD 5AV8B 3H0RC 3AZMA 3MGPC 5JRGD 3NQJA 1JFIA 1P3AD 3VH6W 3WKJC 5CP6A 3REHA 3REJD 4AWLC 4EO5B 3KXBB 2FJ7A 3TU4C 4XUJA 2AROA 1BH9B 4J8UB 4H9PA 3LZ1A 3X1UA 1P3KD 5BT1D 2NQBB 4H9SA 5AVCA 3AZMC 1WWSA 1KX3D 1KX5D 4J8XA 4X23D 1M18D 1TZYD 5CP6C 5AV6D 3AFAA 3UT9D 1M1AA 3O62D 3WA9C 2Y2MA 1P3LB 1KX4A 3KUYA 2AROC 2Y2OA 3AZGD 4R8PD 3LZ1C 5B40D 4H9SC 1M19A 3B6GA 3KWQD 5JA4A 5AY8A 1BH8B 3H0LC 4UUZB 5B32B 3MNNB 3UTAC 3AFAC 5DNMB 1M1AC 2PYOD 5BO0A 5AV5A 3VH6T 5CPJD 4J8WA 2ZY2A 3AZHB 2YFWA 1P3BA 1KX4C 3LJAB 3WTPD 3W96B 4KUDA 1P3GB 3X1SB 2J8PA 3MVDC 1ZLAA 3NQUB 4H9OB 4YS3B 1P3FC 2F8NH 1M19C 1ID3D 4H9QB 5F99D 2NZDD 3B6GC 5B31A 3AZLC 5AY8C 3A6NA 5B24D 3REIC 3MGPB 4ZUXD 5AV5C 3MGRD 3WKJB 4QLCD 4AWLB 1HQ3C 3MGQD 3TU4B 5B33D 3C1BD 2Y2PA 3W99A 4KGCD 3VH5A 4H9NA 5GT0B 4WV4B 3LELA 5BS7A 3A6NC 5B1LC 3AZMB 1JFIB 2CV5B 3IP4C 3AN2C 1P3AA 5CP6B 3WTPE 4HGAC 5B1MD 3REJA 2BYMA 5G49A 3WA9B 4NFTA 1P3ID 2AROB 5BNVA 2LY8A 3P5JB 4H9PB 3LZ1B 1P3KA 5B2ID 3KFUG 3LELC 1KX3A 1KX5A 4XZQC 5B32G 4X23A 3AYWC 1P3AC 1M18A 3UTAB 1TZYA 3UT9A 5AV6A 3V9RB 3AFAB 3REJC 1M1AB 3AZNB 1A7WA 3AZED 1EQZC 3AZGA 4R8PA 1P3PD 5B40A 3MVDB 1AOIC 5BT1C 2BYKA 1P3FB 1P3OD 1M19B 3KWQA 3B6GB 4YM6C 1KX3C 1KX5C 3AZLB 5AY8B 3AZIC 1M18C 3AV1C 3REIB 5AV6C 2PYOA 4LD9A 5BO0B 5AV5B 5CPJA 2YFWB 1Q9CA 2XD1A 3WTPA 1HQ3B 2Y2QA 2HUEC 1ID3A 2NZDA 3KWQC 4M6BA 5DNNC 3R45B 3RELC 3A6NB 5B1LB 5B24A 2F8NK 3W98D 2IO5B 4CSRB 2PYOC 4LD9C 3MGRA 3AN2B 5GXQD 5CPJC 4QLCA 1N1JA 4HGAB 3WTPC 3MGSD 5GT3D 3MGQA 5B33A 3C1BA 4KGCA 4H9NB 3H0MC 3AZFA 5B0YD 5FUGB 3LELB 5B2JC 2F8ND 5B24C 4WU9D 4UPKA 3AV2D 4XZQB 4JJNC 3MGRC 3AYWB 1P3AB 1H3OB 2HIOD 5B1MA 3REJB 4J8VD 3REKD 5G49B 3AZJC 3MGQC 5CPIC 2DQNC 5BNVB 1EQZB 4E45A 3AZFC 1AOIB 2DF4C 4YM6B 3REHC 3EG5B 1KX5B 3KSYA 3AZIB 1M18B 1WWIA 3AV1B 2YFVB 2FJ7C 5AV6B 4XUJC 5B1MC 3KXBD 3AZEA 3X1UC 4J8UD 1P3PA 5AVCC 1U35D 2NQBD 1PZRA 1S32A 1P3OA 2Y2GA 4J8XC 3X1VA 4Z66D 5B31G 4DRAA 5DNNB 3KWQB 5C3IC 3RELB 2JCHA 2Y2IA 3KUYC 2PYOB 1P3LD 5BNXB 4LD9B 5CPJB 3AZEC 3WTPB 4WNNB 2CWEA 4ZBJC 3C1CD 3A1IA 1S32C 5B0ZD 4NE5A 3X1VC 1TAFA 5AVBD 4E44A 1P3BC 5B2JB 5DNMD 4J8WC 3W98A 5B24B 3AZHD 4CAYA 4KUDC 4JJNB 3LJAD 5GXQA 3MGRB 5GSUD 1N1JB 1ZLAC 5GT3A 3AZJB 3A1KA 5E5AA 4YS3D 3MGQB 5CPIB 5B31C 4WU8D 3VH6A 3AZFB 3X1TD 5B0YA 5JRGA 3NQJB 2F8NA 3REHB 4WU9A 3WKJD 5GXQC 1F1EA 2FJ7B 2HIOA 4XUJB 3REKA 4J8VA 3W99C 3LZ0D 3TU4D 2L5AA 1KU5A 2Y2NA 5E5AC 3X1UB 1P3MD 2JSSA 5CHLB 5AVCB 5GT0D 5BS7C 1T3UA 5JRGC 2Y2LA 4J8XB 2CV5D 5C3IB 3O62A 1P34D 1KX4B 3WA9D 3KUYB 3REKC 4G91C 4J8VC 3AZEB 2ZY5A 4J8UA 1P3KC 1U35A 2BG1A 4Z2MG 2NQBA 4ZBJB 5JA4B 1S32B 3X1VB 4Z66A 4X23C 1TZYC 3UT9C 1F66D 3UTAD 3O62C 3AFAD 4KHAA 4J8WB 1P3BB 4WJ3C 3AZND 4KUDB 1P3LA 3AZGC 4R8PC 5B40C 1ZLAB 3B6FD 4J8UC 3MVDD 2UWXA 1U35C 5F99A 1P3FD 3C1CA 5KDMA 5B31B 5B0ZA 5CPKD 2ZY3A 4Z66C 3AZLD 1TAFB 4ZUXA 4UUZA 5AVBA 3REID 2ZM5A 3AZHA 3B0DC 2RVQD 2RIQA 3LJAA 5GXQB 5GSUA 3W97D 1HQ3D 3W99B 4H9OA 4YS3A 5E5AB 1ID3C 5F99C 3WAAD 2NZDC 3C1CC 3UTBD 5B0ZC 4WU8A 3X1TA 2Y2KA 5JRGB 5B1LD 4ZUXC 5AVBC 4QLCC 3AN2D 3WKJA 4Z5TD 2BYMB 5GSUC 3C1BC 5B33C 3REKB 4J8VB 3LZ0A 1ULYA 3TU4A 1P3IA 4KGCC 1P3KB 2VQRA 5AV9D 5B2IA 3AZKD 5AV8D 1P3MA 5GT0A 4WU8C 3X1TC 3VH5W 1KX3B 4NE3A 4X23B 2CV5A 4XZQD 1TZYB 3UT9B 3AYWD 3O62B 1P34A 3FDDA 3B0CW 3WA9A 1P3IC 3LZ0C 3AZGB 4R8PB 1EQZD 5B40B 5B2IC 1P3MC 2BYKB 1AOID 1U35B 2HUEB 5GT0C 4DQYB 4YM6D 4Z66B 2CV5C 3AZID 1F66A 3UTAA 3AV1D 3V9RA 1P34C 4KHAB 3AZNA 2XD5A 3B0DB 1P3PC 3B6FA 3MVDA 1P3OC 1ID3B 2JE5A 5F99B 1P3FA 2NZDB 3C1CB 5KDMB 3AL0C 5B0ZB 5B32D 3MNND 5CPKA 5DNND 3AZLA 3VH5T 3RELD 4ZUXB 1F66C 5AVBB 3REIA 2F8NG 1R4VA 2F2AC 3W96D 4QLCB 4LD9D 3AZNC 1P3GD 3X1SD 3MGSA 3B0CT 5GSUB 3W97A 1HQ3A 5B33B 3C1BB 3B6FC 4KGCB 3EPJA 3WAAA 3UTBA 5CPKC 4WU8B 3MGPD 3X1TB 3F6TA 3R45A 3W98C 5B2JD 5B1LA 3AV2A 4CSRA 2FFFB 4JJND 3AN2A 5B1MB 4Z5TA 3MGSC 2RVQC 5GT3C 4G92C 3AZJD 3W97C 1P3IB 4H9RA 3LZ0B 5CPID 3EPKA 3WAAC 3AZKA 4DRBA 2G5IC 5AV9A 5B2IB 5AV8A 5B0YC 3UTBC 3AZFD 1P3MB 3AZMD 5FUGA 4WU9C 3AV2C 5CP6D 3REHD 1HTAA 2IO5C 4XZQA 3B0BA 3AYWA 2HIOC 1H3OA 4Z5TC 3KXBA 2FJ7D 1P34B 4XUJD 2AROD 1BH9A 1W2EA 3LZ1D 3X1UD 1P3PB 1EQZA 5AVCD 3AZKC 5AV9C 5AV8C 4WZSB 1AOIA 1P3OB 1B67A 4J8XD 3EPHA 4YM6A
chains in the Genus database with same CATH topology
1M1AD 4EO5C 4Z2MH 3AZIA 1F66B 3KXBC 3AV1A 1KX4D 2YFVA 3KUYD 3EPLA 2NQBC 3B6FB 1M19D 3B6GD 1S32D 5AY8D 1BH8A 3X1VD 5B32A 3MNNA 5CPKB 5DNNA 5DNMA 1B6WA 3W98B 5AV5D 3RELA 1P3BD 4J8WD 4CAYB 1P3LC 3W96A 4KUDD 5BNXA 1P3GA 3X1SA 3MGSB 5GT3B 4G92B 4NE6A 1ZLAD 3NQUA 3W97B 4WNNA 4H9QA 5B31D 3WAAB 3UTBB 5B0YB 3A6ND 5B32C 3MNNC 2ZY4A 3MGPA 2F8NB 5DNMC 5B2JA 4WU9B 1BFMA 3AZHC 3AV2B 3LJAC 3W96C 4JJNA 2HIOB 1P3GC 4Z5TB 4G91B 3X1SC 4YS3C 3W99D 3AZJA 5E5AD 5CPIA 4H9RB 2W8SA 1Z2CB 2Y2HA 2Y2JA 3AZKB 5AV9B 2G5HC 3LELD 5AV8B 3H0RC 3AZMA 3MGPC 5JRGD 3NQJA 1JFIA 1P3AD 3VH6W 3WKJC 5CP6A 3REHA 3REJD 4AWLC 4EO5B 3KXBB 2FJ7A 3TU4C 4XUJA 2AROA 1BH9B 4J8UB 4H9PA 3LZ1A 3X1UA 1P3KD 5BT1D 2NQBB 4H9SA 5AVCA 3AZMC 1WWSA 1KX3D 1KX5D 4J8XA 4X23D 1M18D 1TZYD 5CP6C 5AV6D 3AFAA 3UT9D 1M1AA 3O62D 3WA9C 2Y2MA 1P3LB 1KX4A 3KUYA 2AROC 2Y2OA 3AZGD 4R8PD 3LZ1C 5B40D 4H9SC 1M19A 3B6GA 3KWQD 5JA4A 5AY8A 1BH8B 3H0LC 4UUZB 5B32B 3MNNB 3UTAC 3AFAC 5DNMB 1M1AC 2PYOD 5BO0A 5AV5A 3VH6T 5CPJD 4J8WA 2ZY2A 3AZHB 2YFWA 1P3BA 1KX4C 3LJAB 3WTPD 3W96B 4KUDA 1P3GB 3X1SB 2J8PA 3MVDC 1ZLAA 3NQUB 4H9OB 4YS3B 1P3FC 2F8NH 1M19C 1ID3D 4H9QB 5F99D 2NZDD 3B6GC 5B31A 3AZLC 5AY8C 3A6NA 5B24D 3REIC 3MGPB 4ZUXD 5AV5C 3MGRD 3WKJB 4QLCD 4AWLB 1HQ3C 3MGQD 3TU4B 5B33D 3C1BD 2Y2PA 3W99A 4KGCD 3VH5A 4H9NA 5GT0B 4WV4B 3LELA 5BS7A 3A6NC 5B1LC 3AZMB 1JFIB 2CV5B 3IP4C 3AN2C 1P3AA 5CP6B 3WTPE 4HGAC 5B1MD 3REJA 2BYMA 5G49A 3WA9B 4NFTA 1P3ID 2AROB 5BNVA 2LY8A 3P5JB 4H9PB 3LZ1B 1P3KA 5B2ID 3KFUG 3LELC 1KX3A 1KX5A 4XZQC 5B32G 4X23A 3AYWC 1P3AC 1M18A 3UTAB 1TZYA 3UT9A 5AV6A 3V9RB 3AFAB 3REJC 1M1AB 3AZNB 1A7WA 3AZED 1EQZC 3AZGA 4R8PA 1P3PD 5B40A 3MVDB 1AOIC 5BT1C 2BYKA 1P3FB 1P3OD 1M19B 3KWQA 3B6GB 4YM6C 1KX3C 1KX5C 3AZLB 5AY8B 3AZIC 1M18C 3AV1C 3REIB 5AV6C 2PYOA 4LD9A 5BO0B 5AV5B 5CPJA 2YFWB 1Q9CA 2XD1A 3WTPA 1HQ3B 2Y2QA 2HUEC 1ID3A 2NZDA 3KWQC 4M6BA 5DNNC 3R45B 3RELC 3A6NB 5B1LB 5B24A 2F8NK 3W98D 2IO5B 4CSRB 2PYOC 4LD9C 3MGRA 3AN2B 5GXQD 5CPJC 4QLCA 1N1JA 4HGAB 3WTPC 3MGSD 5GT3D 3MGQA 5B33A 3C1BA 4KGCA 4H9NB 3H0MC 3AZFA 5B0YD 5FUGB 3LELB 5B2JC 2F8ND 5B24C 4WU9D 4UPKA 3AV2D 4XZQB 4JJNC 3MGRC 3AYWB 1P3AB 1H3OB 2HIOD 5B1MA 3REJB 4J8VD 3REKD 5G49B 3AZJC 3MGQC 5CPIC 2DQNC 5BNVB 1EQZB 4E45A 3AZFC 1AOIB 2DF4C 4YM6B 3REHC 3EG5B 1KX5B 3KSYA 3AZIB 1M18B 1WWIA 3AV1B 2YFVB 2FJ7C 5AV6B 4XUJC 5B1MC 3KXBD 3AZEA 3X1UC 4J8UD 1P3PA 5AVCC 1U35D 2NQBD 1PZRA 1S32A 1P3OA 2Y2GA 4J8XC 3X1VA 4Z66D 5B31G 4DRAA 5DNNB 3KWQB 5C3IC 3RELB 2JCHA 2Y2IA 3KUYC 2PYOB 1P3LD 5BNXB 4LD9B 5CPJB 3AZEC 3WTPB 4WNNB 2CWEA 4ZBJC 3C1CD 3A1IA 1S32C 5B0ZD 4NE5A 3X1VC 1TAFA 5AVBD 4E44A 1P3BC 5B2JB 5DNMD 4J8WC 3W98A 5B24B 3AZHD 4CAYA 4KUDC 4JJNB 3LJAD 5GXQA 3MGRB 5GSUD 1N1JB 1ZLAC 5GT3A 3AZJB 3A1KA 5E5AA 4YS3D 3MGQB 5CPIB 5B31C 4WU8D 3VH6A 3AZFB 3X1TD 5B0YA 5JRGA 3NQJB 2F8NA 3REHB 4WU9A 3WKJD 5GXQC 1F1EA 2FJ7B 2HIOA 4XUJB 3REKA 4J8VA 3W99C 3LZ0D 3TU4D 2L5AA 1KU5A 2Y2NA 5E5AC 3X1UB 1P3MD 2JSSA 5CHLB 5AVCB 5GT0D 5BS7C 1T3UA 5JRGC 2Y2LA 4J8XB 2CV5D 5C3IB 3O62A 1P34D 1KX4B 3WA9D 3KUYB 3REKC 4G91C 4J8VC 3AZEB 2ZY5A 4J8UA 1P3KC 1U35A 2BG1A 4Z2MG 2NQBA 4ZBJB 5JA4B 1S32B 3X1VB 4Z66A 4X23C 1TZYC 3UT9C 1F66D 3UTAD 3O62C 3AFAD 4KHAA 4J8WB 1P3BB 4WJ3C 3AZND 4KUDB 1P3LA 3AZGC 4R8PC 5B40C 1ZLAB 3B6FD 4J8UC 3MVDD 2UWXA 1U35C 5F99A 1P3FD 3C1CA 5KDMA 5B31B 5B0ZA 5CPKD 2ZY3A 4Z66C 3AZLD 1TAFB 4ZUXA 4UUZA 5AVBA 3REID 2ZM5A 3AZHA 3B0DC 2RVQD 2RIQA 3LJAA 5GXQB 5GSUA 3W97D 1HQ3D 3W99B 4H9OA 4YS3A 5E5AB 1ID3C 5F99C 3WAAD 2NZDC 3C1CC 3UTBD 5B0ZC 4WU8A 3X1TA 2Y2KA 5JRGB 5B1LD 4ZUXC 5AVBC 4QLCC 3AN2D 3WKJA 4Z5TD 2BYMB 5GSUC 3C1BC 5B33C 3REKB 4J8VB 3LZ0A 1ULYA 3TU4A 1P3IA 4KGCC 1P3KB 2VQRA 5AV9D 5B2IA 3AZKD 5AV8D 1P3MA 5GT0A 4WU8C 3X1TC 3VH5W 1KX3B 4NE3A 4X23B 2CV5A 4XZQD 1TZYB 3UT9B 3AYWD 3O62B 1P34A 3FDDA 3B0CW 3WA9A 1P3IC 3LZ0C 3AZGB 4R8PB 1EQZD 5B40B 5B2IC 1P3MC 2BYKB 1AOID 1U35B 2HUEB 5GT0C 4DQYB 4YM6D 4Z66B 2CV5C 3AZID 1F66A 3UTAA 3AV1D 3V9RA 1P34C 4KHAB 3AZNA 2XD5A 3B0DB 1P3PC 3B6FA 3MVDA 1P3OC 1ID3B 2JE5A 5F99B 1P3FA 2NZDB 3C1CB 5KDMB 3AL0C 5B0ZB 5B32D 3MNND 5CPKA 5DNND 3AZLA 3VH5T 3RELD 4ZUXB 1F66C 5AVBB 3REIA 2F8NG 1R4VA 2F2AC 3W96D 4QLCB 4LD9D 3AZNC 1P3GD 3X1SD 3MGSA 3B0CT 5GSUB 3W97A 1HQ3A 5B33B 3C1BB 3B6FC 4KGCB 3EPJA 3WAAA 3UTBA 5CPKC 4WU8B 3MGPD 3X1TB 3F6TA 3R45A 3W98C 5B2JD 5B1LA 3AV2A 4CSRA 2FFFB 4JJND 3AN2A 5B1MB 4Z5TA 3MGSC 2RVQC 5GT3C 4G92C 3AZJD 3W97C 1P3IB 4H9RA 3LZ0B 5CPID 3EPKA 3WAAC 3AZKA 4DRBA 2G5IC 5AV9A 5B2IB 5AV8A 5B0YC 3UTBC 3AZFD 1P3MB 3AZMD 5FUGA 4WU9C 3AV2C 5CP6D 3REHD 1HTAA 2IO5C 4XZQA 3B0BA 3AYWA 2HIOC 1H3OA 4Z5TC 3KXBA 2FJ7D 1P34B 4XUJD 2AROD 1BH9A 1W2EA 3LZ1D 3X1UD 1P3PB 1EQZA 5AVCD 3AZKC 5AV9C 5AV8C 4WZSB 1AOIA 1P3OB 1B67A 4J8XD 3EPHA 4YM6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M1A D;  4EO5 C;  4Z2M H;  3AZI A;  1F66 B;  3KXB C;  3AV1 A;  1KX4 D;  2YFV A;  3KUY D;  2NQB C;  3B6F B;  1M19 D;  3B6G D;  1S32 D;  5AY8 D;  1BH8 A;  3X1V D;  5B32 A;  3MNN A;  5CPK B;  5DNN A;  5DNM A;  1B6W A;  3W98 B;  5AV5 D;  3REL A;  1P3B D;  4J8W D;  4CAY B;  1P3L C;  3W96 A;  4KUD D;  5BNX A;  1P3G A;  3X1S A;  3MGS B;  5GT3 B;  4G92 B;  4NE6 A;  1ZLA D;  3NQU A;  3W97 B;  4WNN A;  4H9Q A;  5B31 D;  3WAA B;  3UTB B;  5B0Y B;  3A6N D;  5B32 C;  3MNN C;  3MGP A;  2F8N B;  5DNM C;  5B2J A;  4WU9 B;  1BFM A;  3AZH C;  3AV2 B;  3LJA C;  3W96 C;  4JJN A;  2HIO B;  1P3G C;  4Z5T B;  4G91 B;  3X1S C;  4YS3 C;  3W99 D;  3AZJ A;  5E5A D;  5CPI A;  4H9R B;  3AZK B;  5AV9 B;  3LEL D;  5AV8 B;  3AZM A;  3MGP C;  5JRG D;  3NQJ A;  1JFI A;  1P3A D;  3VH6 W;  3WKJ C;  5CP6 A;  3REH A;  3REJ D;  4AWL C;  4EO5 B;  3KXB B;  2FJ7 A;  3TU4 C;  4XUJ A;  2ARO A;  1BH9 B;  4J8U B;  4H9P A;  3LZ1 A;  3X1U A;  1P3K D;  5BT1 D;  2NQB B;  4H9S A;  5AVC A;  3AZM C;  1WWS A;  1KX3 D;  1KX5 D;  4J8X A;  4X23 D;  1M18 D;  1TZY D;  5CP6 C;  5AV6 D;  3AFA A;  3UT9 D;  1M1A A;  3O62 D;  3WA9 C;  1P3L B;  1KX4 A;  3KUY A;  2ARO C;  3AZG D;  4R8P D;  3LZ1 C;  5B40 D;  4H9S C;  1M19 A;  3B6G A;  3KWQ D;  5JA4 A;  5AY8 A;  1BH8 B;  4UUZ B;  5B32 B;  3MNN B;  3UTA C;  3AFA C;  5DNM B;  1M1A C;  2PYO D;  5BO0 A;  5AV5 A;  3VH6 T;  5CPJ D;  4J8W A;  1P3B A;  3AZH B;  2YFW A;  1KX4 C;  3LJA B;  3WTP D;  3W96 B;  4KUD A;  1P3G B;  3X1S B;  3MVD C;  1ZLA A;  3NQU B;  4H9O B;  4YS3 B;  1P3F C;  2F8N H;  1M19 C;  1ID3 D;  4H9Q B;  5F99 D;  2NZD D;  3B6G C;  5B31 A;  3AZL C;  5AY8 C;  3A6N A;  5B24 D;  3REI C;  3MGP B;  4ZUX D;  5AV5 C;  3MGR D;  3WKJ B;  4QLC D;  4AWL B;  1HQ3 C;  3MGQ D;  3TU4 B;  5B33 D;  3C1B D;  3W99 A;  4KGC D;  3VH5 A;  4H9N A;  5GT0 B;  4WV4 B;  3LEL A;  5BS7 A;  3A6N C;  5B1L C;  3AZM B;  1JFI B;  2CV5 B;  3AN2 C;  1P3A A;  5CP6 B;  3WTP E;  4HGA C;  5B1M D;  3REJ A;  2BYM A;  5G49 A;  3WA9 B;  4NFT A;  1P3I D;  2ARO B;  5BNV A;  2LY8 A;  4H9P B;  3LZ1 B;  1P3K A;  5B2I D;  3LEL C;  1KX3 A;  1KX5 A;  4XZQ C;  5B32 G;  4X23 A;  3AYW C;  1P3A C;  1M18 A;  3UTA B;  1TZY A;  3UT9 A;  5AV6 A;  3V9R B;  3AFA B;  3REJ C;  1M1A B;  3AZN B;  1A7W A;  3AZE D;  1EQZ C;  3AZG A;  4R8P A;  1P3P D;  5B40 A;  3MVD B;  1AOI C;  5BT1 C;  2BYK A;  1P3F B;  1P3O D;  1M19 B;  3KWQ A;  3B6G B;  4YM6 C;  1KX3 C;  1KX5 C;  3AZL B;  5AY8 B;  3AZI C;  1M18 C;  3AV1 C;  3REI B;  5AV6 C;  2PYO A;  4LD9 A;  5BO0 B;  5AV5 B;  5CPJ A;  2YFW B;  1Q9C A;  3WTP A;  1HQ3 B;  2HUE C;  1ID3 A;  2NZD A;  3KWQ C;  4M6B A;  5DNN C;  3R45 B;  3REL C;  3A6N B;  5B1L B;  5B24 A;  2F8N K;  3W98 D;  2IO5 B;  4CSR B;  2PYO C;  4LD9 C;  3MGR A;  3AN2 B;  5GXQ D;  5CPJ C;  4QLC A;  1N1J A;  4HGA B;  3WTP C;  3MGS D;  5GT3 D;  3MGQ A;  5B33 A;  3C1B A;  4KGC A;  4H9N B;  3AZF A;  5B0Y D;  5FUG B;  3LEL B;  5B2J C;  2F8N D;  5B24 C;  4WU9 D;  3AV2 D;  4XZQ B;  4JJN C;  3MGR C;  3AYW B;  1P3A B;  1H3O B;  2HIO D;  5B1M A;  3REJ B;  4J8V D;  3REK D;  5G49 B;  3AZJ C;  3MGQ C;  5CPI C;  5BNV B;  1EQZ B;  4E45 A;  3AZF C;  1AOI B;  4YM6 B;  3REH C;  1KX5 B;  3KSY A;  3AZI B;  1M18 B;  1WWI A;  3AV1 B;  2YFV B;  2FJ7 C;  5AV6 B;  4XUJ C;  5B1M C;  3KXB D;  3AZE A;  3X1U C;  4J8U D;  1P3P A;  5AVC C;  1U35 D;  2NQB D;  1S32 A;  1P3O A;  3X1V A;  4J8X C;  4Z66 D;  5B31 G;  4DRA A;  5DNN B;  3KWQ B;  5C3I C;  3REL B;  3KUY C;  2PYO B;  1P3L D;  5BNX B;  4LD9 B;  5CPJ B;  3AZE C;  3WTP B;  4WNN B;  2CWE A;  4ZBJ C;  3C1C D;  1S32 C;  5B0Z D;  4NE5 A;  3X1V C;  1TAF A;  5AVB D;  4E44 A;  1P3B C;  5B2J B;  5DNM D;  4J8W C;  3W98 A;  5B24 B;  3AZH D;  4CAY A;  4KUD C;  4JJN B;  3LJA D;  5GXQ A;  3MGR B;  5GSU D;  1N1J B;  1ZLA C;  5GT3 A;  3AZJ B;  3MGQ B;  5E5A A;  4YS3 D;  5CPI B;  5B31 C;  4WU8 D;  3VH6 A;  3AZF B;  3X1T D;  5B0Y A;  5JRG A;  3NQJ B;  2F8N A;  3REH B;  4WU9 A;  3WKJ D;  5GXQ C;  1F1E A;  2FJ7 B;  2HIO A;  4XUJ B;  3REK A;  4J8V A;  3W99 C;  3LZ0 D;  3TU4 D;  2L5A A;  1KU5 A;  5E5A C;  3X1U B;  1P3M D;  2JSS A;  5CHL B;  5AVC B;  5GT0 D;  5BS7 C;  5JRG C;  4J8X B;  2CV5 D;  5C3I B;  3O62 A;  1P34 D;  1KX4 B;  3WA9 D;  3KUY B;  3REK C;  4G91 C;  4J8V C;  3AZE B;  4J8U A;  1P3K C;  1U35 A;  4Z2M G;  2NQB A;  4ZBJ B;  5JA4 B;  1S32 B;  3X1V B;  4Z66 A;  4X23 C;  1TZY C;  3UT9 C;  1F66 D;  3UTA D;  3O62 C;  3AFA D;  4KHA A;  4J8W B;  1P3B B;  3AZN D;  4KUD B;  1P3L A;  3AZG C;  4R8P C;  5B40 C;  1ZLA B;  3B6F D;  4J8U C;  3MVD D;  1U35 C;  5F99 A;  1P3F D;  3C1C A;  5KDM A;  5B31 B;  5B0Z A;  5CPK D;  4Z66 C;  3AZL D;  1TAF B;  4ZUX A;  4UUZ A;  5AVB A;  3REI D;  3AZH A;  3B0D C;  2RVQ D;  3LJA A;  5GXQ B;  5GSU A;  3W97 D;  1HQ3 D;  3W99 B;  4H9O A;  4YS3 A;  5E5A B;  1ID3 C;  5F99 C;  3WAA D;  2NZD C;  3C1C C;  3UTB D;  5B0Z C;  4WU8 A;  3X1T A;  5JRG B;  5B1L D;  4ZUX C;  5AVB C;  4QLC C;  3AN2 D;  3WKJ A;  4Z5T D;  2BYM B;  5GSU C;  3C1B C;  5B33 C;  3REK B;  4J8V B;  3LZ0 A;  1ULY A;  3TU4 A;  1P3I A;  4KGC C;  1P3K B;  3AZK D;  5AV9 D;  5B2I A;  1P3M A;  5AV8 D;  5GT0 A;  4WU8 C;  3X1T C;  3VH5 W;  1KX3 B;  4NE3 A;  4X23 B;  2CV5 A;  4XZQ D;  1TZY B;  3UT9 B;  3AYW D;  3O62 B;  1P34 A;  3B0C W;  3WA9 A;  1P3I C;  3LZ0 C;  3AZG B;  4R8P B;  1EQZ D;  5B40 B;  5B2I C;  1P3M C;  2BYK B;  1AOI D;  1U35 B;  2HUE B;  5GT0 C;  4YM6 D;  4Z66 B;  2CV5 C;  3AZI D;  1F66 A;  3UTA A;  3AV1 D;  3V9R A;  1P34 C;  4KHA B;  3AZN A;  3B0D B;  1P3P C;  3B6F A;  3MVD A;  1P3O C;  1ID3 B;  5F99 B;  1P3F A;  2NZD B;  3C1C B;  5KDM B;  5B0Z B;  5B32 D;  3MNN D;  5CPK A;  5DNN D;  3AZL A;  3VH5 T;  3REL D;  4ZUX B;  1F66 C;  5AVB B;  3REI A;  2F8N G;  1R4V A;  3W96 D;  4QLC B;  4LD9 D;  3AZN C;  1P3G D;  3X1S D;  3MGS A;  3B0C T;  5GSU B;  3W97 A;  1HQ3 A;  5B33 B;  3C1B B;  3B6F C;  4KGC B;  3WAA A;  3UTB A;  5CPK C;  4WU8 B;  3MGP D;  3X1T B;  3R45 A;  3W98 C;  5B2J D;  5B1L A;  3AV2 A;  4CSR A;  4JJN D;  3AN2 A;  5B1M B;  4Z5T A;  3MGS C;  2RVQ C;  5GT3 C;  4G92 C;  3AZJ D;  3W97 C;  1P3I B;  4H9R A;  3LZ0 B;  5CPI D;  3WAA C;  3AZK A;  4DRB A;  5AV9 A;  5B2I B;  5AV8 A;  5B0Y C;  3UTB C;  3AZF D;  1P3M B;  3AZM D;  5FUG A;  4WU9 C;  3AV2 C;  5CP6 D;  3REH D;  1HTA A;  2IO5 C;  4XZQ A;  3B0B A;  3AYW A;  2HIO C;  1H3O A;  4Z5T C;  3KXB A;  2FJ7 D;  1P34 B;  4XUJ D;  2ARO D;  1BH9 A;  3LZ1 D;  3X1U D;  1P3P B;  1EQZ A;  5AVC D;  3AZK C;  5AV9 C;  5AV8 C;  4WZS B;  1AOI A;  1P3O B;  1B67 A;  4J8X D;  4YM6 A; 
#chains in the Genus database with same CATH topology
 1M1A D;  4EO5 C;  4Z2M H;  3AZI A;  1F66 B;  3KXB C;  3AV1 A;  1KX4 D;  2YFV A;  3KUY D;  3EPL A;  2NQB C;  3B6F B;  1M19 D;  3B6G D;  1S32 D;  5AY8 D;  1BH8 A;  3X1V D;  5B32 A;  3MNN A;  5CPK B;  5DNN A;  5DNM A;  1B6W A;  3W98 B;  5AV5 D;  3REL A;  1P3B D;  4J8W D;  4CAY B;  1P3L C;  3W96 A;  4KUD D;  5BNX A;  1P3G A;  3X1S A;  3MGS B;  5GT3 B;  4G92 B;  4NE6 A;  1ZLA D;  3NQU A;  3W97 B;  4WNN A;  4H9Q A;  5B31 D;  3WAA B;  3UTB B;  5B0Y B;  3A6N D;  5B32 C;  3MNN C;  2ZY4 A;  3MGP A;  2F8N B;  5DNM C;  5B2J A;  4WU9 B;  1BFM A;  3AZH C;  3AV2 B;  3LJA C;  3W96 C;  4JJN A;  2HIO B;  1P3G C;  4Z5T B;  4G91 B;  3X1S C;  4YS3 C;  3W99 D;  3AZJ A;  5E5A D;  5CPI A;  4H9R B;  2W8S A;  1Z2C B;  2Y2H A;  2Y2J A;  3AZK B;  5AV9 B;  2G5H C;  3LEL D;  5AV8 B;  3H0R C;  3AZM A;  3MGP C;  5JRG D;  3NQJ A;  1JFI A;  1P3A D;  3VH6 W;  3WKJ C;  5CP6 A;  3REH A;  3REJ D;  4AWL C;  4EO5 B;  3KXB B;  2FJ7 A;  3TU4 C;  4XUJ A;  2ARO A;  1BH9 B;  4J8U B;  4H9P A;  3LZ1 A;  3X1U A;  1P3K D;  5BT1 D;  2NQB B;  4H9S A;  5AVC A;  3AZM C;  1WWS A;  1KX3 D;  1KX5 D;  4J8X A;  4X23 D;  1M18 D;  1TZY D;  5CP6 C;  5AV6 D;  3AFA A;  3UT9 D;  1M1A A;  3O62 D;  3WA9 C;  2Y2M A;  1P3L B;  1KX4 A;  3KUY A;  2ARO C;  2Y2O A;  3AZG D;  4R8P D;  3LZ1 C;  5B40 D;  4H9S C;  1M19 A;  3B6G A;  3KWQ D;  5JA4 A;  5AY8 A;  1BH8 B;  3H0L C;  4UUZ B;  5B32 B;  3MNN B;  3UTA C;  3AFA C;  5DNM B;  1M1A C;  2PYO D;  5BO0 A;  5AV5 A;  3VH6 T;  5CPJ D;  4J8W A;  2ZY2 A;  3AZH B;  2YFW A;  1P3B A;  1KX4 C;  3LJA B;  3WTP D;  3W96 B;  4KUD A;  1P3G B;  3X1S B;  2J8P A;  3MVD C;  1ZLA A;  3NQU B;  4H9O B;  4YS3 B;  1P3F C;  2F8N H;  1M19 C;  1ID3 D;  4H9Q B;  5F99 D;  2NZD D;  3B6G C;  5B31 A;  3AZL C;  5AY8 C;  3A6N A;  5B24 D;  3REI C;  3MGP B;  4ZUX D;  5AV5 C;  3MGR D;  3WKJ B;  4QLC D;  4AWL B;  1HQ3 C;  3MGQ D;  3TU4 B;  5B33 D;  3C1B D;  2Y2P A;  3W99 A;  4KGC D;  3VH5 A;  4H9N A;  5GT0 B;  4WV4 B;  3LEL A;  5BS7 A;  3A6N C;  5B1L C;  3AZM B;  1JFI B;  2CV5 B;  3IP4 C;  3AN2 C;  1P3A A;  5CP6 B;  3WTP E;  4HGA C;  5B1M D;  3REJ A;  2BYM A;  5G49 A;  3WA9 B;  4NFT A;  1P3I D;  2ARO B;  5BNV A;  2LY8 A;  3P5J B;  4H9P B;  3LZ1 B;  1P3K A;  5B2I D;  3KFU G;  3LEL C;  1KX3 A;  1KX5 A;  4XZQ C;  5B32 G;  4X23 A;  3AYW C;  1P3A C;  1M18 A;  3UTA B;  1TZY A;  3UT9 A;  5AV6 A;  3V9R B;  3AFA B;  3REJ C;  1M1A B;  3AZN B;  1A7W A;  3AZE D;  1EQZ C;  3AZG A;  4R8P A;  1P3P D;  5B40 A;  3MVD B;  1AOI C;  5BT1 C;  2BYK A;  1P3F B;  1P3O D;  1M19 B;  3KWQ A;  3B6G B;  4YM6 C;  1KX3 C;  1KX5 C;  3AZL B;  5AY8 B;  3AZI C;  1M18 C;  3AV1 C;  3REI B;  5AV6 C;  2PYO A;  4LD9 A;  5BO0 B;  5AV5 B;  5CPJ A;  2YFW B;  1Q9C A;  2XD1 A;  3WTP A;  1HQ3 B;  2Y2Q A;  2HUE C;  1ID3 A;  2NZD A;  3KWQ C;  4M6B A;  5DNN C;  3R45 B;  3REL C;  3A6N B;  5B1L B;  5B24 A;  2F8N K;  3W98 D;  2IO5 B;  4CSR B;  2PYO C;  4LD9 C;  3MGR A;  3AN2 B;  5GXQ D;  5CPJ C;  4QLC A;  1N1J A;  4HGA B;  3WTP C;  3MGS D;  5GT3 D;  3MGQ A;  5B33 A;  3C1B A;  4KGC A;  4H9N B;  3H0M C;  3AZF A;  5B0Y D;  5FUG B;  3LEL B;  5B2J C;  2F8N D;  5B24 C;  4WU9 D;  4UPK A;  3AV2 D;  4XZQ B;  4JJN C;  3MGR C;  3AYW B;  1P3A B;  1H3O B;  2HIO D;  5B1M A;  3REJ B;  4J8V D;  3REK D;  5G49 B;  3AZJ C;  3MGQ C;  5CPI C;  2DQN C;  5BNV B;  1EQZ B;  4E45 A;  3AZF C;  1AOI B;  2DF4 C;  4YM6 B;  3REH C;  3EG5 B;  1KX5 B;  3KSY A;  3AZI B;  1M18 B;  1WWI A;  3AV1 B;  2YFV B;  2FJ7 C;  5AV6 B;  4XUJ C;  5B1M C;  3KXB D;  3AZE A;  3X1U C;  4J8U D;  1P3P A;  5AVC C;  1U35 D;  2NQB D;  1PZR A;  1S32 A;  1P3O A;  2Y2G A;  4J8X C;  3X1V A;  4Z66 D;  5B31 G;  4DRA A;  5DNN B;  3KWQ B;  5C3I C;  3REL B;  2JCH A;  2Y2I A;  3KUY C;  2PYO B;  1P3L D;  5BNX B;  4LD9 B;  5CPJ B;  3AZE C;  3WTP B;  4WNN B;  2CWE A;  4ZBJ C;  3C1C D;  3A1I A;  1S32 C;  5B0Z D;  4NE5 A;  3X1V C;  1TAF A;  5AVB D;  4E44 A;  1P3B C;  5B2J B;  5DNM D;  4J8W C;  3W98 A;  5B24 B;  3AZH D;  4CAY A;  4KUD C;  4JJN B;  3LJA D;  5GXQ A;  3MGR B;  5GSU D;  1N1J B;  1ZLA C;  5GT3 A;  3AZJ B;  3A1K A;  5E5A A;  4YS3 D;  3MGQ B;  5CPI B;  5B31 C;  4WU8 D;  3VH6 A;  3AZF B;  3X1T D;  5B0Y A;  5JRG A;  3NQJ B;  2F8N A;  3REH B;  4WU9 A;  3WKJ D;  5GXQ C;  1F1E A;  2FJ7 B;  2HIO A;  4XUJ B;  3REK A;  4J8V A;  3W99 C;  3LZ0 D;  3TU4 D;  2L5A A;  1KU5 A;  2Y2N A;  5E5A C;  3X1U B;  1P3M D;  2JSS A;  5CHL B;  5AVC B;  5GT0 D;  5BS7 C;  1T3U A;  5JRG C;  2Y2L A;  4J8X B;  2CV5 D;  5C3I B;  3O62 A;  1P34 D;  1KX4 B;  3WA9 D;  3KUY B;  3REK C;  4G91 C;  4J8V C;  3AZE B;  2ZY5 A;  4J8U A;  1P3K C;  1U35 A;  2BG1 A;  4Z2M G;  2NQB A;  4ZBJ B;  5JA4 B;  1S32 B;  3X1V B;  4Z66 A;  4X23 C;  1TZY C;  3UT9 C;  1F66 D;  3UTA D;  3O62 C;  3AFA D;  4KHA A;  4J8W B;  1P3B B;  4WJ3 C;  3AZN D;  4KUD B;  1P3L A;  3AZG C;  4R8P C;  5B40 C;  1ZLA B;  3B6F D;  4J8U C;  3MVD D;  2UWX A;  1U35 C;  5F99 A;  1P3F D;  3C1C A;  5KDM A;  5B31 B;  5B0Z A;  5CPK D;  2ZY3 A;  4Z66 C;  3AZL D;  1TAF B;  4ZUX A;  4UUZ A;  5AVB A;  3REI D;  2ZM5 A;  3AZH A;  3B0D C;  2RVQ D;  2RIQ A;  3LJA A;  5GXQ B;  5GSU A;  3W97 D;  1HQ3 D;  3W99 B;  4H9O A;  4YS3 A;  5E5A B;  1ID3 C;  5F99 C;  3WAA D;  2NZD C;  3C1C C;  3UTB D;  5B0Z C;  4WU8 A;  3X1T A;  2Y2K A;  5JRG B;  5B1L D;  4ZUX C;  5AVB C;  4QLC C;  3AN2 D;  3WKJ A;  4Z5T D;  2BYM B;  5GSU C;  3C1B C;  5B33 C;  3REK B;  4J8V B;  3LZ0 A;  1ULY A;  3TU4 A;  1P3I A;  4KGC C;  1P3K B;  2VQR A;  5AV9 D;  5B2I A;  3AZK D;  5AV8 D;  1P3M A;  5GT0 A;  4WU8 C;  3X1T C;  3VH5 W;  1KX3 B;  4NE3 A;  4X23 B;  2CV5 A;  4XZQ D;  1TZY B;  3UT9 B;  3AYW D;  3O62 B;  1P34 A;  3FDD A;  3B0C W;  3WA9 A;  1P3I C;  3LZ0 C;  3AZG B;  4R8P B;  1EQZ D;  5B40 B;  5B2I C;  1P3M C;  2BYK B;  1AOI D;  1U35 B;  2HUE B;  5GT0 C;  4DQY B;  4YM6 D;  4Z66 B;  2CV5 C;  3AZI D;  1F66 A;  3UTA A;  3AV1 D;  3V9R A;  1P34 C;  4KHA B;  3AZN A;  2XD5 A;  3B0D B;  1P3P C;  3B6F A;  3MVD A;  1P3O C;  1ID3 B;  2JE5 A;  5F99 B;  1P3F A;  2NZD B;  3C1C B;  5KDM B;  3AL0 C;  5B0Z B;  5B32 D;  3MNN D;  5CPK A;  5DNN D;  3AZL A;  3VH5 T;  3REL D;  4ZUX B;  1F66 C;  5AVB B;  3REI A;  2F8N G;  1R4V A;  2F2A C;  3W96 D;  4QLC B;  4LD9 D;  3AZN C;  1P3G D;  3X1S D;  3MGS A;  3B0C T;  5GSU B;  3W97 A;  1HQ3 A;  5B33 B;  3C1B B;  3B6F C;  4KGC B;  3EPJ A;  3WAA A;  3UTB A;  5CPK C;  4WU8 B;  3MGP D;  3X1T B;  3F6T A;  3R45 A;  3W98 C;  5B2J D;  5B1L A;  3AV2 A;  4CSR A;  2FFF B;  4JJN D;  3AN2 A;  5B1M B;  4Z5T A;  3MGS C;  2RVQ C;  5GT3 C;  4G92 C;  3AZJ D;  3W97 C;  1P3I B;  4H9R A;  3LZ0 B;  5CPI D;  3EPK A;  3WAA C;  3AZK A;  4DRB A;  2G5I C;  5AV9 A;  5B2I B;  5AV8 A;  5B0Y C;  3UTB C;  3AZF D;  1P3M B;  3AZM D;  5FUG A;  4WU9 C;  3AV2 C;  5CP6 D;  3REH D;  1HTA A;  2IO5 C;  4XZQ A;  3B0B A;  3AYW A;  2HIO C;  1H3O A;  4Z5T C;  3KXB A;  2FJ7 D;  1P34 B;  4XUJ D;  2ARO D;  1BH9 A;  1W2E A;  3LZ1 D;  3X1U D;  1P3P B;  1EQZ A;  5AVC D;  3AZK C;  5AV9 C;  5AV8 C;  4WZS B;  1AOI A;  1P3O B;  1B67 A;  4J8X D;  3EPH A;  4YM6 A; 
#chains in the Genus database with same CATH homology
 1M1A D;  4EO5 C;  4Z2M H;  3AZI A;  1F66 B;  3KXB C;  3AV1 A;  1KX4 D;  2YFV A;  3KUY D;  3EPL A;  2NQB C;  3B6F B;  1M19 D;  3B6G D;  1S32 D;  5AY8 D;  1BH8 A;  3X1V D;  5B32 A;  3MNN A;  5CPK B;  5DNN A;  5DNM A;  1B6W A;  3W98 B;  5AV5 D;  3REL A;  1P3B D;  4J8W D;  4CAY B;  1P3L C;  3W96 A;  4KUD D;  5BNX A;  1P3G A;  3X1S A;  3MGS B;  5GT3 B;  4G92 B;  4NE6 A;  1ZLA D;  3NQU A;  3W97 B;  4WNN A;  4H9Q A;  5B31 D;  3WAA B;  3UTB B;  5B0Y B;  3A6N D;  5B32 C;  3MNN C;  2ZY4 A;  3MGP A;  2F8N B;  5DNM C;  5B2J A;  4WU9 B;  1BFM A;  3AZH C;  3AV2 B;  3LJA C;  3W96 C;  4JJN A;  2HIO B;  1P3G C;  4Z5T B;  4G91 B;  3X1S C;  4YS3 C;  3W99 D;  3AZJ A;  5E5A D;  5CPI A;  4H9R B;  2W8S A;  1Z2C B;  2Y2H A;  2Y2J A;  3AZK B;  5AV9 B;  2G5H C;  3LEL D;  5AV8 B;  3H0R C;  3AZM A;  3MGP C;  5JRG D;  3NQJ A;  1JFI A;  1P3A D;  3VH6 W;  3WKJ C;  5CP6 A;  3REH A;  3REJ D;  4AWL C;  4EO5 B;  3KXB B;  2FJ7 A;  3TU4 C;  4XUJ A;  2ARO A;  1BH9 B;  4J8U B;  4H9P A;  3LZ1 A;  3X1U A;  1P3K D;  5BT1 D;  2NQB B;  4H9S A;  5AVC A;  3AZM C;  1WWS A;  1KX3 D;  1KX5 D;  4J8X A;  4X23 D;  1M18 D;  1TZY D;  5CP6 C;  5AV6 D;  3AFA A;  3UT9 D;  1M1A A;  3O62 D;  3WA9 C;  2Y2M A;  1P3L B;  1KX4 A;  3KUY A;  2ARO C;  2Y2O A;  3AZG D;  4R8P D;  3LZ1 C;  5B40 D;  4H9S C;  1M19 A;  3B6G A;  3KWQ D;  5JA4 A;  5AY8 A;  1BH8 B;  3H0L C;  4UUZ B;  5B32 B;  3MNN B;  3UTA C;  3AFA C;  5DNM B;  1M1A C;  2PYO D;  5BO0 A;  5AV5 A;  3VH6 T;  5CPJ D;  4J8W A;  2ZY2 A;  3AZH B;  2YFW A;  1P3B A;  1KX4 C;  3LJA B;  3WTP D;  3W96 B;  4KUD A;  1P3G B;  3X1S B;  2J8P A;  3MVD C;  1ZLA A;  3NQU B;  4H9O B;  4YS3 B;  1P3F C;  2F8N H;  1M19 C;  1ID3 D;  4H9Q B;  5F99 D;  2NZD D;  3B6G C;  5B31 A;  3AZL C;  5AY8 C;  3A6N A;  5B24 D;  3REI C;  3MGP B;  4ZUX D;  5AV5 C;  3MGR D;  3WKJ B;  4QLC D;  4AWL B;  1HQ3 C;  3MGQ D;  3TU4 B;  5B33 D;  3C1B D;  2Y2P A;  3W99 A;  4KGC D;  3VH5 A;  4H9N A;  5GT0 B;  4WV4 B;  3LEL A;  5BS7 A;  3A6N C;  5B1L C;  3AZM B;  1JFI B;  2CV5 B;  3IP4 C;  3AN2 C;  1P3A A;  5CP6 B;  3WTP E;  4HGA C;  5B1M D;  3REJ A;  2BYM A;  5G49 A;  3WA9 B;  4NFT A;  1P3I D;  2ARO B;  5BNV A;  2LY8 A;  3P5J B;  4H9P B;  3LZ1 B;  1P3K A;  5B2I D;  3KFU G;  3LEL C;  1KX3 A;  1KX5 A;  4XZQ C;  5B32 G;  4X23 A;  3AYW C;  1P3A C;  1M18 A;  3UTA B;  1TZY A;  3UT9 A;  5AV6 A;  3V9R B;  3AFA B;  3REJ C;  1M1A B;  3AZN B;  1A7W A;  3AZE D;  1EQZ C;  3AZG A;  4R8P A;  1P3P D;  5B40 A;  3MVD B;  1AOI C;  5BT1 C;  2BYK A;  1P3F B;  1P3O D;  1M19 B;  3KWQ A;  3B6G B;  4YM6 C;  1KX3 C;  1KX5 C;  3AZL B;  5AY8 B;  3AZI C;  1M18 C;  3AV1 C;  3REI B;  5AV6 C;  2PYO A;  4LD9 A;  5BO0 B;  5AV5 B;  5CPJ A;  2YFW B;  1Q9C A;  2XD1 A;  3WTP A;  1HQ3 B;  2Y2Q A;  2HUE C;  1ID3 A;  2NZD A;  3KWQ C;  4M6B A;  5DNN C;  3R45 B;  3REL C;  3A6N B;  5B1L B;  5B24 A;  2F8N K;  3W98 D;  2IO5 B;  4CSR B;  2PYO C;  4LD9 C;  3MGR A;  3AN2 B;  5GXQ D;  5CPJ C;  4QLC A;  1N1J A;  4HGA B;  3WTP C;  3MGS D;  5GT3 D;  3MGQ A;  5B33 A;  3C1B A;  4KGC A;  4H9N B;  3H0M C;  3AZF A;  5B0Y D;  5FUG B;  3LEL B;  5B2J C;  2F8N D;  5B24 C;  4WU9 D;  4UPK A;  3AV2 D;  4XZQ B;  4JJN C;  3MGR C;  3AYW B;  1P3A B;  1H3O B;  2HIO D;  5B1M A;  3REJ B;  4J8V D;  3REK D;  5G49 B;  3AZJ C;  3MGQ C;  5CPI C;  2DQN C;  5BNV B;  1EQZ B;  4E45 A;  3AZF C;  1AOI B;  2DF4 C;  4YM6 B;  3REH C;  3EG5 B;  1KX5 B;  3KSY A;  3AZI B;  1M18 B;  1WWI A;  3AV1 B;  2YFV B;  2FJ7 C;  5AV6 B;  4XUJ C;  5B1M C;  3KXB D;  3AZE A;  3X1U C;  4J8U D;  1P3P A;  5AVC C;  1U35 D;  2NQB D;  1PZR A;  1S32 A;  1P3O A;  2Y2G A;  4J8X C;  3X1V A;  4Z66 D;  5B31 G;  4DRA A;  5DNN B;  3KWQ B;  5C3I C;  3REL B;  2JCH A;  2Y2I A;  3KUY C;  2PYO B;  1P3L D;  5BNX B;  4LD9 B;  5CPJ B;  3AZE C;  3WTP B;  4WNN B;  2CWE A;  4ZBJ C;  3C1C D;  3A1I A;  1S32 C;  5B0Z D;  4NE5 A;  3X1V C;  1TAF A;  5AVB D;  4E44 A;  1P3B C;  5B2J B;  5DNM D;  4J8W C;  3W98 A;  5B24 B;  3AZH D;  4CAY A;  4KUD C;  4JJN B;  3LJA D;  5GXQ A;  3MGR B;  5GSU D;  1N1J B;  1ZLA C;  5GT3 A;  3AZJ B;  3A1K A;  5E5A A;  4YS3 D;  3MGQ B;  5CPI B;  5B31 C;  4WU8 D;  3VH6 A;  3AZF B;  3X1T D;  5B0Y A;  5JRG A;  3NQJ B;  2F8N A;  3REH B;  4WU9 A;  3WKJ D;  5GXQ C;  1F1E A;  2FJ7 B;  2HIO A;  4XUJ B;  3REK A;  4J8V A;  3W99 C;  3LZ0 D;  3TU4 D;  2L5A A;  1KU5 A;  2Y2N A;  5E5A C;  3X1U B;  1P3M D;  2JSS A;  5CHL B;  5AVC B;  5GT0 D;  5BS7 C;  1T3U A;  5JRG C;  2Y2L A;  4J8X B;  2CV5 D;  5C3I B;  3O62 A;  1P34 D;  1KX4 B;  3WA9 D;  3KUY B;  3REK C;  4G91 C;  4J8V C;  3AZE B;  2ZY5 A;  4J8U A;  1P3K C;  1U35 A;  2BG1 A;  4Z2M G;  2NQB A;  4ZBJ B;  5JA4 B;  1S32 B;  3X1V B;  4Z66 A;  4X23 C;  1TZY C;  3UT9 C;  1F66 D;  3UTA D;  3O62 C;  3AFA D;  4KHA A;  4J8W B;  1P3B B;  4WJ3 C;  3AZN D;  4KUD B;  1P3L A;  3AZG C;  4R8P C;  5B40 C;  1ZLA B;  3B6F D;  4J8U C;  3MVD D;  2UWX A;  1U35 C;  5F99 A;  1P3F D;  3C1C A;  5KDM A;  5B31 B;  5B0Z A;  5CPK D;  2ZY3 A;  4Z66 C;  3AZL D;  1TAF B;  4ZUX A;  4UUZ A;  5AVB A;  3REI D;  2ZM5 A;  3AZH A;  3B0D C;  2RVQ D;  2RIQ A;  3LJA A;  5GXQ B;  5GSU A;  3W97 D;  1HQ3 D;  3W99 B;  4H9O A;  4YS3 A;  5E5A B;  1ID3 C;  5F99 C;  3WAA D;  2NZD C;  3C1C C;  3UTB D;  5B0Z C;  4WU8 A;  3X1T A;  2Y2K A;  5JRG B;  5B1L D;  4ZUX C;  5AVB C;  4QLC C;  3AN2 D;  3WKJ A;  4Z5T D;  2BYM B;  5GSU C;  3C1B C;  5B33 C;  3REK B;  4J8V B;  3LZ0 A;  1ULY A;  3TU4 A;  1P3I A;  4KGC C;  1P3K B;  2VQR A;  5AV9 D;  5B2I A;  3AZK D;  5AV8 D;  1P3M A;  5GT0 A;  4WU8 C;  3X1T C;  3VH5 W;  1KX3 B;  4NE3 A;  4X23 B;  2CV5 A;  4XZQ D;  1TZY B;  3UT9 B;  3AYW D;  3O62 B;  1P34 A;  3FDD A;  3B0C W;  3WA9 A;  1P3I C;  3LZ0 C;  3AZG B;  4R8P B;  1EQZ D;  5B40 B;  5B2I C;  1P3M C;  2BYK B;  1AOI D;  1U35 B;  2HUE B;  5GT0 C;  4DQY B;  4YM6 D;  4Z66 B;  2CV5 C;  3AZI D;  1F66 A;  3UTA A;  3AV1 D;  3V9R A;  1P34 C;  4KHA B;  3AZN A;  2XD5 A;  3B0D B;  1P3P C;  3B6F A;  3MVD A;  1P3O C;  1ID3 B;  2JE5 A;  5F99 B;  1P3F A;  2NZD B;  3C1C B;  5KDM B;  3AL0 C;  5B0Z B;  5B32 D;  3MNN D;  5CPK A;  5DNN D;  3AZL A;  3VH5 T;  3REL D;  4ZUX B;  1F66 C;  5AVB B;  3REI A;  2F8N G;  1R4V A;  2F2A C;  3W96 D;  4QLC B;  4LD9 D;  3AZN C;  1P3G D;  3X1S D;  3MGS A;  3B0C T;  5GSU B;  3W97 A;  1HQ3 A;  5B33 B;  3C1B B;  3B6F C;  4KGC B;  3EPJ A;  3WAA A;  3UTB A;  5CPK C;  4WU8 B;  3MGP D;  3X1T B;  3F6T A;  3R45 A;  3W98 C;  5B2J D;  5B1L A;  3AV2 A;  4CSR A;  2FFF B;  4JJN D;  3AN2 A;  5B1M B;  4Z5T A;  3MGS C;  2RVQ C;  5GT3 C;  4G92 C;  3AZJ D;  3W97 C;  1P3I B;  4H9R A;  3LZ0 B;  5CPI D;  3EPK A;  3WAA C;  3AZK A;  4DRB A;  2G5I C;  5AV9 A;  5B2I B;  5AV8 A;  5B0Y C;  3UTB C;  3AZF D;  1P3M B;  3AZM D;  5FUG A;  4WU9 C;  3AV2 C;  5CP6 D;  3REH D;  1HTA A;  2IO5 C;  4XZQ A;  3B0B A;  3AYW A;  2HIO C;  1H3O A;  4Z5T C;  3KXB A;  2FJ7 D;  1P34 B;  4XUJ D;  2ARO D;  1BH9 A;  1W2E A;  3LZ1 D;  3X1U D;  1P3P B;  1EQZ A;  5AVC D;  3AZK C;  5AV9 C;  5AV8 C;  4WZS B;  1AOI A;  1P3O B;  1B67 A;  4J8X D;  3EPH A;  4YM6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...