4NE5A

Human mhf1-mhf2 complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
93
structure length
93
Chain Sequence
SYQQRLKAAVHYTVGCLCEEVALDKAMQFSKQTIAAISELTFRQCENFAKDLEMFARHAKRTTINTEDVKLLARRSNSLLKYITDKSEEIAQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Centromere protein S
publication title The MHF complex senses branched DNA by binding a pair of crossover DNA duplexes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 35
structure length 93
sequence length 93
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2013-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15630 CENP-S CENP-S protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4ne5A00
3AYWB 4WU8B 3LJAA 3X1VB 3AZNA 5CPIB 5B0YC 5B33B 4H9RB 1P3OA 5F99A 3AZGB 5B2IC 2F8NG 3MGRC 5BNXA 2NQBC 5AV9A 3REHB 3AZNB 5F99B 2CV5C 4H9OB 5B40B 3WA9C 4J8XD 2FJ7D 3REKA 3B6FB 1HQ3C 3REJB 3B0DC 3AZJD 4JJNC 5AV9B 4CSRB 5CPJD 3AV2B 1TZYD 3MGSD 5BT1C 3A6NB 5B1MC 3KXBA 3REKB 4G91B 1P3GA 3UT9D 3AZID 1KX5D 3AZLA 4J8XA 4WNNB 1P3FD 2FJ7A 5B2JB 4J8UC 4QLCD 3MGPB 1P3GB 3REHC 3UTAA 5DNMB 5CPJA 1TZYA 3AZLB 4Z2MG 3WAAB 4J8WC 5DNNC 1P3PD 5B32A 3AN2C 1P3AC 5GXQD 3UTAB 3X1SD 1KX5A 2LY8A 4WU9A 1P3FA 3WTPC 1P3MB 3LZ0C 1P34A 3LZ1B 3B6GB 1B67A 1WWSA 5G49A 3W97B 3AFAC 4R8PD 2NZDC 3C1CB 3VH5T 3TU4A 2BYMA 4Z5TA 4Z66D 4WU9B 5GT3C 1S32B 3W98D 2AROD 1P34B 4WV4B 5B32G 1ZLAB 3W99B 5AV5C 3NQJB 1AOIA 2HUEB 3X1SA 4YS3D 3AV1A 5AVCC 2BYMB 4Z5TB 4X23D 3MVDB 3AZKA 3AZMC 1P3KA 1AOIB 3B0CT 5B31D 4XUJC 3AV1B 5JA4B 1N1JA 5GSUC 1M18C 3VH5W 3WKJC 3LZ1C 4KUDC 3C1CC 4XZQC 4KHAB 5E5AD 4J8VD 4H9PA 5AVBB 4R8PC 3REID 1N1JB 3RELC 1EQZC 4H9NB 3W99C 1ZLAC 5B24A 1P3IC 5JRGC 5GT0B 1F66B 3B0CW 4ZUXC 3MVDC 3AZFD 3V9RA 5B24B 1P3LC 4UUZA 3KWQC 1P3BA 4J8VA 1M19A 4KGCC 3LELA 3V9RB 3MNNB 1HTAA 3UTBC 4UUZB 5B0ZC 1P3BB 4G92C 5CP6C 3MGRD 3AZFA 2NQBD 1KX4A 1ID3C 3VH5A 5AY8A 3LELB 3AZEB 5B1LC 2RVQC 3C1BC 3WA9D 4E45A 2HIOB 1HQ3D 4JJND 3KUYC 1M1AC 4M6BA 5B0YA 1U35B 4YM6C 1KX4B 5AY8B 3MGQC 5AV6A 5CPKC 5BT1D 5B2IA 5B1MD 4ZBJB 5KDMA 3MGRA 5BNVA 4LD9C 4EO5C 3X1TA 2PYOA 2YFVA 2F8NB 3W96C 3O62C 5AV6B 2CWEA 2CV5A 3WA9A 4J8UD 1HQ3A 5BNVB 4JJNA 5AV8C 3REHD 1KX3C 3X1TB 2PYOB 3LJAB 4J8WD 2HIOC 5DNND 3REJD 1P3OB 3AZHC 3AN2D 5C3IB 1P3AD 4AWLB 3X1UC 1BH9A 3AV2D 5BNXB 4NFTA 3WTPD 4CAYA 2IO5B 3LZ0D 3AYWC 3AFAD 4WU8C 3X1VC 2NZDD 1BH9B 5CPIC 5B33C 5GT3D 4CAYB 3MGPD 3AZGC 5AV5D 4HGAB 3KXBB 5AVCD 4Z2MH 3AZJA 3AZNC 4E44A 1JFIA 3MGSA 5F99C 3AZMD 5B40C 4AWLC 3B6FC 3R45A 4J8XB 2FJ7B 3REJC 4XUJD 3UT9A 5AV9C 3AZIA 5GSUD 1BFMA 5CPJB 3AV2C 1M18D 1JFIB 3LZ1D 3B6GD 1TZYB 3WKJD 1R4VA 3A6NC 3REKC 4G91C 4QLCA 5FUGA 3C1CD 4KUDD 4XZQD 5B32B 2YFWA 3AZIB 1S32D 3RELD 1EQZD 2JSSA 1KX5B 1ZLAD 3W99D 3AZMA 1P3ID 5JRGD 1P3FB 5B2JC 3KXBC 1P3PA 3MGPC 1P3GC 5GXQA 5G49B 2YFWB 5DNMC 4ZUXD 3MVDD 3TU4B 3WAAC 3AZLC 1P3LD 1P3PB 3KWQD 3UTAC 5GXQB 2L5AA 4R8PA 4KGCD 3X1SB 1H3OA 4Z66A 1P3IA 5JRGA 1P3MC 3W98A 2AROA 3UTBD 3B6GC 5B32C 5B0ZD 3AZKB 3W97C 1P3KB 5CP6D 1ULYA 4YS3A 1H3OB 1WWIA 1ID3D 4WU9C 1S32C 4X23A 3W98B 5B1LD 2RVQD 3KWQA 3C1BD 1P34C 2HUEC 5B31A 4YS3B 1M1AD 3KUYD 3TU4C 4Z5TC 5BO0A 4YM6D 4H9PB 3MGQD 5CPKD 1AOIC 3AV1C 5B31B 4LD9D 5E5AA 3REIA 3MNND 3O62D 3W96D 3C1BA 3AZKC 4H9SC 4WZSB 5B31G 1M1AA 5AV8D 1KX3D 5E5AB 4J8VB 5AVBC 1M19B 3MGQA 3REIB 5CPKA 5GT0C 2HIOD 2BYKA 5BS7C 3AZHD 4NE3A 1F66C 3X1UD 3O62A 3AZFB 5B24C 3NQUA 3AYWD 1KX3A 2F8ND 4WU8D 3X1VD 2NQBA 1A7WA 5CPID 5B33D 5B0YB 3MNNC 2F8NH 3AZGD 1P3BC 5B2IB 3X1UA 5KDMB 3MGRB 2NQBB 3AZND 3LELC 2YFVB 3AZEC 5F99D 5B40D 5B1MA 3AYWA 2CV5B 3WA9B 3B6FD 1HQ3B 5AV9D 4JJNB 5B33A 1U35C 4H9RA 1KX4C 5AY8C 3AZGA 3A6ND 4ZBJC 5B1MB 4J8UA 3REKD 3REHA 1BH8A 5AV6C 4H9OA 5B40A 4J8WA 3B6FA 5B2JD 5DNNA 3KXBD 4J8UB 3REJA 3AN2A 4NE5A 1P3GD 1P3AA 3X1TC 2PYOC 5DNMD 4CSRA 3LJAC 3AV2A 1BH8B 3A6NA 3AZLD 3WAAD 3WTPA 3VH6T 4J8WB 3LZ0A 1P3OC 5DNNB 5C3IC 3AN2B 1P3AB 3AFAA 3UTAD 2NZDA 3AZJB 4WNNA 1P3MD 2IO5C 3WTPB 5GT3A 5B2JA 3LZ0B 3MGPA 5B32D 3MGSB 5AV5A 3W97D 5DNMA 4DRBA 3AFAB 3R45B 5AVCA 2NZDB 3WAAA 3UT9B 4WU9D 5GT3B 1P34D 3B0BA 3VH6W 5AV5B 4HGAC 4XUJA 1B6WA 5FUGB 5AVCB 4QLCB 3TU4D 4Z5TD 1P3MA 5GSUA 1M18A 3WKJA 3LZ1A 3B6GA 3W97A 3AZMB 4J8XC 2FJ7C 1AOID 4KUDA 3C1CA 3AV1D 4XZQA 4XUJB 3AZJC 1S32A 5GSUB 3RELA 5CPJC 1EQZA 1M18B 1ZLAA 1TZYC 3W99A 3KSYA 3MGSC 3AZKD 3WKJB 3NQJA 1P3KD 4KUDB 3WTPE 4XZQB 3UT9C 5AVBD 3AZIC 4ZUXA 4R8PB 3MVDA 3RELB 1KX5C 1EQZB 4Z66B 1P3IB 1P3FC 5JRGB 1P3LA 5GT0D 4QLCC 2AROB 5JA4A 1F66D 4KGCA 4ZUXB 1Q9CA 4H9SA 5CHLB 5B24D 4NE6A 1P3LB 3VH6A 4X23B 1P3PC 3UTBA 4KHAA 5B0ZA 3KWQB 1TAFA 5CP6A 5GXQC 5AVBA 4H9QA 4KGCB 3X1SC 4H9NA 1ID3A 5BO0B 5GT0A 5BS7A 5B1LA 3UTBB 1P3BD 1F66A 5B0ZB 1P3KC 4G92B 1M19D 1TAFB 5CP6B 4H9QB 3KUYA 4Z66C 3LELD 4YM6A 1ID3B 3AZED 3W98C 2AROC 5B1LB 3C1BB 4YS3C 4LD9A 1M1AB 3KUYB 1U35D 1KX4D 5AY8D 3W96A 4YM6B 3MNNA 4X23C 3MGQB 5CPKB 4DRAA 2BYKB 5B31C 5AV8A 4LD9B 4EO5B 5B0YD 3AZEA 3O62B 3W96B 5AV6D 5B2ID 2HIOA 3AZHA 5AV8B 5E5AC 3NQUB 3X1TD 4J8VC 1U35A 1M19C 1KX3B 2PYOD 3LJAD 3REIC 2F8NK 2CV5D 1P3OD 3AZHB 2F8NA 4WU8A 3X1UB 3X1VA 3B0DB 3AZFC 5CPIA 1KU5A 1F1EA
chains in the Genus database with same CATH superfamily
3H0MC 3AYWB 2Y2OA 4WU8B 3LJAA 3X1VB 2ZY2A 3AZNA 5CPIB 5B0YC 5B33B 4H9RB 1P3OA 1T3UA 5F99A 3AZGB 5B2IC 2F8NG 3KFUG 3MGRC 5BNXA 2NQBC 5AV9A 3REHB 3AZNB 2JE5A 5F99B 2CV5C 4H9OB 5B40B 3WA9C 4J8XD 2FJ7D 3REKA 3B6FB 1HQ3C 3REJB 3B0DC 3AZJD 4JJNC 5AV9B 2W8SA 4CSRB 5CPJD 3AV2B 1TZYD 3MGSD 5BT1C 3A6NB 5B1MC 1PZRA 2ZM5A 3KXBA 3REKB 4G91B 1P3GA 3UT9D 3AZID 1KX5D 3AZLA 4J8XA 4WNNB 1P3FD 2FJ7A 5B2JB 4J8UC 4QLCD 3MGPB 1P3GB 3REHC 3UTAA 5DNMB 5CPJA 1TZYA 3AZLB 4Z2MG 3WAAB 4J8WC 5DNNC 1P3PD 5B32A 3AN2C 1P3AC 2G5HC 5GXQD 3UTAB 3X1SD 1KX5A 2LY8A 4WU9A 1P3FA 3WTPC 1P3MB 3LZ0C 1P34A 3LZ1B 3B6GB 1B67A 1WWSA 5G49A 3W97B 3AFAC 4R8PD 2NZDC 3C1CB 3EPHA 3VH5T 3TU4A 2BYMA 4Z5TA 4Z66D 4WU9B 5GT3C 1S32B 3W98D 2AROD 1P34B 4WV4B 5B32G 1ZLAB 3W99B 5AV5C 3NQJB 1AOIA 2HUEB 3X1SA 4YS3D 3AV1A 5AVCC 2BYMB 4Z5TB 4X23D 3MVDB 3AZKA 3AZMC 1P3KA 1AOIB 3B0CT 5B31D 4XUJC 3AV1B 5JA4B 1N1JA 5GSUC 1M18C 2ZY4A 3VH5W 3LZ1C 3WKJC 4KUDC 3C1CC 4XZQC 4KHAB 5E5AD 4J8VD 2Y2GA 4H9PA 1Z2CB 5AVBB 4R8PC 3REID 1N1JB 3RELC 1EQZC 4H9NB 3W99C 1ZLAC 5B24A 1P3IC 5JRGC 1W2EA 5GT0B 2UWXA 2JCHA 1F66B 3B0CW 4ZUXC 3MVDC 3AZFD 2G5IC 3V9RA 5B24B 1P3LC 2Y2QA 2Y2HA 4UUZA 3KWQC 1P3BA 4J8VA 1M19A 4KGCC 3LELA 3V9RB 3MNNB 1HTAA 3UTBC 4UUZB 5B0ZC 1P3BB 4G92C 5CP6C 3MGRD 3AZFA 2NQBD 1KX4A 1ID3C 3VH5A 5AY8A 3LELB 3AZEB 5B1LC 2RVQC 3C1BC 3WA9D 2BG1A 4E45A 2HIOB 1HQ3D 4JJND 3KUYC 1M1AC 4M6BA 5B0YA 1U35B 4YM6C 1KX4B 5AY8B 3MGQC 5AV6A 5CPKC 5BT1D 5B2IA 5B1MD 4ZBJB 5KDMA 3MGRA 5BNVA 4LD9C 4EO5C 3X1TA 2PYOA 2YFVA 2F8NB 3P5JB 3W96C 3O62C 4UPKA 5AV6B 2CWEA 2CV5A 3WA9A 4J8UD 1HQ3A 5BNVB 4JJNA 5AV8C 3REHD 1KX3C 3X1TB 2PYOB 2F2AC 3LJAB 3F6TA 4J8WD 2HIOC 5DNND 3REJD 1P3OB 3AZHC 3AN2D 5C3IB 1P3AD 4AWLB 3X1UC 1BH9A 3AV2D 5BNXB 4NFTA 3WTPD 4CAYA 2IO5B 3LZ0D 3AYWC 3AFAD 4WU8C 3X1VC 2NZDD 1BH9B 5CPIC 5B33C 5GT3D 4CAYB 2XD1A 3MGPD 3AZGC 5AV5D 4DQYB 4HGAB 3KXBB 5AVCD 4Z2MH 3AZJA 3AZNC 4E44A 1JFIA 3MGSA 5F99C 3AZMD 5B40C 4AWLC 3B6FC 3R45A 4J8XB 2FJ7B 3REJC 4XUJD 3UT9A 5AV9C 3AZIA 5GSUD 1BFMA 5CPJB 3AV2C 1M18D 1JFIB 3LZ1D 3B6GD 1TZYB 3WKJD 1R4VA 3A6NC 3AL0C 3REKC 4G91C 4QLCA 5FUGA 3C1CD 4KUDD 4XZQD 5B32B 2YFWA 3AZIB 1S32D 2ZY5A 3RELD 1EQZD 2JSSA 1KX5B 1ZLAD 3W99D 3AZMA 1P3ID 5JRGD 1P3FB 5B2JC 3KXBC 1P3PA 3MGPC 1P3GC 5GXQA 5G49B 2YFWB 5DNMC 4ZUXD 3MVDD 3TU4B 3WAAC 3AZLC 1P3LD 1P3PB 3KWQD 3UTAC 5GXQB 2L5AA 4R8PA 4KGCD 3X1SB 1H3OA 4Z66A 1P3IA 3EPLA 5JRGA 1P3MC 3W98A 2AROA 3UTBD 3B6GC 5B32C 5B0ZD 3AZKB 3W97C 1P3KB 5CP6D 1ULYA 4YS3A 1H3OB 1WWIA 1ID3D 4WU9C 1S32C 4X23A 3W98B 5B1LD 2RVQD 3KWQA 3C1BD 1P34C 2HUEC 2RIQA 5B31A 4YS3B 1M1AD 3KUYD 3TU4C 4Z5TC 5BO0A 4YM6D 4H9PB 3H0LC 3MGQD 2ZY3A 2Y2PA 5CPKD 1AOIC 3AV1C 5B31B 4LD9D 5E5AA 2FFFB 3REIA 3MNND 3O62D 3W96D 3C1BA 3FDDA 3AZKC 4H9SC 4WZSB 5B31G 1M1AA 5AV8D 1KX3D 5E5AB 4J8VB 5AVBC 1M19B 3MGQA 3REIB 2Y2MA 5CPKA 2VQRA 2Y2JA 5GT0C 2HIOD 2DQNC 2BYKA 5BS7C 3AZHD 4NE3A 1F66C 3X1UD 3O62A 3AZFB 5B24C 3IP4C 3NQUA 3AYWD 1KX3A 2F8ND 4WU8D 3X1VD 2NQBA 1A7WA 5CPID 5B33D 5B0YB 3MNNC 2F8NH 3AZGD 1P3BC 5B2IB 3X1UA 5KDMB 3MGRB 3EPJA 3A1IA 2NQBB 3AZND 3LELC 2YFVB 3AZEC 5F99D 5B40D 5B1MA 3AYWA 2CV5B 3WA9B 3B6FD 2Y2LA 1HQ3B 5AV9D 4JJNB 5B33A 1U35C 4H9RA 1KX4C 5AY8C 3AZGA 3A6ND 4ZBJC 5B1MB 4J8UA 3REKD 3REHA 1BH8A 5AV6C 4H9OA 5B40A 4J8WA 3B6FA 5B2JD 5DNNA 3KXBD 4J8UB 3REJA 3AN2A 4NE5A 1P3GD 1P3AA 3X1TC 2PYOC 5DNMD 4CSRA 3LJAC 3AV2A 1BH8B 3A6NA 3AZLD 3WAAD 3WTPA 3VH6T 4J8WB 3LZ0A 1P3OC 5DNNB 5C3IC 3AN2B 1P3AB 3AFAA 3UTAD 2NZDA 3AZJB 3H0RC 4WNNA 1P3MD 2IO5C 3WTPB 5GT3A 5B2JA 3LZ0B 3MGPA 5B32D 3MGSB 5AV5A 3W97D 5DNMA 4DRBA 3AFAB 3R45B 5AVCA 2NZDB 3WAAA 3UT9B 4WU9D 5GT3B 1P34D 3B0BA 3VH6W 5AV5B 4HGAC 4XUJA 1B6WA 5FUGB 5AVCB 4QLCB 3TU4D 4Z5TD 1P3MA 5GSUA 1M18A 3WKJA 3LZ1A 3B6GA 3W97A 3AZMB 4J8XC 2FJ7C 1AOID 4KUDA 3C1CA 3AV1D 4XZQA 4XUJB 3AZJC 1S32A 3A1KA 5GSUB 3RELA 5CPJC 1EQZA 1M18B 1ZLAA 1TZYC 3W99A 3KSYA 3MGSC 3AZKD 3WKJB 3NQJA 1P3KD 4KUDB 3WTPE 4XZQB 3UT9C 5AVBD 3AZIC 4ZUXA 4R8PB 3MVDA 3RELB 1KX5C 1EQZB 4Z66B 1P3IB 1P3FC 5JRGB 1P3LA 5GT0D 4QLCC 2AROB 5JA4A 1F66D 4KGCA 2Y2NA 4ZUXB 1Q9CA 4H9SA 5CHLB 5B24D 4NE6A 1P3LB 3VH6A 4X23B 1P3PC 3UTBA 4KHAA 5B0ZA 3KWQB 1TAFA 5CP6A 5GXQC 5AVBA 4H9QA 4KGCB 3X1SC 4H9NA 1ID3A 5BO0B 5GT0A 5BS7A 5B1LA 3UTBB 1P3BD 1F66A 5B0ZB 1P3KC 4G92B 1M19D 1TAFB 5CP6B 4H9QB 3KUYA 4Z66C 3LELD 4YM6A 1ID3B 2Y2KA 3AZED 3W98C 2AROC 2DF4C 5B1LB 3C1BB 2Y2IA 4YS3C 4LD9A 4WJ3C 1M1AB 3KUYB 3EPKA 1U35D 1KX4D 5AY8D 2J8PA 3W96A 4YM6B 3MNNA 4X23C 3MGQB 5CPKB 4DRAA 2BYKB 5B31C 5AV8A 4LD9B 4EO5B 5B0YD 3AZEA 3O62B 3EG5B 5AV6D 3W96B 5B2ID 2HIOA 3AZHA 5AV8B 5E5AC 3NQUB 3X1TD 4J8VC 1U35A 1M19C 1KX3B 2PYOD 3LJAD 3REIC 2XD5A 2F8NK 2CV5D 1P3OD 3AZHB 2F8NA 4WU8A 3X1UB 3X1VA 3B0DB 3AZFC 5CPIA 1KU5A 1F1EA
chains in the Genus database with same CATH topology
3H0MC 3AYWB 2Y2OA 4WU8B 3LJAA 3X1VB 2ZY2A 3AZNA 5CPIB 5B0YC 5B33B 4H9RB 1P3OA 1T3UA 5F99A 3AZGB 5B2IC 2F8NG 3KFUG 3MGRC 5BNXA 2NQBC 5AV9A 3REHB 3AZNB 2JE5A 5F99B 2CV5C 4H9OB 5B40B 3WA9C 4J8XD 2FJ7D 3REKA 3B6FB 1HQ3C 3REJB 3B0DC 3AZJD 4JJNC 5AV9B 2W8SA 4CSRB 5CPJD 3AV2B 1TZYD 3MGSD 5BT1C 3A6NB 5B1MC 1PZRA 2ZM5A 3KXBA 3REKB 4G91B 1P3GA 3UT9D 3AZID 1KX5D 3AZLA 4J8XA 4WNNB 1P3FD 2FJ7A 5B2JB 4J8UC 4QLCD 3MGPB 1P3GB 3REHC 3UTAA 5DNMB 5CPJA 1TZYA 3AZLB 4Z2MG 3WAAB 4J8WC 5DNNC 1P3PD 5B32A 3AN2C 1P3AC 2G5HC 5GXQD 3UTAB 3X1SD 1KX5A 2LY8A 4WU9A 1P3FA 3WTPC 1P3MB 3LZ0C 1P34A 3LZ1B 3B6GB 1B67A 1WWSA 5G49A 3W97B 3AFAC 4R8PD 2NZDC 3C1CB 3EPHA 3VH5T 3TU4A 2BYMA 4Z5TA 4Z66D 4WU9B 5GT3C 1S32B 3W98D 2AROD 1P34B 4WV4B 5B32G 1ZLAB 3W99B 5AV5C 3NQJB 1AOIA 2HUEB 3X1SA 4YS3D 3AV1A 5AVCC 2BYMB 4Z5TB 4X23D 3MVDB 3AZKA 3AZMC 1P3KA 1AOIB 3B0CT 5B31D 4XUJC 3AV1B 5JA4B 1N1JA 5GSUC 1M18C 2ZY4A 3VH5W 3LZ1C 3WKJC 4KUDC 3C1CC 4XZQC 4KHAB 5E5AD 4J8VD 2Y2GA 4H9PA 1Z2CB 5AVBB 4R8PC 3REID 1N1JB 3RELC 1EQZC 4H9NB 3W99C 1ZLAC 5B24A 1P3IC 5JRGC 1W2EA 5GT0B 2UWXA 2JCHA 1F66B 3B0CW 4ZUXC 3MVDC 3AZFD 2G5IC 3V9RA 5B24B 1P3LC 2Y2QA 2Y2HA 4UUZA 3KWQC 1P3BA 4J8VA 1M19A 4KGCC 3LELA 3V9RB 3MNNB 1HTAA 3UTBC 4UUZB 5B0ZC 1P3BB 4G92C 5CP6C 3MGRD 3AZFA 2NQBD 1KX4A 1ID3C 3VH5A 5AY8A 3LELB 3AZEB 5B1LC 2RVQC 3C1BC 3WA9D 2BG1A 4E45A 2HIOB 1HQ3D 4JJND 3KUYC 1M1AC 4M6BA 5B0YA 1U35B 4YM6C 1KX4B 5AY8B 3MGQC 5AV6A 5CPKC 5BT1D 5B2IA 5B1MD 4ZBJB 5KDMA 3MGRA 5BNVA 4LD9C 4EO5C 3X1TA 2PYOA 2YFVA 2F8NB 3P5JB 3W96C 3O62C 4UPKA 5AV6B 2CWEA 2CV5A 3WA9A 4J8UD 1HQ3A 5BNVB 4JJNA 5AV8C 3REHD 1KX3C 3X1TB 2PYOB 2F2AC 3LJAB 3F6TA 4J8WD 2HIOC 5DNND 3REJD 1P3OB 3AZHC 3AN2D 5C3IB 1P3AD 4AWLB 3X1UC 1BH9A 3AV2D 5BNXB 4NFTA 3WTPD 4CAYA 2IO5B 3LZ0D 3AYWC 3AFAD 4WU8C 3X1VC 2NZDD 1BH9B 5CPIC 5B33C 5GT3D 4CAYB 2XD1A 3MGPD 3AZGC 5AV5D 4DQYB 4HGAB 3KXBB 5AVCD 4Z2MH 3AZJA 3AZNC 4E44A 1JFIA 3MGSA 5F99C 3AZMD 5B40C 4AWLC 3B6FC 3R45A 4J8XB 2FJ7B 3REJC 4XUJD 3UT9A 5AV9C 3AZIA 5GSUD 1BFMA 5CPJB 3AV2C 1M18D 1JFIB 3LZ1D 3B6GD 1TZYB 3WKJD 1R4VA 3A6NC 3AL0C 3REKC 4G91C 4QLCA 5FUGA 3C1CD 4KUDD 4XZQD 5B32B 2YFWA 3AZIB 1S32D 2ZY5A 3RELD 1EQZD 2JSSA 1KX5B 1ZLAD 3W99D 3AZMA 1P3ID 5JRGD 1P3FB 5B2JC 3KXBC 1P3PA 3MGPC 1P3GC 5GXQA 5G49B 2YFWB 5DNMC 4ZUXD 3MVDD 3TU4B 3WAAC 3AZLC 1P3LD 1P3PB 3KWQD 3UTAC 5GXQB 2L5AA 4R8PA 4KGCD 3X1SB 1H3OA 4Z66A 1P3IA 3EPLA 5JRGA 1P3MC 3W98A 2AROA 3UTBD 3B6GC 5B32C 5B0ZD 3AZKB 3W97C 1P3KB 5CP6D 1ULYA 4YS3A 1H3OB 1WWIA 1ID3D 4WU9C 1S32C 4X23A 3W98B 5B1LD 2RVQD 3KWQA 3C1BD 1P34C 2HUEC 2RIQA 5B31A 4YS3B 1M1AD 3KUYD 3TU4C 4Z5TC 5BO0A 4YM6D 4H9PB 3H0LC 3MGQD 2ZY3A 2Y2PA 5CPKD 1AOIC 3AV1C 5B31B 4LD9D 5E5AA 2FFFB 3REIA 3MNND 3O62D 3W96D 3C1BA 3FDDA 3AZKC 4H9SC 4WZSB 5B31G 1M1AA 5AV8D 1KX3D 5E5AB 4J8VB 5AVBC 1M19B 3MGQA 3REIB 2Y2MA 5CPKA 2VQRA 2Y2JA 5GT0C 2HIOD 2DQNC 2BYKA 5BS7C 3AZHD 4NE3A 1F66C 3X1UD 3O62A 3AZFB 5B24C 3IP4C 3NQUA 3AYWD 1KX3A 2F8ND 4WU8D 3X1VD 2NQBA 1A7WA 5CPID 5B33D 5B0YB 3MNNC 2F8NH 3AZGD 1P3BC 5B2IB 3X1UA 5KDMB 3MGRB 3EPJA 3A1IA 2NQBB 3AZND 3LELC 2YFVB 3AZEC 5F99D 5B40D 5B1MA 3AYWA 2CV5B 3WA9B 3B6FD 2Y2LA 1HQ3B 5AV9D 4JJNB 5B33A 1U35C 4H9RA 1KX4C 5AY8C 3AZGA 3A6ND 4ZBJC 5B1MB 4J8UA 3REKD 3REHA 1BH8A 5AV6C 4H9OA 5B40A 4J8WA 3B6FA 5B2JD 5DNNA 3KXBD 4J8UB 3REJA 3AN2A 4NE5A 1P3GD 1P3AA 3X1TC 2PYOC 5DNMD 4CSRA 3LJAC 3AV2A 1BH8B 3A6NA 3AZLD 3WAAD 3WTPA 3VH6T 4J8WB 3LZ0A 1P3OC 5DNNB 5C3IC 3AN2B 1P3AB 3AFAA 3UTAD 2NZDA 3AZJB 3H0RC 4WNNA 1P3MD 2IO5C 3WTPB 5GT3A 5B2JA 3LZ0B 3MGPA 5B32D 3MGSB 5AV5A 3W97D 5DNMA 4DRBA 3AFAB 3R45B 5AVCA 2NZDB 3WAAA 3UT9B 4WU9D 5GT3B 1P34D 3B0BA 3VH6W 5AV5B 4HGAC 4XUJA 1B6WA 5FUGB 5AVCB 4QLCB 3TU4D 4Z5TD 1P3MA 5GSUA 1M18A 3WKJA 3LZ1A 3B6GA 3W97A 3AZMB 4J8XC 2FJ7C 1AOID 4KUDA 3C1CA 3AV1D 4XZQA 4XUJB 3AZJC 1S32A 3A1KA 5GSUB 3RELA 5CPJC 1EQZA 1M18B 1ZLAA 1TZYC 3W99A 3KSYA 3MGSC 3AZKD 3WKJB 3NQJA 1P3KD 4KUDB 3WTPE 4XZQB 3UT9C 5AVBD 3AZIC 4ZUXA 4R8PB 3MVDA 3RELB 1KX5C 1EQZB 4Z66B 1P3IB 1P3FC 5JRGB 1P3LA 5GT0D 4QLCC 2AROB 5JA4A 1F66D 4KGCA 2Y2NA 4ZUXB 1Q9CA 4H9SA 5CHLB 5B24D 4NE6A 1P3LB 3VH6A 4X23B 1P3PC 3UTBA 4KHAA 5B0ZA 3KWQB 1TAFA 5CP6A 5GXQC 5AVBA 4H9QA 4KGCB 3X1SC 4H9NA 1ID3A 5BO0B 5GT0A 5BS7A 5B1LA 3UTBB 1P3BD 1F66A 5B0ZB 1P3KC 4G92B 1M19D 1TAFB 5CP6B 4H9QB 3KUYA 4Z66C 3LELD 4YM6A 1ID3B 2Y2KA 3AZED 3W98C 2AROC 2DF4C 5B1LB 3C1BB 2Y2IA 4YS3C 4LD9A 4WJ3C 1M1AB 3KUYB 3EPKA 1U35D 1KX4D 5AY8D 2J8PA 3W96A 4YM6B 3MNNA 4X23C 3MGQB 5CPKB 4DRAA 2BYKB 5B31C 5AV8A 4LD9B 4EO5B 5B0YD 3AZEA 3O62B 3EG5B 5AV6D 3W96B 5B2ID 2HIOA 3AZHA 5AV8B 5E5AC 3NQUB 3X1TD 4J8VC 1U35A 1M19C 1KX3B 2PYOD 3LJAD 3REIC 2XD5A 2F8NK 2CV5D 1P3OD 3AZHB 2F8NA 4WU8A 3X1UB 3X1VA 3B0DB 3AZFC 5CPIA 1KU5A 1F1EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AYW B;  4WU8 B;  3LJA A;  3X1V B;  3AZN A;  5CPI B;  5B0Y C;  5B33 B;  4H9R B;  1P3O A;  5F99 A;  3AZG B;  5B2I C;  2F8N G;  3MGR C;  5BNX A;  2NQB C;  5AV9 A;  3REH B;  3AZN B;  5F99 B;  2CV5 C;  4H9O B;  5B40 B;  3WA9 C;  4J8X D;  2FJ7 D;  3REK A;  3B6F B;  1HQ3 C;  3REJ B;  3B0D C;  3AZJ D;  4JJN C;  5AV9 B;  4CSR B;  5CPJ D;  3AV2 B;  1TZY D;  3MGS D;  5BT1 C;  3A6N B;  5B1M C;  3KXB A;  3REK B;  4G91 B;  1P3G A;  3UT9 D;  3AZI D;  1KX5 D;  3AZL A;  4J8X A;  4WNN B;  1P3F D;  2FJ7 A;  5B2J B;  4J8U C;  4QLC D;  3MGP B;  1P3G B;  3REH C;  3UTA A;  5DNM B;  5CPJ A;  1TZY A;  3AZL B;  4Z2M G;  3WAA B;  4J8W C;  5DNN C;  1P3P D;  5B32 A;  3AN2 C;  1P3A C;  5GXQ D;  3UTA B;  3X1S D;  1KX5 A;  2LY8 A;  4WU9 A;  1P3F A;  3WTP C;  1P3M B;  3LZ0 C;  1P34 A;  3LZ1 B;  3B6G B;  1B67 A;  1WWS A;  5G49 A;  3W97 B;  3AFA C;  4R8P D;  2NZD C;  3C1C B;  3VH5 T;  3TU4 A;  2BYM A;  4Z5T A;  4Z66 D;  4WU9 B;  5GT3 C;  1S32 B;  3W98 D;  2ARO D;  1P34 B;  4WV4 B;  5B32 G;  1ZLA B;  3W99 B;  5AV5 C;  3NQJ B;  1AOI A;  2HUE B;  3X1S A;  4YS3 D;  3AV1 A;  5AVC C;  2BYM B;  4Z5T B;  4X23 D;  3MVD B;  3AZK A;  3AZM C;  1P3K A;  1AOI B;  3B0C T;  5B31 D;  4XUJ C;  3AV1 B;  5JA4 B;  1N1J A;  5GSU C;  1M18 C;  3VH5 W;  3WKJ C;  3LZ1 C;  4KUD C;  3C1C C;  4XZQ C;  4KHA B;  5E5A D;  4J8V D;  4H9P A;  5AVB B;  4R8P C;  3REI D;  1N1J B;  3REL C;  1EQZ C;  4H9N B;  3W99 C;  1ZLA C;  5B24 A;  1P3I C;  5JRG C;  5GT0 B;  1F66 B;  3B0C W;  4ZUX C;  3MVD C;  3AZF D;  3V9R A;  5B24 B;  1P3L C;  4UUZ A;  3KWQ C;  1P3B A;  4J8V A;  1M19 A;  4KGC C;  3LEL A;  3V9R B;  3MNN B;  1HTA A;  3UTB C;  4UUZ B;  5B0Z C;  1P3B B;  4G92 C;  5CP6 C;  3MGR D;  3AZF A;  2NQB D;  1KX4 A;  1ID3 C;  3VH5 A;  5AY8 A;  3LEL B;  3AZE B;  5B1L C;  2RVQ C;  3C1B C;  3WA9 D;  4E45 A;  2HIO B;  1HQ3 D;  4JJN D;  3KUY C;  1M1A C;  4M6B A;  5B0Y A;  1U35 B;  4YM6 C;  1KX4 B;  5AY8 B;  3MGQ C;  5AV6 A;  5CPK C;  5BT1 D;  5B2I A;  5B1M D;  4ZBJ B;  5KDM A;  3MGR A;  5BNV A;  4LD9 C;  4EO5 C;  3X1T A;  2PYO A;  2YFV A;  2F8N B;  3W96 C;  3O62 C;  5AV6 B;  2CWE A;  2CV5 A;  3WA9 A;  4J8U D;  1HQ3 A;  5BNV B;  4JJN A;  5AV8 C;  3REH D;  1KX3 C;  3X1T B;  2PYO B;  3LJA B;  4J8W D;  2HIO C;  5DNN D;  3REJ D;  1P3O B;  3AZH C;  3AN2 D;  5C3I B;  1P3A D;  4AWL B;  3X1U C;  1BH9 A;  3AV2 D;  5BNX B;  4NFT A;  3WTP D;  4CAY A;  2IO5 B;  3LZ0 D;  3AYW C;  3AFA D;  4WU8 C;  3X1V C;  2NZD D;  1BH9 B;  5CPI C;  5B33 C;  5GT3 D;  4CAY B;  3MGP D;  3AZG C;  5AV5 D;  4HGA B;  3KXB B;  5AVC D;  4Z2M H;  3AZJ A;  3AZN C;  4E44 A;  1JFI A;  3MGS A;  5F99 C;  3AZM D;  5B40 C;  4AWL C;  3B6F C;  3R45 A;  4J8X B;  2FJ7 B;  3REJ C;  4XUJ D;  3UT9 A;  5AV9 C;  3AZI A;  5GSU D;  1BFM A;  5CPJ B;  3AV2 C;  1M18 D;  1JFI B;  3LZ1 D;  3B6G D;  1TZY B;  3WKJ D;  1R4V A;  3A6N C;  3REK C;  4G91 C;  4QLC A;  5FUG A;  3C1C D;  4KUD D;  4XZQ D;  5B32 B;  2YFW A;  3AZI B;  1S32 D;  3REL D;  1EQZ D;  2JSS A;  1KX5 B;  1ZLA D;  3W99 D;  3AZM A;  1P3I D;  5JRG D;  1P3F B;  5B2J C;  3KXB C;  1P3P A;  3MGP C;  1P3G C;  5GXQ A;  5G49 B;  2YFW B;  5DNM C;  4ZUX D;  3MVD D;  3TU4 B;  3WAA C;  3AZL C;  1P3L D;  1P3P B;  3KWQ D;  3UTA C;  5GXQ B;  2L5A A;  4R8P A;  4KGC D;  3X1S B;  1H3O A;  4Z66 A;  1P3I A;  5JRG A;  1P3M C;  3W98 A;  2ARO A;  3UTB D;  3B6G C;  5B32 C;  5B0Z D;  3AZK B;  3W97 C;  1P3K B;  5CP6 D;  1ULY A;  4YS3 A;  1H3O B;  1WWI A;  1ID3 D;  4WU9 C;  1S32 C;  4X23 A;  3W98 B;  5B1L D;  2RVQ D;  3KWQ A;  3C1B D;  1P34 C;  2HUE C;  5B31 A;  4YS3 B;  1M1A D;  3KUY D;  3TU4 C;  4Z5T C;  5BO0 A;  4YM6 D;  4H9P B;  3MGQ D;  5CPK D;  1AOI C;  3AV1 C;  5B31 B;  4LD9 D;  5E5A A;  3REI A;  3MNN D;  3O62 D;  3W96 D;  3C1B A;  3AZK C;  4H9S C;  4WZS B;  5B31 G;  1M1A A;  5AV8 D;  1KX3 D;  5E5A B;  4J8V B;  5AVB C;  1M19 B;  3MGQ A;  3REI B;  5CPK A;  5GT0 C;  2HIO D;  2BYK A;  5BS7 C;  3AZH D;  4NE3 A;  1F66 C;  3X1U D;  3O62 A;  3AZF B;  5B24 C;  3NQU A;  3AYW D;  1KX3 A;  2F8N D;  4WU8 D;  3X1V D;  2NQB A;  1A7W A;  5CPI D;  5B33 D;  5B0Y B;  3MNN C;  2F8N H;  3AZG D;  1P3B C;  5B2I B;  3X1U A;  5KDM B;  3MGR B;  2NQB B;  3AZN D;  3LEL C;  2YFV B;  3AZE C;  5F99 D;  5B40 D;  5B1M A;  3AYW A;  2CV5 B;  3WA9 B;  3B6F D;  1HQ3 B;  5AV9 D;  4JJN B;  5B33 A;  1U35 C;  4H9R A;  1KX4 C;  5AY8 C;  3AZG A;  3A6N D;  4ZBJ C;  5B1M B;  4J8U A;  3REK D;  3REH A;  1BH8 A;  5AV6 C;  4H9O A;  5B40 A;  4J8W A;  3B6F A;  5B2J D;  5DNN A;  3KXB D;  4J8U B;  3REJ A;  3AN2 A;  4NE5 A;  1P3G D;  1P3A A;  3X1T C;  2PYO C;  5DNM D;  4CSR A;  3LJA C;  3AV2 A;  1BH8 B;  3A6N A;  3AZL D;  3WAA D;  3WTP A;  3VH6 T;  4J8W B;  3LZ0 A;  1P3O C;  5DNN B;  5C3I C;  3AN2 B;  1P3A B;  3AFA A;  3UTA D;  2NZD A;  3AZJ B;  4WNN A;  1P3M D;  2IO5 C;  3WTP B;  5GT3 A;  5B2J A;  3LZ0 B;  3MGP A;  5B32 D;  3MGS B;  5AV5 A;  3W97 D;  5DNM A;  4DRB A;  3AFA B;  3R45 B;  5AVC A;  2NZD B;  3WAA A;  3UT9 B;  4WU9 D;  5GT3 B;  1P34 D;  3B0B A;  3VH6 W;  5AV5 B;  4HGA C;  4XUJ A;  1B6W A;  5FUG B;  5AVC B;  4QLC B;  3TU4 D;  4Z5T D;  1P3M A;  5GSU A;  1M18 A;  3WKJ A;  3LZ1 A;  3B6G A;  3W97 A;  3AZM B;  4J8X C;  2FJ7 C;  1AOI D;  4KUD A;  3C1C A;  3AV1 D;  4XZQ A;  4XUJ B;  3AZJ C;  1S32 A;  5GSU B;  3REL A;  5CPJ C;  1EQZ A;  1M18 B;  1ZLA A;  1TZY C;  3W99 A;  3KSY A;  3MGS C;  3AZK D;  3WKJ B;  3NQJ A;  1P3K D;  4KUD B;  3WTP E;  4XZQ B;  3UT9 C;  5AVB D;  3AZI C;  4ZUX A;  4R8P B;  3MVD A;  3REL B;  1KX5 C;  1EQZ B;  4Z66 B;  1P3I B;  1P3F C;  5JRG B;  1P3L A;  5GT0 D;  4QLC C;  2ARO B;  5JA4 A;  1F66 D;  4KGC A;  4ZUX B;  1Q9C A;  4H9S A;  5CHL B;  5B24 D;  4NE6 A;  1P3L B;  3VH6 A;  4X23 B;  1P3P C;  3UTB A;  4KHA A;  5B0Z A;  3KWQ B;  1TAF A;  5CP6 A;  5GXQ C;  5AVB A;  4H9Q A;  4KGC B;  3X1S C;  4H9N A;  1ID3 A;  5BO0 B;  5GT0 A;  5BS7 A;  5B1L A;  3UTB B;  1P3B D;  1F66 A;  5B0Z B;  1P3K C;  4G92 B;  1M19 D;  1TAF B;  5CP6 B;  4H9Q B;  3KUY A;  4Z66 C;  3LEL D;  4YM6 A;  1ID3 B;  3AZE D;  3W98 C;  2ARO C;  5B1L B;  3C1B B;  4YS3 C;  4LD9 A;  1M1A B;  3KUY B;  1U35 D;  1KX4 D;  5AY8 D;  3W96 A;  4YM6 B;  3MNN A;  4X23 C;  3MGQ B;  5CPK B;  4DRA A;  2BYK B;  5B31 C;  5AV8 A;  4LD9 B;  4EO5 B;  5B0Y D;  3AZE A;  3O62 B;  3W96 B;  5AV6 D;  5B2I D;  2HIO A;  3AZH A;  5AV8 B;  5E5A C;  3NQU B;  3X1T D;  4J8V C;  1U35 A;  1M19 C;  1KX3 B;  2PYO D;  3LJA D;  3REI C;  2F8N K;  2CV5 D;  1P3O D;  3AZH B;  2F8N A;  4WU8 A;  3X1U B;  3X1V A;  3B0D B;  3AZF C;  5CPI A;  1KU5 A;  1F1E A; 
#chains in the Genus database with same CATH topology
 3H0M C;  3AYW B;  2Y2O A;  4WU8 B;  3LJA A;  3X1V B;  2ZY2 A;  3AZN A;  5CPI B;  5B0Y C;  5B33 B;  4H9R B;  1P3O A;  1T3U A;  5F99 A;  3AZG B;  5B2I C;  2F8N G;  3KFU G;  3MGR C;  5BNX A;  2NQB C;  5AV9 A;  3REH B;  3AZN B;  2JE5 A;  5F99 B;  2CV5 C;  4H9O B;  5B40 B;  3WA9 C;  4J8X D;  2FJ7 D;  3REK A;  3B6F B;  1HQ3 C;  3REJ B;  3B0D C;  3AZJ D;  4JJN C;  5AV9 B;  2W8S A;  4CSR B;  5CPJ D;  3AV2 B;  1TZY D;  3MGS D;  5BT1 C;  3A6N B;  5B1M C;  1PZR A;  2ZM5 A;  3KXB A;  3REK B;  4G91 B;  1P3G A;  3UT9 D;  3AZI D;  1KX5 D;  3AZL A;  4J8X A;  4WNN B;  1P3F D;  2FJ7 A;  5B2J B;  4J8U C;  4QLC D;  3MGP B;  1P3G B;  3REH C;  3UTA A;  5DNM B;  5CPJ A;  1TZY A;  3AZL B;  4Z2M G;  3WAA B;  4J8W C;  5DNN C;  1P3P D;  5B32 A;  3AN2 C;  1P3A C;  2G5H C;  5GXQ D;  3UTA B;  3X1S D;  1KX5 A;  2LY8 A;  4WU9 A;  1P3F A;  3WTP C;  1P3M B;  3LZ0 C;  1P34 A;  3LZ1 B;  3B6G B;  1B67 A;  1WWS A;  5G49 A;  3W97 B;  3AFA C;  4R8P D;  2NZD C;  3C1C B;  3EPH A;  3VH5 T;  3TU4 A;  2BYM A;  4Z5T A;  4Z66 D;  4WU9 B;  5GT3 C;  1S32 B;  3W98 D;  2ARO D;  1P34 B;  4WV4 B;  5B32 G;  1ZLA B;  3W99 B;  5AV5 C;  3NQJ B;  1AOI A;  2HUE B;  3X1S A;  4YS3 D;  3AV1 A;  5AVC C;  2BYM B;  4Z5T B;  4X23 D;  3MVD B;  3AZK A;  3AZM C;  1P3K A;  1AOI B;  3B0C T;  5B31 D;  4XUJ C;  3AV1 B;  5JA4 B;  1N1J A;  5GSU C;  1M18 C;  2ZY4 A;  3VH5 W;  3LZ1 C;  3WKJ C;  4KUD C;  3C1C C;  4XZQ C;  4KHA B;  5E5A D;  4J8V D;  2Y2G A;  4H9P A;  1Z2C B;  5AVB B;  4R8P C;  3REI D;  1N1J B;  3REL C;  1EQZ C;  4H9N B;  3W99 C;  1ZLA C;  5B24 A;  1P3I C;  5JRG C;  1W2E A;  5GT0 B;  2UWX A;  2JCH A;  1F66 B;  3B0C W;  4ZUX C;  3MVD C;  3AZF D;  2G5I C;  3V9R A;  5B24 B;  1P3L C;  2Y2Q A;  2Y2H A;  4UUZ A;  3KWQ C;  1P3B A;  4J8V A;  1M19 A;  4KGC C;  3LEL A;  3V9R B;  3MNN B;  1HTA A;  3UTB C;  4UUZ B;  5B0Z C;  1P3B B;  4G92 C;  5CP6 C;  3MGR D;  3AZF A;  2NQB D;  1KX4 A;  1ID3 C;  3VH5 A;  5AY8 A;  3LEL B;  3AZE B;  5B1L C;  2RVQ C;  3C1B C;  3WA9 D;  2BG1 A;  4E45 A;  2HIO B;  1HQ3 D;  4JJN D;  3KUY C;  1M1A C;  4M6B A;  5B0Y A;  1U35 B;  4YM6 C;  1KX4 B;  5AY8 B;  3MGQ C;  5AV6 A;  5CPK C;  5BT1 D;  5B2I A;  5B1M D;  4ZBJ B;  5KDM A;  3MGR A;  5BNV A;  4LD9 C;  4EO5 C;  3X1T A;  2PYO A;  2YFV A;  2F8N B;  3P5J B;  3W96 C;  3O62 C;  4UPK A;  5AV6 B;  2CWE A;  2CV5 A;  3WA9 A;  4J8U D;  1HQ3 A;  5BNV B;  4JJN A;  5AV8 C;  3REH D;  1KX3 C;  3X1T B;  2PYO B;  2F2A C;  3LJA B;  3F6T A;  4J8W D;  2HIO C;  5DNN D;  3REJ D;  1P3O B;  3AZH C;  3AN2 D;  5C3I B;  1P3A D;  4AWL B;  3X1U C;  1BH9 A;  3AV2 D;  5BNX B;  4NFT A;  3WTP D;  4CAY A;  2IO5 B;  3LZ0 D;  3AYW C;  3AFA D;  4WU8 C;  3X1V C;  2NZD D;  1BH9 B;  5CPI C;  5B33 C;  5GT3 D;  4CAY B;  2XD1 A;  3MGP D;  3AZG C;  5AV5 D;  4DQY B;  4HGA B;  3KXB B;  5AVC D;  4Z2M H;  3AZJ A;  3AZN C;  4E44 A;  1JFI A;  3MGS A;  5F99 C;  3AZM D;  5B40 C;  4AWL C;  3B6F C;  3R45 A;  4J8X B;  2FJ7 B;  3REJ C;  4XUJ D;  3UT9 A;  5AV9 C;  3AZI A;  5GSU D;  1BFM A;  5CPJ B;  3AV2 C;  1M18 D;  1JFI B;  3LZ1 D;  3B6G D;  1TZY B;  3WKJ D;  1R4V A;  3A6N C;  3AL0 C;  3REK C;  4G91 C;  4QLC A;  5FUG A;  3C1C D;  4KUD D;  4XZQ D;  5B32 B;  2YFW A;  3AZI B;  1S32 D;  2ZY5 A;  3REL D;  1EQZ D;  2JSS A;  1KX5 B;  1ZLA D;  3W99 D;  3AZM A;  1P3I D;  5JRG D;  1P3F B;  5B2J C;  3KXB C;  1P3P A;  3MGP C;  1P3G C;  5GXQ A;  5G49 B;  2YFW B;  5DNM C;  4ZUX D;  3MVD D;  3TU4 B;  3WAA C;  3AZL C;  1P3L D;  1P3P B;  3KWQ D;  3UTA C;  5GXQ B;  2L5A A;  4R8P A;  4KGC D;  3X1S B;  1H3O A;  4Z66 A;  1P3I A;  3EPL A;  5JRG A;  1P3M C;  3W98 A;  2ARO A;  3UTB D;  3B6G C;  5B32 C;  5B0Z D;  3AZK B;  3W97 C;  1P3K B;  5CP6 D;  1ULY A;  4YS3 A;  1H3O B;  1WWI A;  1ID3 D;  4WU9 C;  1S32 C;  4X23 A;  3W98 B;  5B1L D;  2RVQ D;  3KWQ A;  3C1B D;  1P34 C;  2HUE C;  2RIQ A;  5B31 A;  4YS3 B;  1M1A D;  3KUY D;  3TU4 C;  4Z5T C;  5BO0 A;  4YM6 D;  4H9P B;  3H0L C;  3MGQ D;  2ZY3 A;  2Y2P A;  5CPK D;  1AOI C;  3AV1 C;  5B31 B;  4LD9 D;  5E5A A;  2FFF B;  3REI A;  3MNN D;  3O62 D;  3W96 D;  3C1B A;  3FDD A;  3AZK C;  4H9S C;  4WZS B;  5B31 G;  1M1A A;  5AV8 D;  1KX3 D;  5E5A B;  4J8V B;  5AVB C;  1M19 B;  3MGQ A;  3REI B;  2Y2M A;  5CPK A;  2VQR A;  2Y2J A;  5GT0 C;  2HIO D;  2DQN C;  2BYK A;  5BS7 C;  3AZH D;  4NE3 A;  1F66 C;  3X1U D;  3O62 A;  3AZF B;  5B24 C;  3IP4 C;  3NQU A;  3AYW D;  1KX3 A;  2F8N D;  4WU8 D;  3X1V D;  2NQB A;  1A7W A;  5CPI D;  5B33 D;  5B0Y B;  3MNN C;  2F8N H;  3AZG D;  1P3B C;  5B2I B;  3X1U A;  5KDM B;  3MGR B;  3EPJ A;  3A1I A;  2NQB B;  3AZN D;  3LEL C;  2YFV B;  3AZE C;  5F99 D;  5B40 D;  5B1M A;  3AYW A;  2CV5 B;  3WA9 B;  3B6F D;  2Y2L A;  1HQ3 B;  5AV9 D;  4JJN B;  5B33 A;  1U35 C;  4H9R A;  1KX4 C;  5AY8 C;  3AZG A;  3A6N D;  4ZBJ C;  5B1M B;  4J8U A;  3REK D;  3REH A;  1BH8 A;  5AV6 C;  4H9O A;  5B40 A;  4J8W A;  3B6F A;  5B2J D;  5DNN A;  3KXB D;  4J8U B;  3REJ A;  3AN2 A;  4NE5 A;  1P3G D;  1P3A A;  3X1T C;  2PYO C;  5DNM D;  4CSR A;  3LJA C;  3AV2 A;  1BH8 B;  3A6N A;  3AZL D;  3WAA D;  3WTP A;  3VH6 T;  4J8W B;  3LZ0 A;  1P3O C;  5DNN B;  5C3I C;  3AN2 B;  1P3A B;  3AFA A;  3UTA D;  2NZD A;  3AZJ B;  3H0R C;  4WNN A;  1P3M D;  2IO5 C;  3WTP B;  5GT3 A;  5B2J A;  3LZ0 B;  3MGP A;  5B32 D;  3MGS B;  5AV5 A;  3W97 D;  5DNM A;  4DRB A;  3AFA B;  3R45 B;  5AVC A;  2NZD B;  3WAA A;  3UT9 B;  4WU9 D;  5GT3 B;  1P34 D;  3B0B A;  3VH6 W;  5AV5 B;  4HGA C;  4XUJ A;  1B6W A;  5FUG B;  5AVC B;  4QLC B;  3TU4 D;  4Z5T D;  1P3M A;  5GSU A;  1M18 A;  3WKJ A;  3LZ1 A;  3B6G A;  3W97 A;  3AZM B;  4J8X C;  2FJ7 C;  1AOI D;  4KUD A;  3C1C A;  3AV1 D;  4XZQ A;  4XUJ B;  3AZJ C;  1S32 A;  3A1K A;  5GSU B;  3REL A;  5CPJ C;  1EQZ A;  1M18 B;  1ZLA A;  1TZY C;  3W99 A;  3KSY A;  3MGS C;  3AZK D;  3WKJ B;  3NQJ A;  1P3K D;  4KUD B;  3WTP E;  4XZQ B;  3UT9 C;  5AVB D;  3AZI C;  4ZUX A;  4R8P B;  3MVD A;  3REL B;  1KX5 C;  1EQZ B;  4Z66 B;  1P3I B;  1P3F C;  5JRG B;  1P3L A;  5GT0 D;  4QLC C;  2ARO B;  5JA4 A;  1F66 D;  4KGC A;  2Y2N A;  4ZUX B;  1Q9C A;  4H9S A;  5CHL B;  5B24 D;  4NE6 A;  1P3L B;  3VH6 A;  4X23 B;  1P3P C;  3UTB A;  4KHA A;  5B0Z A;  3KWQ B;  1TAF A;  5CP6 A;  5GXQ C;  5AVB A;  4H9Q A;  4KGC B;  3X1S C;  4H9N A;  1ID3 A;  5BO0 B;  5GT0 A;  5BS7 A;  5B1L A;  3UTB B;  1P3B D;  1F66 A;  5B0Z B;  1P3K C;  4G92 B;  1M19 D;  1TAF B;  5CP6 B;  4H9Q B;  3KUY A;  4Z66 C;  3LEL D;  4YM6 A;  1ID3 B;  2Y2K A;  3AZE D;  3W98 C;  2ARO C;  2DF4 C;  5B1L B;  3C1B B;  2Y2I A;  4YS3 C;  4LD9 A;  4WJ3 C;  1M1A B;  3KUY B;  3EPK A;  1U35 D;  1KX4 D;  5AY8 D;  2J8P A;  3W96 A;  4YM6 B;  3MNN A;  4X23 C;  3MGQ B;  5CPK B;  4DRA A;  2BYK B;  5B31 C;  5AV8 A;  4LD9 B;  4EO5 B;  5B0Y D;  3AZE A;  3O62 B;  3EG5 B;  5AV6 D;  3W96 B;  5B2I D;  2HIO A;  3AZH A;  5AV8 B;  5E5A C;  3NQU B;  3X1T D;  4J8V C;  1U35 A;  1M19 C;  1KX3 B;  2PYO D;  3LJA D;  3REI C;  2XD5 A;  2F8N K;  2CV5 D;  1P3O D;  3AZH B;  2F8N A;  4WU8 A;  3X1U B;  3X1V A;  3B0D B;  3AZF C;  5CPI A;  1KU5 A;  1F1E A; 
#chains in the Genus database with same CATH homology
 3H0M C;  3AYW B;  2Y2O A;  4WU8 B;  3LJA A;  3X1V B;  2ZY2 A;  3AZN A;  5CPI B;  5B0Y C;  5B33 B;  4H9R B;  1P3O A;  1T3U A;  5F99 A;  3AZG B;  5B2I C;  2F8N G;  3KFU G;  3MGR C;  5BNX A;  2NQB C;  5AV9 A;  3REH B;  3AZN B;  2JE5 A;  5F99 B;  2CV5 C;  4H9O B;  5B40 B;  3WA9 C;  4J8X D;  2FJ7 D;  3REK A;  3B6F B;  1HQ3 C;  3REJ B;  3B0D C;  3AZJ D;  4JJN C;  5AV9 B;  2W8S A;  4CSR B;  5CPJ D;  3AV2 B;  1TZY D;  3MGS D;  5BT1 C;  3A6N B;  5B1M C;  1PZR A;  2ZM5 A;  3KXB A;  3REK B;  4G91 B;  1P3G A;  3UT9 D;  3AZI D;  1KX5 D;  3AZL A;  4J8X A;  4WNN B;  1P3F D;  2FJ7 A;  5B2J B;  4J8U C;  4QLC D;  3MGP B;  1P3G B;  3REH C;  3UTA A;  5DNM B;  5CPJ A;  1TZY A;  3AZL B;  4Z2M G;  3WAA B;  4J8W C;  5DNN C;  1P3P D;  5B32 A;  3AN2 C;  1P3A C;  2G5H C;  5GXQ D;  3UTA B;  3X1S D;  1KX5 A;  2LY8 A;  4WU9 A;  1P3F A;  3WTP C;  1P3M B;  3LZ0 C;  1P34 A;  3LZ1 B;  3B6G B;  1B67 A;  1WWS A;  5G49 A;  3W97 B;  3AFA C;  4R8P D;  2NZD C;  3C1C B;  3EPH A;  3VH5 T;  3TU4 A;  2BYM A;  4Z5T A;  4Z66 D;  4WU9 B;  5GT3 C;  1S32 B;  3W98 D;  2ARO D;  1P34 B;  4WV4 B;  5B32 G;  1ZLA B;  3W99 B;  5AV5 C;  3NQJ B;  1AOI A;  2HUE B;  3X1S A;  4YS3 D;  3AV1 A;  5AVC C;  2BYM B;  4Z5T B;  4X23 D;  3MVD B;  3AZK A;  3AZM C;  1P3K A;  1AOI B;  3B0C T;  5B31 D;  4XUJ C;  3AV1 B;  5JA4 B;  1N1J A;  5GSU C;  1M18 C;  2ZY4 A;  3VH5 W;  3LZ1 C;  3WKJ C;  4KUD C;  3C1C C;  4XZQ C;  4KHA B;  5E5A D;  4J8V D;  2Y2G A;  4H9P A;  1Z2C B;  5AVB B;  4R8P C;  3REI D;  1N1J B;  3REL C;  1EQZ C;  4H9N B;  3W99 C;  1ZLA C;  5B24 A;  1P3I C;  5JRG C;  1W2E A;  5GT0 B;  2UWX A;  2JCH A;  1F66 B;  3B0C W;  4ZUX C;  3MVD C;  3AZF D;  2G5I C;  3V9R A;  5B24 B;  1P3L C;  2Y2Q A;  2Y2H A;  4UUZ A;  3KWQ C;  1P3B A;  4J8V A;  1M19 A;  4KGC C;  3LEL A;  3V9R B;  3MNN B;  1HTA A;  3UTB C;  4UUZ B;  5B0Z C;  1P3B B;  4G92 C;  5CP6 C;  3MGR D;  3AZF A;  2NQB D;  1KX4 A;  1ID3 C;  3VH5 A;  5AY8 A;  3LEL B;  3AZE B;  5B1L C;  2RVQ C;  3C1B C;  3WA9 D;  2BG1 A;  4E45 A;  2HIO B;  1HQ3 D;  4JJN D;  3KUY C;  1M1A C;  4M6B A;  5B0Y A;  1U35 B;  4YM6 C;  1KX4 B;  5AY8 B;  3MGQ C;  5AV6 A;  5CPK C;  5BT1 D;  5B2I A;  5B1M D;  4ZBJ B;  5KDM A;  3MGR A;  5BNV A;  4LD9 C;  4EO5 C;  3X1T A;  2PYO A;  2YFV A;  2F8N B;  3P5J B;  3W96 C;  3O62 C;  4UPK A;  5AV6 B;  2CWE A;  2CV5 A;  3WA9 A;  4J8U D;  1HQ3 A;  5BNV B;  4JJN A;  5AV8 C;  3REH D;  1KX3 C;  3X1T B;  2PYO B;  2F2A C;  3LJA B;  3F6T A;  4J8W D;  2HIO C;  5DNN D;  3REJ D;  1P3O B;  3AZH C;  3AN2 D;  5C3I B;  1P3A D;  4AWL B;  3X1U C;  1BH9 A;  3AV2 D;  5BNX B;  4NFT A;  3WTP D;  4CAY A;  2IO5 B;  3LZ0 D;  3AYW C;  3AFA D;  4WU8 C;  3X1V C;  2NZD D;  1BH9 B;  5CPI C;  5B33 C;  5GT3 D;  4CAY B;  2XD1 A;  3MGP D;  3AZG C;  5AV5 D;  4DQY B;  4HGA B;  3KXB B;  5AVC D;  4Z2M H;  3AZJ A;  3AZN C;  4E44 A;  1JFI A;  3MGS A;  5F99 C;  3AZM D;  5B40 C;  4AWL C;  3B6F C;  3R45 A;  4J8X B;  2FJ7 B;  3REJ C;  4XUJ D;  3UT9 A;  5AV9 C;  3AZI A;  5GSU D;  1BFM A;  5CPJ B;  3AV2 C;  1M18 D;  1JFI B;  3LZ1 D;  3B6G D;  1TZY B;  3WKJ D;  1R4V A;  3A6N C;  3AL0 C;  3REK C;  4G91 C;  4QLC A;  5FUG A;  3C1C D;  4KUD D;  4XZQ D;  5B32 B;  2YFW A;  3AZI B;  1S32 D;  2ZY5 A;  3REL D;  1EQZ D;  2JSS A;  1KX5 B;  1ZLA D;  3W99 D;  3AZM A;  1P3I D;  5JRG D;  1P3F B;  5B2J C;  3KXB C;  1P3P A;  3MGP C;  1P3G C;  5GXQ A;  5G49 B;  2YFW B;  5DNM C;  4ZUX D;  3MVD D;  3TU4 B;  3WAA C;  3AZL C;  1P3L D;  1P3P B;  3KWQ D;  3UTA C;  5GXQ B;  2L5A A;  4R8P A;  4KGC D;  3X1S B;  1H3O A;  4Z66 A;  1P3I A;  3EPL A;  5JRG A;  1P3M C;  3W98 A;  2ARO A;  3UTB D;  3B6G C;  5B32 C;  5B0Z D;  3AZK B;  3W97 C;  1P3K B;  5CP6 D;  1ULY A;  4YS3 A;  1H3O B;  1WWI A;  1ID3 D;  4WU9 C;  1S32 C;  4X23 A;  3W98 B;  5B1L D;  2RVQ D;  3KWQ A;  3C1B D;  1P34 C;  2HUE C;  2RIQ A;  5B31 A;  4YS3 B;  1M1A D;  3KUY D;  3TU4 C;  4Z5T C;  5BO0 A;  4YM6 D;  4H9P B;  3H0L C;  3MGQ D;  2ZY3 A;  2Y2P A;  5CPK D;  1AOI C;  3AV1 C;  5B31 B;  4LD9 D;  5E5A A;  2FFF B;  3REI A;  3MNN D;  3O62 D;  3W96 D;  3C1B A;  3FDD A;  3AZK C;  4H9S C;  4WZS B;  5B31 G;  1M1A A;  5AV8 D;  1KX3 D;  5E5A B;  4J8V B;  5AVB C;  1M19 B;  3MGQ A;  3REI B;  2Y2M A;  5CPK A;  2VQR A;  2Y2J A;  5GT0 C;  2HIO D;  2DQN C;  2BYK A;  5BS7 C;  3AZH D;  4NE3 A;  1F66 C;  3X1U D;  3O62 A;  3AZF B;  5B24 C;  3IP4 C;  3NQU A;  3AYW D;  1KX3 A;  2F8N D;  4WU8 D;  3X1V D;  2NQB A;  1A7W A;  5CPI D;  5B33 D;  5B0Y B;  3MNN C;  2F8N H;  3AZG D;  1P3B C;  5B2I B;  3X1U A;  5KDM B;  3MGR B;  3EPJ A;  3A1I A;  2NQB B;  3AZN D;  3LEL C;  2YFV B;  3AZE C;  5F99 D;  5B40 D;  5B1M A;  3AYW A;  2CV5 B;  3WA9 B;  3B6F D;  2Y2L A;  1HQ3 B;  5AV9 D;  4JJN B;  5B33 A;  1U35 C;  4H9R A;  1KX4 C;  5AY8 C;  3AZG A;  3A6N D;  4ZBJ C;  5B1M B;  4J8U A;  3REK D;  3REH A;  1BH8 A;  5AV6 C;  4H9O A;  5B40 A;  4J8W A;  3B6F A;  5B2J D;  5DNN A;  3KXB D;  4J8U B;  3REJ A;  3AN2 A;  4NE5 A;  1P3G D;  1P3A A;  3X1T C;  2PYO C;  5DNM D;  4CSR A;  3LJA C;  3AV2 A;  1BH8 B;  3A6N A;  3AZL D;  3WAA D;  3WTP A;  3VH6 T;  4J8W B;  3LZ0 A;  1P3O C;  5DNN B;  5C3I C;  3AN2 B;  1P3A B;  3AFA A;  3UTA D;  2NZD A;  3AZJ B;  3H0R C;  4WNN A;  1P3M D;  2IO5 C;  3WTP B;  5GT3 A;  5B2J A;  3LZ0 B;  3MGP A;  5B32 D;  3MGS B;  5AV5 A;  3W97 D;  5DNM A;  4DRB A;  3AFA B;  3R45 B;  5AVC A;  2NZD B;  3WAA A;  3UT9 B;  4WU9 D;  5GT3 B;  1P34 D;  3B0B A;  3VH6 W;  5AV5 B;  4HGA C;  4XUJ A;  1B6W A;  5FUG B;  5AVC B;  4QLC B;  3TU4 D;  4Z5T D;  1P3M A;  5GSU A;  1M18 A;  3WKJ A;  3LZ1 A;  3B6G A;  3W97 A;  3AZM B;  4J8X C;  2FJ7 C;  1AOI D;  4KUD A;  3C1C A;  3AV1 D;  4XZQ A;  4XUJ B;  3AZJ C;  1S32 A;  3A1K A;  5GSU B;  3REL A;  5CPJ C;  1EQZ A;  1M18 B;  1ZLA A;  1TZY C;  3W99 A;  3KSY A;  3MGS C;  3AZK D;  3WKJ B;  3NQJ A;  1P3K D;  4KUD B;  3WTP E;  4XZQ B;  3UT9 C;  5AVB D;  3AZI C;  4ZUX A;  4R8P B;  3MVD A;  3REL B;  1KX5 C;  1EQZ B;  4Z66 B;  1P3I B;  1P3F C;  5JRG B;  1P3L A;  5GT0 D;  4QLC C;  2ARO B;  5JA4 A;  1F66 D;  4KGC A;  2Y2N A;  4ZUX B;  1Q9C A;  4H9S A;  5CHL B;  5B24 D;  4NE6 A;  1P3L B;  3VH6 A;  4X23 B;  1P3P C;  3UTB A;  4KHA A;  5B0Z A;  3KWQ B;  1TAF A;  5CP6 A;  5GXQ C;  5AVB A;  4H9Q A;  4KGC B;  3X1S C;  4H9N A;  1ID3 A;  5BO0 B;  5GT0 A;  5BS7 A;  5B1L A;  3UTB B;  1P3B D;  1F66 A;  5B0Z B;  1P3K C;  4G92 B;  1M19 D;  1TAF B;  5CP6 B;  4H9Q B;  3KUY A;  4Z66 C;  3LEL D;  4YM6 A;  1ID3 B;  2Y2K A;  3AZE D;  3W98 C;  2ARO C;  2DF4 C;  5B1L B;  3C1B B;  2Y2I A;  4YS3 C;  4LD9 A;  4WJ3 C;  1M1A B;  3KUY B;  3EPK A;  1U35 D;  1KX4 D;  5AY8 D;  2J8P A;  3W96 A;  4YM6 B;  3MNN A;  4X23 C;  3MGQ B;  5CPK B;  4DRA A;  2BYK B;  5B31 C;  5AV8 A;  4LD9 B;  4EO5 B;  5B0Y D;  3AZE A;  3O62 B;  3EG5 B;  5AV6 D;  3W96 B;  5B2I D;  2HIO A;  3AZH A;  5AV8 B;  5E5A C;  3NQU B;  3X1T D;  4J8V C;  1U35 A;  1M19 C;  1KX3 B;  2PYO D;  3LJA D;  3REI C;  2XD5 A;  2F8N K;  2CV5 D;  1P3O D;  3AZH B;  2F8N A;  4WU8 A;  3X1U B;  3X1V A;  3B0D B;  3AZF C;  5CPI A;  1KU5 A;  1F1E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...