3AZHC

Crystal structure of human nucleosome core particle containing h3k122q mutation
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
106
structure length
106
Chain Sequence
KAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3azhC00
4XZQD 1B67A 3WTPD 1P3KB 1B6WA 3A6NB 5AV6A 4LD9A 3X1TC 1P3IB 3VH6A 5CP6A 5GT0C 3AZKC 1U35D 4JJNA 3AZMC 5JA4A 2F8NA 3X1TD 5AV8B 2BYMA 2YFWA 4XUJB 3AZKD 3X1UC 3AZMD 3VH5T 1P3MC 1P3BB 1ID3B 2AROB 4AWLC 5BO0B 4J8VD 3W96A 1P34B 5GT3B 4KGCD 3X1UD 3UTBA 3MVDC 3B0CW 5CPKA 2PYOA 3KUYA 1M19A 4X23B 4WU8B 3REHB 1P3OA 1F1EA 5B1LC 3AFAC 5B40B 4XZQB 1H3OB 3MVDD 5B33C 3WTPB 1P3FA 3O62A 3AFAD 1P34A 3B6GB 1U35B 5E5AA 1AOIC 4CSRB 3X1TB 2NQBC 1ZLAA 4Z66C 3LZ0A 1P3AC 5GT0B 3AZKB 5CPJC 3AZMB 5B0YD 1AOID 1P3PC 3REKC 1EQZA 5B2IA 2NQBD 1KX5C 4J8UA 1P3AD 3NQJB 1P3MB 5CPJD 3X1UB 2F8NG 3MGSC 4KUDA 4AWLB 3REKD 1M18D 5B32G 4YS3A 3AZHD 3REIA 1P3GD 3MVDB 1HTAA 5B31C 5GXQC 1WWSA 5B1LB 3AFAB 5FUGA 5B1MC 5B2JC 5B33B 5CHLB 3W98C 4ZBJC 3AZGC 3REJA 3AV1C 3LJAC 1AOIB 3MGQD 4KHAA 3W98D 4QLCA 4R8PA 2NQBB 4Z66B 1P3AB 3AZEC 2JSSA 4YM6A 3WKJA 2BYKA 3LJAD 5B0ZA 3REKB 1P3PB 1JFIB 1KX5B 5F99C 3KWQA 3AZED 3X1VA 4EO5C 3MGSB 3AZNC 2NZDA 1KX3C 4Z66A 3MGRC 5B31B 5KDMB 5GXQB 3VH5W 4M6BA 3VH6T 3AZFA 3TU4C 1KX3D 5B1MB 4NE3A 3MGRD 3UT9C 3W99D 4NE5A 3C1BA 5AVBC 5B2JB 4HGAC 3AN2A 5CPIC 3W98B 4ZBJB 3AZGB 3AZJA 3AV1B 5AVBD 4J8WC 4CAYA 5CPID 1P3LC 1TZYC 5AVCC 3W97C 1N1JA 3AZEB 4Z5TC 1M1AC 3MNNA 4JJND 2F8NK 1P3LD 1TZYD 5AVCD 3LELC 4Z2MH 5F99B 4Z5TD 1F66A 1S32C 4EO5B 3AZNB 4UUZB 1BH9A 3KXBA 3LELD 5AY8A 1KX3B 3MGRB 1BH8A 2HIOA 1S32D 3UTAC 3TU4B 1P3OD 1HQ3A 3UT9B 4WU9C 5AVBB 5DNNA 4HGAB 3X1SA 5CPIB 1WWIA 3AZNA 3UTAD 3AZLC 2YFVB 4H9RB 4J8VC 5B32A 4WU9D 4J8XA 4J8WB 4KGCC 1P3LB 4E45A 1TZYB 5AVCB 1P3KA 2FJ7C 3W97B 3AZLD 3AV2C 3A6NA 3TU4A 4Z5TB 2CWEA 3LZ0D 5BS7C 1P3IA 1M1AB 5B31G 3LELB 2FJ7D 3AV2D 5AV8A 1S32B 3B0BA 4XUJA 4J8WA 1ID3A 1P3BA 2AROA 5BO0A 5AV9C 3REID 5BT1C 5GT3A 5B0YC 3UTAB 3R45B 4X23A 3NQUB 4WU8A 3REHA 1TAFB 5AV9D 4WU9B 5BT1D 5B40A 4XZQA 1H3OA 3WTPA 3AZLB 3AZIC 1M18C 5JRGD 3REJD 4J8VB 5BNVB 3B6FC 3AZHC 3B6GA 1P3GC 4KGCB 1U35A 4QLCD 3LZ1C 2FJ7B 3AZID 3AV2B 4CSRA 3X1TA 4H9QB 3B6FD 5GT0A 3AZKA 3WA9D 3AZMA 5B0ZD 3LZ1D 3RELC 3X1VD 3NQJA 1P3MA 4KGCA 3X1UA 3MGQC 5GSUD 5DNMC 4ZUXC 3WAAC 3RELD 5AV9B 4H9OB 5G49B 4H9QA 1KX4C 4H9SC 5B0YB 3MVDA 5DNMD 4ZUXD 4DRBA 3WAAD 5CPJB 5B1LA 3AFAA 1KX4D 5C3IC 5B33A 3AZIB 1M18B 4H9NB 4Z2MG 5BNXB 3AZJD 3B6FB 3AZHB 1P3GB 3AYWC 3LZ1B 1AOIA 5AV5D 2NQBA 3C1CC 1P3AA 3W99C 3AYWD 5CPJA 3MGPC 2CV5C 1P3PA 3REKA 1JFIA 3RELB 1KX5A 5B24C 3C1CD 3MGQB 3MGPD 3MGSA 5DNMB 4ZUXB 2CV5D 4LD9C 5AV6C 5AY8D 3WAAB 4WZSB 4DRAA 5B24D 5CP6C 1KX4B 4JJNC 3LJAB 5B31A 5KDMA 5GXQA 4LD9D 5AV6D 3B0DC 1HQ3D 5CP6D 5B1MA 5C3IB 5B2JA 2F8ND 3W98A 3AZGA 3W96C 5B32D 4J8XD 3AYWB 4G91C 3AV1A 3UTBC 1R4VA 5CPKC 3V9RB 3LJAA 2PYOC 3KUYC 2HUEC 1M19C 2L5AA 1P3OC 3C1CB 3W96D 3W99B 3AZEA 3UTBD 3MGPB 5CPKD 1P3FC 2PYOD 4H9PB 3KUYD 2CV5B 1M19D 5F99A 5B24B 3O62C 5E5AC 1ID3D 1P3FD 1P3BD 4UUZA 4LD9B 5AV6B 2AROD 1ZLAC 1KX3A 3LZ0C 5CP6B 3O62D 1P34D 3MGRA 4JJNB 5E5AD 2F8NB 4NE6A 1EQZC 5B2IC 3B0DB 4G92C 1ZLAD 4J8UC 3REHD 3UT9A 2BYMB 2YFWB 5AVBA 5CPIA 4KUDC 1EQZD 5B2ID 4YS3C 4J8UD 3W96B 2LY8A 2YFVA 4H9RA 4G91B 3B6GD 3REIC 3UTBB 5CPKB 2PYOB 3KUYB 4KUDD 2HUEB 1M19B 1P3LA 1TZYA 1P3OB 5AVCA 3W97A 4YS3D 4Z5TA 5GT0D 1M1AA 1P3FB 3LELA 5JRGC 3REJC 3O62B 5E5AB 1S32A 1P3MD 4R8PC 4QLCC 1U35C 1ZLAB 3VH6W 3LZ0B 4YM6C 3WKJC 1ULYA 3WA9C 5B0ZC 4R8PD 1EQZB 5B2IB 3R45A 4NFTA 4G92B 3UTAA 4J8UB 3NQUA 3KWQC 3X1VC 1TAFA 5B1LD 4YM6D 3WKJD 4WU9A 4WV4B 5B33D 4KUDB 5GSUC 2NZDC 4YS3B 3AZLA 3KWQD 4J8VA 3REIB 5BNVA 2NZDD 3AZFC 2FJ7A 3AV2A 5FUGB 4Z66D 5BS7A 3C1BC 3AN2C 4E44A 1P3PD 3VH5A 3AZFD 5JRGB 3REJB 1KX5D 4WNNB 3AZJC 3C1BD 3AN2D 4KHAB 3MGSD 4QLCB 4R8PB 5AV5C 4YM6B 5AV9A 3WKJB 4H9OA 2BYKB 5G49A 3MNNC 3WA9B 5B31D 5B0ZB 5GXQD 5B0YA 5JRGA 3KWQB 3X1VB 1F66C 4WNNA 5B1MD 3MNND 5B2JD 3B0CT 5GSUB 3KXBC 2NZDB 5AY8C 3AZIA 1M18A 3AZGD 2HIOC 4H9NA 5BNXA 1F66D 3AV1D 3B6FA 3AZHA 1P3GA 3WA9A 3KXBD 3LZ1A 3AZFB 1HQ3C 2HIOD 3C1BB 5DNNC 3X1SC 3AN2B 2F8NH 5GSUA 5F99D 3RELA 3AZJB 5B32C 4J8XC 5DNND 3X1SD 4CAYB 2IO5C 3MGQA 3AZND 5DNMA 4ZUXA 1N1JB 5AV5B 1P3KC 3A6NC 3WAAA 1P3IC 3MNNB 1A7WA 1KX4A 1BFMA 4H9SA 1P3KD 3A6ND 3TU4D 1F66B 1P3ID 3UT9D 5AV8C 4XUJC 1ID3C 1BH9B 3KXBB 1P3BC 5AY8B 2AROC 5AV5A 1BH8B 2HIOB 5AV8D 1P34C 5GT3C 3AYWA 4XUJD 4J8WD 3V9RA 2RVQC 1HQ3B 1Q9CA 4X23C 4WU8C 3REHC 3W97D 5DNNB 3X1SB 3C1CA 1M1AD 5GT3D 3WTPE 3W99A 5JA4B 5B40C 1KU5A 4XZQC 3MGPA 3WTPC 3KSYA 2RVQD 4H9PA 2CV5A 4X23D 4WU8D 5B32B 4J8XB 5B24A 3B6GC 2IO5B 5B40D
chains in the Genus database with same CATH superfamily
4XZQD 1B67A 3WTPD 1P3KB 2W8SA 2ZY5A 1B6WA 3A6NB 2Y2MA 5AV6A 4LD9A 3X1TC 1P3IB 3VH6A 5CP6A 5GT0C 3AZKC 1U35D 4JJNA 3AZMC 5JA4A 2F8NA 2Y2QA 3X1TD 5AV8B 2BYMA 2YFWA 4XUJB 3AZKD 3X1UC 3AZMD 3VH5T 1P3MC 1P3BB 1ID3B 2AROB 4AWLC 5BO0B 4J8VD 3W96A 1P34B 5GT3B 4KGCD 3X1UD 3UTBA 3MVDC 3B0CW 5CPKA 2PYOA 3KUYA 1M19A 4X23B 4WU8B 3REHB 1P3OA 1F1EA 5B1LC 3AFAC 5B40B 4XZQB 1H3OB 3MVDD 5B33C 3WTPB 1P3FA 3O62A 3AFAD 1P34A 3B6GB 1U35B 5E5AA 1AOIC 4CSRB 3X1TB 2NQBC 1ZLAA 4Z66C 3LZ0A 1P3AC 5GT0B 3AZKB 5CPJC 3AZMB 5B0YD 1AOID 1P3PC 3REKC 1EQZA 5B2IA 2NQBD 1KX5C 4J8UA 1P3AD 3NQJB 1P3MB 5CPJD 3X1UB 2F8NG 3MGSC 4KUDA 4AWLB 3REKD 1M18D 5B32G 4YS3A 3AZHD 3REIA 1P3GD 3MVDB 1HTAA 5B31C 5GXQC 1WWSA 2JCHA 5B1LB 3AFAB 5FUGA 5B1MC 5B2JC 5B33B 5CHLB 3W98C 4ZBJC 3AZGC 3REJA 3KFUG 3AV1C 3LJAC 1AOIB 3MGQD 4KHAA 3W98D 4QLCA 4R8PA 2NQBB 4Z66B 1P3AB 3AZEC 2JSSA 4YM6A 3WKJA 2BYKA 3LJAD 5B0ZA 3REKB 1P3PB 1JFIB 1KX5B 5F99C 3KWQA 3AZED 2Y2HA 3X1VA 4EO5C 3MGSB 3EPKA 3AZNC 2NZDA 1KX3C 4Z66A 3MGRC 5B31B 5KDMB 5GXQB 3VH5W 4M6BA 3VH6T 3AZFA 3TU4C 1KX3D 2Y2JA 5B1MB 4NE3A 3MGRD 3UT9C 3W99D 2ZY3A 4NE5A 5AVBC 5B2JB 4HGAC 3C1BA 3AN2A 5CPIC 3W98B 4ZBJB 3AZGB 3A1KA 3AZJA 3AV1B 5AVBD 4J8WC 4CAYA 5CPID 1P3LC 1TZYC 5AVCC 3H0LC 3W97C 1N1JA 3AZEB 4Z5TC 1M1AC 3MNNA 4JJND 2F8NK 1P3LD 1TZYD 2BG1A 5AVCD 3LELC 4Z2MH 5F99B 4Z5TD 1F66A 1S32C 4EO5B 2XD5A 3AZNB 2ZY4A 4UUZB 1BH9A 3KXBA 3LELD 5AY8A 1KX3B 3MGRB 1BH8A 2HIOA 3EG5B 1S32D 2Y2NA 3UTAC 3TU4B 1P3OD 1HQ3A 3UT9B 4WU9C 5AVBB 5DNNA 4HGAB 3X1SA 5CPIB 1WWIA 3AZNA 3UTAD 3AZLC 2YFVB 4H9RB 4J8VC 2DQNC 5B32A 4WU9D 4J8XA 4J8WB 4KGCC 1P3LB 4E45A 1TZYB 5AVCB 1P3KA 2FJ7C 3W97B 3AZLD 3AV2C 3A6NA 3TU4A 4Z5TB 2CWEA 3LZ0D 5BS7C 1P3IA 1M1AB 5B31G 3LELB 2FJ7D 3AV2D 5AV8A 1S32B 2Y2OA 3B0BA 4XUJA 4J8WA 1ID3A 1P3BA 2AROA 3EPLA 5BO0A 5AV9C 3REID 2XD1A 5BT1C 5GT3A 5B0YC 3UTAB 3R45B 4X23A 3NQUB 4WU8A 3REHA 1TAFB 5AV9D 4WU9B 5BT1D 5B40A 4XZQA 1H3OA 3WTPA 3AZLB 3AZIC 1M18C 5JRGD 3REJD 4J8VB 5BNVB 3B6FC 3AZHC 3B6GA 1P3GC 4KGCB 1U35A 4QLCD 3LZ1C 2FJ7B 3FDDA 3AZID 3AV2B 4CSRA 3X1TA 4H9QB 3B6FD 5GT0A 3AZKA 3WA9D 3AZMA 5B0ZD 3LZ1D 3RELC 3X1VD 1T3UA 3NQJA 1P3MA 2FFFB 4KGCA 3X1UA 3MGQC 5GSUD 5DNMC 4ZUXC 3WAAC 3RELD 5AV9B 4H9OB 5G49B 4H9QA 1KX4C 4H9SC 5B0YB 3MVDA 5DNMD 4ZUXD 4DRBA 3WAAD 5CPJB 5B1LA 3AFAA 1KX4D 5C3IC 5B33A 3AZIB 1M18B 4H9NB 4Z2MG 5BNXB 3AZJD 3B6FB 3AZHB 1P3GB 3AYWC 3LZ1B 1AOIA 5AV5D 3A1IA 3IP4C 2NQBA 3C1CC 1P3AA 3W99C 3AYWD 5CPJA 3F6TA 3MGPC 1Z2CB 2CV5C 1P3PA 3REKA 1JFIA 3RELB 1KX5A 5B24C 3C1CD 3MGQB 3MGPD 3MGSA 5DNMB 4ZUXB 2CV5D 3P5JB 5AV6C 5AY8D 3WAAB 4LD9C 4WZSB 4DRAA 5B24D 5CP6C 1KX4B 4JJNC 3LJAB 5B31A 2Y2LA 5KDMA 5GXQA 4LD9D 5AV6D 3B0DC 1HQ3D 2G5HC 2F2AC 5CP6D 5B1MA 5C3IB 5B2JA 2F8ND 3W98A 3EPJA 3AZGA 3W96C 5B32D 4J8XD 3AYWB 4G91C 3AV1A 3UTBC 1R4VA 5CPKC 3V9RB 3LJAA 2PYOC 3KUYC 2HUEC 1M19C 2L5AA 1P3OC 1W2EA 3C1CB 3W96D 3W99B 3AZEA 3UTBD 3MGPB 5CPKD 1P3FC 2PYOD 4H9PB 3KUYD 2CV5B 1M19D 2RIQA 5F99A 5B24B 3O62C 3EPHA 5E5AC 1ID3D 1P3FD 1P3BD 4UUZA 4LD9B 5AV6B 2AROD 1ZLAC 1KX3A 3LZ0C 5CP6B 3O62D 1P34D 3MGRA 2Y2PA 4JJNB 5E5AD 2F8NB 4NE6A 1EQZC 5B2IC 3B0DB 4G92C 2Y2IA 1ZLAD 4J8UC 3REHD 3UT9A 2BYMB 2YFWB 5AVBA 5CPIA 4KUDC 1EQZD 5B2ID 4YS3C 4J8UD 3W96B 2LY8A 2YFVA 4H9RA 4G91B 3B6GD 3REIC 3UTBB 5CPKB 2PYOB 3KUYB 2G5IC 2HUEB 1M19B 4KUDD 1P3LA 1TZYA 1P3OB 5AVCA 3W97A 4YS3D 4Z5TA 5GT0D 1M1AA 1P3FB 3LELA 5JRGC 3REJC 3O62B 5E5AB 1S32A 1P3MD 4R8PC 4QLCC 1U35C 1ZLAB 3VH6W 3LZ0B 4YM6C 3WKJC 1ULYA 3WA9C 2DF4C 5B0ZC 4R8PD 1EQZB 5B2IB 3R45A 4NFTA 4G92B 3UTAA 4J8UB 3NQUA 3KWQC 3X1VC 1TAFA 5B1LD 4YM6D 3WKJD 4WU9A 4WV4B 5B33D 4KUDB 5GSUC 2NZDC 3AL0C 4YS3B 3AZLA 3KWQD 4J8VA 3REIB 5BNVA 2NZDD 3AZFC 2FJ7A 3AV2A 5FUGB 4Z66D 3H0RC 5BS7A 3C1BC 3AN2C 4E44A 4UPKA 1P3PD 3VH5A 3AZFD 5JRGB 3REJB 1KX5D 4WNNB 3AZJC 1PZRA 3C1BD 3AN2D 4KHAB 3MGSD 4QLCB 4R8PB 4DQYB 5AV5C 4YM6B 5AV9A 3WKJB 4H9OA 2BYKB 5G49A 3MNNC 3WA9B 2ZM5A 5B31D 5B0ZB 5GXQD 5B0YA 5JRGA 3KWQB 3X1VB 1F66C 4WNNA 5B1MD 3MNND 5B2JD 3B0CT 5GSUB 3KXBC 2NZDB 5AY8C 3AZIA 1M18A 3AZGD 2HIOC 4H9NA 5BNXA 1F66D 3AV1D 3B6FA 3AZHA 1P3GA 3WA9A 3KXBD 4WJ3C 3LZ1A 3AZFB 1HQ3C 2UWXA 2HIOD 3C1BB 5DNNC 3X1SC 3AN2B 2F8NH 2VQRA 5GSUA 5F99D 3RELA 3AZJB 5B32C 4J8XC 5DNND 3X1SD 4CAYB 2IO5C 3MGQA 3AZND 5DNMA 4ZUXA 1N1JB 5AV5B 1P3KC 3A6NC 3WAAA 1P3IC 3MNNB 1A7WA 2J8PA 1KX4A 1BFMA 4H9SA 1P3KD 3A6ND 3TU4D 2Y2KA 1F66B 1P3ID 3UT9D 5AV8C 2ZY2A 2Y2GA 4XUJC 1ID3C 1BH9B 3KXBB 1P3BC 5AY8B 2AROC 5AV5A 1BH8B 2HIOB 5AV8D 1P34C 5GT3C 3AYWA 4XUJD 4J8WD 3V9RA 2RVQC 3H0MC 1HQ3B 1Q9CA 4X23C 4WU8C 3REHC 3W97D 5DNNB 3X1SB 3C1CA 1M1AD 5GT3D 3WTPE 3W99A 5JA4B 5B40C 1KU5A 4XZQC 3MGPA 3WTPC 3KSYA 2RVQD 4H9PA 2CV5A 4X23D 4WU8D 2JE5A 5B32B 4J8XB 5B24A 3B6GC 2IO5B 5B40D
chains in the Genus database with same CATH topology
4XZQD 1B67A 3WTPD 1P3KB 2W8SA 2ZY5A 1B6WA 3A6NB 2Y2MA 5AV6A 4LD9A 3X1TC 1P3IB 3VH6A 5CP6A 5GT0C 3AZKC 1U35D 4JJNA 3AZMC 5JA4A 2F8NA 2Y2QA 3X1TD 5AV8B 2BYMA 2YFWA 4XUJB 3AZKD 3X1UC 3AZMD 3VH5T 1P3MC 1P3BB 1ID3B 2AROB 4AWLC 5BO0B 4J8VD 3W96A 1P34B 5GT3B 4KGCD 3X1UD 3UTBA 3MVDC 3B0CW 5CPKA 2PYOA 3KUYA 1M19A 4X23B 4WU8B 3REHB 1P3OA 1F1EA 5B1LC 3AFAC 5B40B 4XZQB 1H3OB 3MVDD 5B33C 3WTPB 1P3FA 3O62A 3AFAD 1P34A 3B6GB 1U35B 5E5AA 1AOIC 4CSRB 3X1TB 2NQBC 1ZLAA 4Z66C 3LZ0A 1P3AC 5GT0B 3AZKB 5CPJC 3AZMB 5B0YD 1AOID 1P3PC 3REKC 1EQZA 5B2IA 2NQBD 1KX5C 4J8UA 1P3AD 3NQJB 1P3MB 5CPJD 3X1UB 2F8NG 3MGSC 4KUDA 4AWLB 3REKD 1M18D 5B32G 4YS3A 3AZHD 3REIA 1P3GD 3MVDB 1HTAA 5B31C 5GXQC 1WWSA 2JCHA 5B1LB 3AFAB 5FUGA 5B1MC 5B2JC 5B33B 5CHLB 3W98C 4ZBJC 3AZGC 3REJA 3KFUG 3AV1C 3LJAC 1AOIB 3MGQD 4KHAA 3W98D 4QLCA 4R8PA 2NQBB 4Z66B 1P3AB 3AZEC 2JSSA 4YM6A 3WKJA 2BYKA 3LJAD 5B0ZA 3REKB 1P3PB 1JFIB 1KX5B 5F99C 3KWQA 3AZED 2Y2HA 3X1VA 4EO5C 3MGSB 3EPKA 3AZNC 2NZDA 1KX3C 4Z66A 3MGRC 5B31B 5KDMB 5GXQB 3VH5W 4M6BA 3VH6T 3AZFA 3TU4C 1KX3D 2Y2JA 5B1MB 4NE3A 3MGRD 3UT9C 3W99D 2ZY3A 4NE5A 5AVBC 5B2JB 4HGAC 3C1BA 3AN2A 5CPIC 3W98B 4ZBJB 3AZGB 3A1KA 3AZJA 3AV1B 5AVBD 4J8WC 4CAYA 5CPID 1P3LC 1TZYC 5AVCC 3H0LC 3W97C 1N1JA 3AZEB 4Z5TC 1M1AC 3MNNA 4JJND 2F8NK 1P3LD 1TZYD 2BG1A 5AVCD 3LELC 4Z2MH 5F99B 4Z5TD 1F66A 1S32C 4EO5B 2XD5A 3AZNB 2ZY4A 4UUZB 1BH9A 3KXBA 3LELD 5AY8A 1KX3B 3MGRB 1BH8A 2HIOA 3EG5B 1S32D 2Y2NA 3UTAC 3TU4B 1P3OD 1HQ3A 3UT9B 4WU9C 5AVBB 5DNNA 4HGAB 3X1SA 5CPIB 1WWIA 3AZNA 3UTAD 3AZLC 2YFVB 4H9RB 4J8VC 2DQNC 5B32A 4WU9D 4J8XA 4J8WB 4KGCC 1P3LB 4E45A 1TZYB 5AVCB 1P3KA 2FJ7C 3W97B 3AZLD 3AV2C 3A6NA 3TU4A 4Z5TB 2CWEA 3LZ0D 5BS7C 1P3IA 1M1AB 5B31G 3LELB 2FJ7D 3AV2D 5AV8A 1S32B 2Y2OA 3B0BA 4XUJA 4J8WA 1ID3A 1P3BA 2AROA 3EPLA 5BO0A 5AV9C 3REID 2XD1A 5BT1C 5GT3A 5B0YC 3UTAB 3R45B 4X23A 3NQUB 4WU8A 3REHA 1TAFB 5AV9D 4WU9B 5BT1D 5B40A 4XZQA 1H3OA 3WTPA 3AZLB 3AZIC 1M18C 5JRGD 3REJD 4J8VB 5BNVB 3B6FC 3AZHC 3B6GA 1P3GC 4KGCB 1U35A 4QLCD 3LZ1C 2FJ7B 3FDDA 3AZID 3AV2B 4CSRA 3X1TA 4H9QB 3B6FD 5GT0A 3AZKA 3WA9D 3AZMA 5B0ZD 3LZ1D 3RELC 3X1VD 1T3UA 3NQJA 1P3MA 2FFFB 4KGCA 3X1UA 3MGQC 5GSUD 5DNMC 4ZUXC 3WAAC 3RELD 5AV9B 4H9OB 5G49B 4H9QA 1KX4C 4H9SC 5B0YB 3MVDA 5DNMD 4ZUXD 4DRBA 3WAAD 5CPJB 5B1LA 3AFAA 1KX4D 5C3IC 5B33A 3AZIB 1M18B 4H9NB 4Z2MG 5BNXB 3AZJD 3B6FB 3AZHB 1P3GB 3AYWC 3LZ1B 1AOIA 5AV5D 3A1IA 3IP4C 2NQBA 3C1CC 1P3AA 3W99C 3AYWD 5CPJA 3F6TA 3MGPC 1Z2CB 2CV5C 1P3PA 3REKA 1JFIA 3RELB 1KX5A 5B24C 3C1CD 3MGQB 3MGPD 3MGSA 5DNMB 4ZUXB 2CV5D 3P5JB 5AV6C 5AY8D 3WAAB 4LD9C 4WZSB 4DRAA 5B24D 5CP6C 1KX4B 4JJNC 3LJAB 5B31A 2Y2LA 5KDMA 5GXQA 4LD9D 5AV6D 3B0DC 1HQ3D 2G5HC 2F2AC 5CP6D 5B1MA 5C3IB 5B2JA 2F8ND 3W98A 3EPJA 3AZGA 3W96C 5B32D 4J8XD 3AYWB 4G91C 3AV1A 3UTBC 1R4VA 5CPKC 3V9RB 3LJAA 2PYOC 3KUYC 2HUEC 1M19C 2L5AA 1P3OC 1W2EA 3C1CB 3W96D 3W99B 3AZEA 3UTBD 3MGPB 5CPKD 1P3FC 2PYOD 4H9PB 3KUYD 2CV5B 1M19D 2RIQA 5F99A 5B24B 3O62C 3EPHA 5E5AC 1ID3D 1P3FD 1P3BD 4UUZA 4LD9B 5AV6B 2AROD 1ZLAC 1KX3A 3LZ0C 5CP6B 3O62D 1P34D 3MGRA 2Y2PA 4JJNB 5E5AD 2F8NB 4NE6A 1EQZC 5B2IC 3B0DB 4G92C 2Y2IA 1ZLAD 4J8UC 3REHD 3UT9A 2BYMB 2YFWB 5AVBA 5CPIA 4KUDC 1EQZD 5B2ID 4YS3C 4J8UD 3W96B 2LY8A 2YFVA 4H9RA 4G91B 3B6GD 3REIC 3UTBB 5CPKB 2PYOB 3KUYB 2G5IC 2HUEB 1M19B 4KUDD 1P3LA 1TZYA 1P3OB 5AVCA 3W97A 4YS3D 4Z5TA 5GT0D 1M1AA 1P3FB 3LELA 5JRGC 3REJC 3O62B 5E5AB 1S32A 1P3MD 4R8PC 4QLCC 1U35C 1ZLAB 3VH6W 3LZ0B 4YM6C 3WKJC 1ULYA 3WA9C 2DF4C 5B0ZC 4R8PD 1EQZB 5B2IB 3R45A 4NFTA 4G92B 3UTAA 4J8UB 3NQUA 3KWQC 3X1VC 1TAFA 5B1LD 4YM6D 3WKJD 4WU9A 4WV4B 5B33D 4KUDB 5GSUC 2NZDC 3AL0C 4YS3B 3AZLA 3KWQD 4J8VA 3REIB 5BNVA 2NZDD 3AZFC 2FJ7A 3AV2A 5FUGB 4Z66D 3H0RC 5BS7A 3C1BC 3AN2C 4E44A 4UPKA 1P3PD 3VH5A 3AZFD 5JRGB 3REJB 1KX5D 4WNNB 3AZJC 1PZRA 3C1BD 3AN2D 4KHAB 3MGSD 4QLCB 4R8PB 4DQYB 5AV5C 4YM6B 5AV9A 3WKJB 4H9OA 2BYKB 5G49A 3MNNC 3WA9B 2ZM5A 5B31D 5B0ZB 5GXQD 5B0YA 5JRGA 3KWQB 3X1VB 1F66C 4WNNA 5B1MD 3MNND 5B2JD 3B0CT 5GSUB 3KXBC 2NZDB 5AY8C 3AZIA 1M18A 3AZGD 2HIOC 4H9NA 5BNXA 1F66D 3AV1D 3B6FA 3AZHA 1P3GA 3WA9A 3KXBD 4WJ3C 3LZ1A 3AZFB 1HQ3C 2UWXA 2HIOD 3C1BB 5DNNC 3X1SC 3AN2B 2F8NH 2VQRA 5GSUA 5F99D 3RELA 3AZJB 5B32C 4J8XC 5DNND 3X1SD 4CAYB 2IO5C 3MGQA 3AZND 5DNMA 4ZUXA 1N1JB 5AV5B 1P3KC 3A6NC 3WAAA 1P3IC 3MNNB 1A7WA 2J8PA 1KX4A 1BFMA 4H9SA 1P3KD 3A6ND 3TU4D 2Y2KA 1F66B 1P3ID 3UT9D 5AV8C 2ZY2A 2Y2GA 4XUJC 1ID3C 1BH9B 3KXBB 1P3BC 5AY8B 2AROC 5AV5A 1BH8B 2HIOB 5AV8D 1P34C 5GT3C 3AYWA 4XUJD 4J8WD 3V9RA 2RVQC 3H0MC 1HQ3B 1Q9CA 4X23C 4WU8C 3REHC 3W97D 5DNNB 3X1SB 3C1CA 1M1AD 5GT3D 3WTPE 3W99A 5JA4B 5B40C 1KU5A 4XZQC 3MGPA 3WTPC 3KSYA 2RVQD 4H9PA 2CV5A 4X23D 4WU8D 2JE5A 5B32B 4J8XB 5B24A 3B6GC 2IO5B 5B40D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XZQ D;  1B67 A;  3WTP D;  1P3K B;  1B6W A;  3A6N B;  5AV6 A;  4LD9 A;  3X1T C;  1P3I B;  3VH6 A;  5CP6 A;  5GT0 C;  3AZK C;  1U35 D;  4JJN A;  3AZM C;  5JA4 A;  2F8N A;  3X1T D;  5AV8 B;  2BYM A;  2YFW A;  4XUJ B;  3AZK D;  3X1U C;  3AZM D;  3VH5 T;  1P3M C;  1P3B B;  1ID3 B;  2ARO B;  4AWL C;  5BO0 B;  4J8V D;  3W96 A;  1P34 B;  5GT3 B;  4KGC D;  3X1U D;  3UTB A;  3MVD C;  3B0C W;  5CPK A;  2PYO A;  3KUY A;  1M19 A;  4X23 B;  4WU8 B;  3REH B;  1P3O A;  1F1E A;  5B1L C;  3AFA C;  5B40 B;  4XZQ B;  1H3O B;  3MVD D;  5B33 C;  3WTP B;  1P3F A;  3O62 A;  3AFA D;  1P34 A;  3B6G B;  1U35 B;  5E5A A;  1AOI C;  4CSR B;  3X1T B;  2NQB C;  1ZLA A;  4Z66 C;  3LZ0 A;  1P3A C;  5GT0 B;  3AZK B;  5CPJ C;  3AZM B;  5B0Y D;  1AOI D;  1P3P C;  3REK C;  1EQZ A;  5B2I A;  2NQB D;  1KX5 C;  4J8U A;  1P3A D;  3NQJ B;  1P3M B;  5CPJ D;  3X1U B;  2F8N G;  3MGS C;  4KUD A;  4AWL B;  3REK D;  1M18 D;  5B32 G;  4YS3 A;  3AZH D;  3REI A;  1P3G D;  3MVD B;  1HTA A;  5B31 C;  5GXQ C;  1WWS A;  5B1L B;  3AFA B;  5FUG A;  5B1M C;  5B2J C;  5B33 B;  5CHL B;  3W98 C;  4ZBJ C;  3AZG C;  3REJ A;  3AV1 C;  3LJA C;  1AOI B;  3MGQ D;  4KHA A;  3W98 D;  4QLC A;  4R8P A;  2NQB B;  4Z66 B;  1P3A B;  3AZE C;  2JSS A;  4YM6 A;  3WKJ A;  2BYK A;  3LJA D;  5B0Z A;  3REK B;  1P3P B;  1JFI B;  1KX5 B;  5F99 C;  3KWQ A;  3AZE D;  3X1V A;  4EO5 C;  3MGS B;  3AZN C;  2NZD A;  1KX3 C;  4Z66 A;  3MGR C;  5B31 B;  5KDM B;  5GXQ B;  3VH5 W;  4M6B A;  3VH6 T;  3AZF A;  3TU4 C;  1KX3 D;  5B1M B;  4NE3 A;  3MGR D;  3UT9 C;  3W99 D;  4NE5 A;  3C1B A;  5AVB C;  5B2J B;  4HGA C;  3AN2 A;  5CPI C;  3W98 B;  4ZBJ B;  3AZG B;  3AZJ A;  3AV1 B;  5AVB D;  4J8W C;  4CAY A;  5CPI D;  1P3L C;  1TZY C;  5AVC C;  3W97 C;  1N1J A;  3AZE B;  4Z5T C;  1M1A C;  3MNN A;  4JJN D;  2F8N K;  1P3L D;  1TZY D;  5AVC D;  3LEL C;  4Z2M H;  5F99 B;  4Z5T D;  1F66 A;  1S32 C;  4EO5 B;  3AZN B;  4UUZ B;  1BH9 A;  3KXB A;  3LEL D;  5AY8 A;  1KX3 B;  3MGR B;  1BH8 A;  2HIO A;  1S32 D;  3UTA C;  3TU4 B;  1P3O D;  1HQ3 A;  3UT9 B;  4WU9 C;  5AVB B;  5DNN A;  4HGA B;  3X1S A;  5CPI B;  1WWI A;  3AZN A;  3UTA D;  3AZL C;  2YFV B;  4H9R B;  4J8V C;  5B32 A;  4WU9 D;  4J8X A;  4J8W B;  4KGC C;  1P3L B;  4E45 A;  1TZY B;  5AVC B;  1P3K A;  2FJ7 C;  3W97 B;  3AZL D;  3AV2 C;  3A6N A;  3TU4 A;  4Z5T B;  2CWE A;  3LZ0 D;  5BS7 C;  1P3I A;  1M1A B;  5B31 G;  3LEL B;  2FJ7 D;  3AV2 D;  5AV8 A;  1S32 B;  3B0B A;  4XUJ A;  4J8W A;  1ID3 A;  1P3B A;  2ARO A;  5BO0 A;  5AV9 C;  3REI D;  5BT1 C;  5GT3 A;  5B0Y C;  3UTA B;  3R45 B;  4X23 A;  3NQU B;  4WU8 A;  3REH A;  1TAF B;  5AV9 D;  4WU9 B;  5BT1 D;  5B40 A;  4XZQ A;  1H3O A;  3WTP A;  3AZL B;  3AZI C;  1M18 C;  5JRG D;  3REJ D;  4J8V B;  5BNV B;  3B6F C;  3AZH C;  3B6G A;  1P3G C;  4KGC B;  1U35 A;  4QLC D;  3LZ1 C;  2FJ7 B;  3AZI D;  3AV2 B;  4CSR A;  3X1T A;  4H9Q B;  3B6F D;  5GT0 A;  3AZK A;  3WA9 D;  3AZM A;  5B0Z D;  3LZ1 D;  3REL C;  3X1V D;  3NQJ A;  1P3M A;  4KGC A;  3X1U A;  3MGQ C;  5GSU D;  5DNM C;  4ZUX C;  3WAA C;  3REL D;  5AV9 B;  4H9O B;  5G49 B;  4H9Q A;  1KX4 C;  4H9S C;  5B0Y B;  3MVD A;  5DNM D;  4ZUX D;  4DRB A;  3WAA D;  5CPJ B;  5B1L A;  3AFA A;  1KX4 D;  5C3I C;  5B33 A;  3AZI B;  1M18 B;  4H9N B;  4Z2M G;  5BNX B;  3AZJ D;  3B6F B;  3AZH B;  1P3G B;  3AYW C;  3LZ1 B;  1AOI A;  5AV5 D;  2NQB A;  3C1C C;  1P3A A;  3W99 C;  3AYW D;  5CPJ A;  3MGP C;  2CV5 C;  1P3P A;  3REK A;  1JFI A;  3REL B;  1KX5 A;  5B24 C;  3C1C D;  3MGQ B;  3MGP D;  3MGS A;  5DNM B;  4ZUX B;  2CV5 D;  4LD9 C;  5AV6 C;  5AY8 D;  3WAA B;  4WZS B;  4DRA A;  5B24 D;  5CP6 C;  1KX4 B;  4JJN C;  3LJA B;  5B31 A;  5KDM A;  5GXQ A;  4LD9 D;  5AV6 D;  3B0D C;  1HQ3 D;  5CP6 D;  5B1M A;  5C3I B;  5B2J A;  2F8N D;  3W98 A;  3AZG A;  3W96 C;  5B32 D;  4J8X D;  3AYW B;  4G91 C;  3AV1 A;  3UTB C;  1R4V A;  5CPK C;  3V9R B;  3LJA A;  2PYO C;  3KUY C;  2HUE C;  1M19 C;  2L5A A;  1P3O C;  3C1C B;  3W96 D;  3W99 B;  3AZE A;  3UTB D;  3MGP B;  5CPK D;  1P3F C;  2PYO D;  4H9P B;  3KUY D;  2CV5 B;  1M19 D;  5F99 A;  5B24 B;  3O62 C;  5E5A C;  1ID3 D;  1P3F D;  1P3B D;  4UUZ A;  4LD9 B;  5AV6 B;  2ARO D;  1ZLA C;  1KX3 A;  3LZ0 C;  5CP6 B;  3O62 D;  1P34 D;  3MGR A;  4JJN B;  5E5A D;  2F8N B;  4NE6 A;  1EQZ C;  5B2I C;  3B0D B;  4G92 C;  1ZLA D;  4J8U C;  3REH D;  3UT9 A;  2BYM B;  2YFW B;  5AVB A;  5CPI A;  4KUD C;  1EQZ D;  5B2I D;  4YS3 C;  4J8U D;  3W96 B;  2LY8 A;  2YFV A;  4H9R A;  4G91 B;  3B6G D;  3REI C;  3UTB B;  5CPK B;  2PYO B;  3KUY B;  4KUD D;  2HUE B;  1M19 B;  1P3L A;  1TZY A;  1P3O B;  5AVC A;  3W97 A;  4YS3 D;  4Z5T A;  5GT0 D;  1M1A A;  1P3F B;  3LEL A;  5JRG C;  3REJ C;  3O62 B;  5E5A B;  1S32 A;  1P3M D;  4R8P C;  4QLC C;  1U35 C;  1ZLA B;  3VH6 W;  3LZ0 B;  4YM6 C;  3WKJ C;  1ULY A;  3WA9 C;  5B0Z C;  4R8P D;  1EQZ B;  5B2I B;  3R45 A;  4NFT A;  4G92 B;  3UTA A;  4J8U B;  3NQU A;  3KWQ C;  3X1V C;  1TAF A;  5B1L D;  4YM6 D;  3WKJ D;  4WU9 A;  4WV4 B;  5B33 D;  4KUD B;  5GSU C;  2NZD C;  4YS3 B;  3AZL A;  3KWQ D;  4J8V A;  3REI B;  5BNV A;  2NZD D;  3AZF C;  2FJ7 A;  3AV2 A;  5FUG B;  4Z66 D;  5BS7 A;  3C1B C;  3AN2 C;  4E44 A;  1P3P D;  3VH5 A;  3AZF D;  5JRG B;  3REJ B;  1KX5 D;  4WNN B;  3AZJ C;  3C1B D;  3AN2 D;  4KHA B;  3MGS D;  4QLC B;  4R8P B;  5AV5 C;  4YM6 B;  5AV9 A;  3WKJ B;  4H9O A;  2BYK B;  5G49 A;  3MNN C;  3WA9 B;  5B31 D;  5B0Z B;  5GXQ D;  5B0Y A;  5JRG A;  3KWQ B;  3X1V B;  1F66 C;  4WNN A;  5B1M D;  3MNN D;  5B2J D;  3B0C T;  5GSU B;  3KXB C;  2NZD B;  5AY8 C;  3AZI A;  1M18 A;  3AZG D;  2HIO C;  4H9N A;  5BNX A;  1F66 D;  3AV1 D;  3B6F A;  3AZH A;  1P3G A;  3WA9 A;  3KXB D;  3LZ1 A;  3AZF B;  1HQ3 C;  2HIO D;  3C1B B;  5DNN C;  3X1S C;  3AN2 B;  2F8N H;  5GSU A;  5F99 D;  3REL A;  3AZJ B;  5B32 C;  4J8X C;  5DNN D;  3X1S D;  4CAY B;  2IO5 C;  3MGQ A;  3AZN D;  5DNM A;  4ZUX A;  1N1J B;  5AV5 B;  1P3K C;  3A6N C;  3WAA A;  1P3I C;  3MNN B;  1A7W A;  1KX4 A;  1BFM A;  4H9S A;  1P3K D;  3A6N D;  3TU4 D;  1F66 B;  1P3I D;  3UT9 D;  5AV8 C;  4XUJ C;  1ID3 C;  1BH9 B;  3KXB B;  1P3B C;  5AY8 B;  2ARO C;  5AV5 A;  1BH8 B;  2HIO B;  5AV8 D;  1P34 C;  5GT3 C;  3AYW A;  4XUJ D;  4J8W D;  3V9R A;  2RVQ C;  1HQ3 B;  1Q9C A;  4X23 C;  4WU8 C;  3REH C;  3W97 D;  5DNN B;  3X1S B;  3C1C A;  1M1A D;  5GT3 D;  3WTP E;  3W99 A;  5JA4 B;  5B40 C;  1KU5 A;  4XZQ C;  3MGP A;  3WTP C;  3KSY A;  2RVQ D;  4H9P A;  2CV5 A;  4X23 D;  4WU8 D;  5B32 B;  4J8X B;  5B24 A;  3B6G C;  2IO5 B;  5B40 D; 
#chains in the Genus database with same CATH topology
 4XZQ D;  1B67 A;  3WTP D;  1P3K B;  2W8S A;  2ZY5 A;  1B6W A;  3A6N B;  2Y2M A;  5AV6 A;  4LD9 A;  3X1T C;  1P3I B;  3VH6 A;  5CP6 A;  5GT0 C;  3AZK C;  1U35 D;  4JJN A;  3AZM C;  5JA4 A;  2F8N A;  2Y2Q A;  3X1T D;  5AV8 B;  2BYM A;  2YFW A;  4XUJ B;  3AZK D;  3X1U C;  3AZM D;  3VH5 T;  1P3M C;  1P3B B;  1ID3 B;  2ARO B;  4AWL C;  5BO0 B;  4J8V D;  3W96 A;  1P34 B;  5GT3 B;  4KGC D;  3X1U D;  3UTB A;  3MVD C;  3B0C W;  5CPK A;  2PYO A;  3KUY A;  1M19 A;  4X23 B;  4WU8 B;  3REH B;  1P3O A;  1F1E A;  5B1L C;  3AFA C;  5B40 B;  4XZQ B;  1H3O B;  3MVD D;  5B33 C;  3WTP B;  1P3F A;  3O62 A;  3AFA D;  1P34 A;  3B6G B;  1U35 B;  5E5A A;  1AOI C;  4CSR B;  3X1T B;  2NQB C;  1ZLA A;  4Z66 C;  3LZ0 A;  1P3A C;  5GT0 B;  3AZK B;  5CPJ C;  3AZM B;  5B0Y D;  1AOI D;  1P3P C;  3REK C;  1EQZ A;  5B2I A;  2NQB D;  1KX5 C;  4J8U A;  1P3A D;  3NQJ B;  1P3M B;  5CPJ D;  3X1U B;  2F8N G;  3MGS C;  4KUD A;  4AWL B;  3REK D;  1M18 D;  5B32 G;  4YS3 A;  3AZH D;  3REI A;  1P3G D;  3MVD B;  1HTA A;  5B31 C;  5GXQ C;  1WWS A;  2JCH A;  5B1L B;  3AFA B;  5FUG A;  5B1M C;  5B2J C;  5B33 B;  5CHL B;  3W98 C;  4ZBJ C;  3AZG C;  3REJ A;  3KFU G;  3AV1 C;  3LJA C;  1AOI B;  3MGQ D;  4KHA A;  3W98 D;  4QLC A;  4R8P A;  2NQB B;  4Z66 B;  1P3A B;  3AZE C;  2JSS A;  4YM6 A;  3WKJ A;  2BYK A;  3LJA D;  5B0Z A;  3REK B;  1P3P B;  1JFI B;  1KX5 B;  5F99 C;  3KWQ A;  3AZE D;  2Y2H A;  3X1V A;  4EO5 C;  3MGS B;  3EPK A;  3AZN C;  2NZD A;  1KX3 C;  4Z66 A;  3MGR C;  5B31 B;  5KDM B;  5GXQ B;  3VH5 W;  4M6B A;  3VH6 T;  3AZF A;  3TU4 C;  1KX3 D;  2Y2J A;  5B1M B;  4NE3 A;  3MGR D;  3UT9 C;  3W99 D;  2ZY3 A;  4NE5 A;  5AVB C;  5B2J B;  4HGA C;  3C1B A;  3AN2 A;  5CPI C;  3W98 B;  4ZBJ B;  3AZG B;  3A1K A;  3AZJ A;  3AV1 B;  5AVB D;  4J8W C;  4CAY A;  5CPI D;  1P3L C;  1TZY C;  5AVC C;  3H0L C;  3W97 C;  1N1J A;  3AZE B;  4Z5T C;  1M1A C;  3MNN A;  4JJN D;  2F8N K;  1P3L D;  1TZY D;  2BG1 A;  5AVC D;  3LEL C;  4Z2M H;  5F99 B;  4Z5T D;  1F66 A;  1S32 C;  4EO5 B;  2XD5 A;  3AZN B;  2ZY4 A;  4UUZ B;  1BH9 A;  3KXB A;  3LEL D;  5AY8 A;  1KX3 B;  3MGR B;  1BH8 A;  2HIO A;  3EG5 B;  1S32 D;  2Y2N A;  3UTA C;  3TU4 B;  1P3O D;  1HQ3 A;  3UT9 B;  4WU9 C;  5AVB B;  5DNN A;  4HGA B;  3X1S A;  5CPI B;  1WWI A;  3AZN A;  3UTA D;  3AZL C;  2YFV B;  4H9R B;  4J8V C;  2DQN C;  5B32 A;  4WU9 D;  4J8X A;  4J8W B;  4KGC C;  1P3L B;  4E45 A;  1TZY B;  5AVC B;  1P3K A;  2FJ7 C;  3W97 B;  3AZL D;  3AV2 C;  3A6N A;  3TU4 A;  4Z5T B;  2CWE A;  3LZ0 D;  5BS7 C;  1P3I A;  1M1A B;  5B31 G;  3LEL B;  2FJ7 D;  3AV2 D;  5AV8 A;  1S32 B;  2Y2O A;  3B0B A;  4XUJ A;  4J8W A;  1ID3 A;  1P3B A;  2ARO A;  3EPL A;  5BO0 A;  5AV9 C;  3REI D;  2XD1 A;  5BT1 C;  5GT3 A;  5B0Y C;  3UTA B;  3R45 B;  4X23 A;  3NQU B;  4WU8 A;  3REH A;  1TAF B;  5AV9 D;  4WU9 B;  5BT1 D;  5B40 A;  4XZQ A;  1H3O A;  3WTP A;  3AZL B;  3AZI C;  1M18 C;  5JRG D;  3REJ D;  4J8V B;  5BNV B;  3B6F C;  3AZH C;  3B6G A;  1P3G C;  4KGC B;  1U35 A;  4QLC D;  3LZ1 C;  2FJ7 B;  3FDD A;  3AZI D;  3AV2 B;  4CSR A;  3X1T A;  4H9Q B;  3B6F D;  5GT0 A;  3AZK A;  3WA9 D;  3AZM A;  5B0Z D;  3LZ1 D;  3REL C;  3X1V D;  1T3U A;  3NQJ A;  1P3M A;  2FFF B;  4KGC A;  3X1U A;  3MGQ C;  5GSU D;  5DNM C;  4ZUX C;  3WAA C;  3REL D;  5AV9 B;  4H9O B;  5G49 B;  4H9Q A;  1KX4 C;  4H9S C;  5B0Y B;  3MVD A;  5DNM D;  4ZUX D;  4DRB A;  3WAA D;  5CPJ B;  5B1L A;  3AFA A;  1KX4 D;  5C3I C;  5B33 A;  3AZI B;  1M18 B;  4H9N B;  4Z2M G;  5BNX B;  3AZJ D;  3B6F B;  3AZH B;  1P3G B;  3AYW C;  3LZ1 B;  1AOI A;  5AV5 D;  3A1I A;  3IP4 C;  2NQB A;  3C1C C;  1P3A A;  3W99 C;  3AYW D;  5CPJ A;  3F6T A;  3MGP C;  1Z2C B;  2CV5 C;  1P3P A;  3REK A;  1JFI A;  3REL B;  1KX5 A;  5B24 C;  3C1C D;  3MGQ B;  3MGP D;  3MGS A;  5DNM B;  4ZUX B;  2CV5 D;  3P5J B;  5AV6 C;  5AY8 D;  3WAA B;  4LD9 C;  4WZS B;  4DRA A;  5B24 D;  5CP6 C;  1KX4 B;  4JJN C;  3LJA B;  5B31 A;  2Y2L A;  5KDM A;  5GXQ A;  4LD9 D;  5AV6 D;  3B0D C;  1HQ3 D;  2G5H C;  2F2A C;  5CP6 D;  5B1M A;  5C3I B;  5B2J A;  2F8N D;  3W98 A;  3EPJ A;  3AZG A;  3W96 C;  5B32 D;  4J8X D;  3AYW B;  4G91 C;  3AV1 A;  3UTB C;  1R4V A;  5CPK C;  3V9R B;  3LJA A;  2PYO C;  3KUY C;  2HUE C;  1M19 C;  2L5A A;  1P3O C;  1W2E A;  3C1C B;  3W96 D;  3W99 B;  3AZE A;  3UTB D;  3MGP B;  5CPK D;  1P3F C;  2PYO D;  4H9P B;  3KUY D;  2CV5 B;  1M19 D;  2RIQ A;  5F99 A;  5B24 B;  3O62 C;  3EPH A;  5E5A C;  1ID3 D;  1P3F D;  1P3B D;  4UUZ A;  4LD9 B;  5AV6 B;  2ARO D;  1ZLA C;  1KX3 A;  3LZ0 C;  5CP6 B;  3O62 D;  1P34 D;  3MGR A;  2Y2P A;  4JJN B;  5E5A D;  2F8N B;  4NE6 A;  1EQZ C;  5B2I C;  3B0D B;  4G92 C;  2Y2I A;  1ZLA D;  4J8U C;  3REH D;  3UT9 A;  2BYM B;  2YFW B;  5AVB A;  5CPI A;  4KUD C;  1EQZ D;  5B2I D;  4YS3 C;  4J8U D;  3W96 B;  2LY8 A;  2YFV A;  4H9R A;  4G91 B;  3B6G D;  3REI C;  3UTB B;  5CPK B;  2PYO B;  3KUY B;  2G5I C;  2HUE B;  1M19 B;  4KUD D;  1P3L A;  1TZY A;  1P3O B;  5AVC A;  3W97 A;  4YS3 D;  4Z5T A;  5GT0 D;  1M1A A;  1P3F B;  3LEL A;  5JRG C;  3REJ C;  3O62 B;  5E5A B;  1S32 A;  1P3M D;  4R8P C;  4QLC C;  1U35 C;  1ZLA B;  3VH6 W;  3LZ0 B;  4YM6 C;  3WKJ C;  1ULY A;  3WA9 C;  2DF4 C;  5B0Z C;  4R8P D;  1EQZ B;  5B2I B;  3R45 A;  4NFT A;  4G92 B;  3UTA A;  4J8U B;  3NQU A;  3KWQ C;  3X1V C;  1TAF A;  5B1L D;  4YM6 D;  3WKJ D;  4WU9 A;  4WV4 B;  5B33 D;  4KUD B;  5GSU C;  2NZD C;  3AL0 C;  4YS3 B;  3AZL A;  3KWQ D;  4J8V A;  3REI B;  5BNV A;  2NZD D;  3AZF C;  2FJ7 A;  3AV2 A;  5FUG B;  4Z66 D;  3H0R C;  5BS7 A;  3C1B C;  3AN2 C;  4E44 A;  4UPK A;  1P3P D;  3VH5 A;  3AZF D;  5JRG B;  3REJ B;  1KX5 D;  4WNN B;  3AZJ C;  1PZR A;  3C1B D;  3AN2 D;  4KHA B;  3MGS D;  4QLC B;  4R8P B;  4DQY B;  5AV5 C;  4YM6 B;  5AV9 A;  3WKJ B;  4H9O A;  2BYK B;  5G49 A;  3MNN C;  3WA9 B;  2ZM5 A;  5B31 D;  5B0Z B;  5GXQ D;  5B0Y A;  5JRG A;  3KWQ B;  3X1V B;  1F66 C;  4WNN A;  5B1M D;  3MNN D;  5B2J D;  3B0C T;  5GSU B;  3KXB C;  2NZD B;  5AY8 C;  3AZI A;  1M18 A;  3AZG D;  2HIO C;  4H9N A;  5BNX A;  1F66 D;  3AV1 D;  3B6F A;  3AZH A;  1P3G A;  3WA9 A;  3KXB D;  4WJ3 C;  3LZ1 A;  3AZF B;  1HQ3 C;  2UWX A;  2HIO D;  3C1B B;  5DNN C;  3X1S C;  3AN2 B;  2F8N H;  2VQR A;  5GSU A;  5F99 D;  3REL A;  3AZJ B;  5B32 C;  4J8X C;  5DNN D;  3X1S D;  4CAY B;  2IO5 C;  3MGQ A;  3AZN D;  5DNM A;  4ZUX A;  1N1J B;  5AV5 B;  1P3K C;  3A6N C;  3WAA A;  1P3I C;  3MNN B;  1A7W A;  2J8P A;  1KX4 A;  1BFM A;  4H9S A;  1P3K D;  3A6N D;  3TU4 D;  2Y2K A;  1F66 B;  1P3I D;  3UT9 D;  5AV8 C;  2ZY2 A;  2Y2G A;  4XUJ C;  1ID3 C;  1BH9 B;  3KXB B;  1P3B C;  5AY8 B;  2ARO C;  5AV5 A;  1BH8 B;  2HIO B;  5AV8 D;  1P34 C;  5GT3 C;  3AYW A;  4XUJ D;  4J8W D;  3V9R A;  2RVQ C;  3H0M C;  1HQ3 B;  1Q9C A;  4X23 C;  4WU8 C;  3REH C;  3W97 D;  5DNN B;  3X1S B;  3C1C A;  1M1A D;  5GT3 D;  3WTP E;  3W99 A;  5JA4 B;  5B40 C;  1KU5 A;  4XZQ C;  3MGP A;  3WTP C;  3KSY A;  2RVQ D;  4H9P A;  2CV5 A;  4X23 D;  4WU8 D;  2JE5 A;  5B32 B;  4J8X B;  5B24 A;  3B6G C;  2IO5 B;  5B40 D; 
#chains in the Genus database with same CATH homology
 4XZQ D;  1B67 A;  3WTP D;  1P3K B;  2W8S A;  2ZY5 A;  1B6W A;  3A6N B;  2Y2M A;  5AV6 A;  4LD9 A;  3X1T C;  1P3I B;  3VH6 A;  5CP6 A;  5GT0 C;  3AZK C;  1U35 D;  4JJN A;  3AZM C;  5JA4 A;  2F8N A;  2Y2Q A;  3X1T D;  5AV8 B;  2BYM A;  2YFW A;  4XUJ B;  3AZK D;  3X1U C;  3AZM D;  3VH5 T;  1P3M C;  1P3B B;  1ID3 B;  2ARO B;  4AWL C;  5BO0 B;  4J8V D;  3W96 A;  1P34 B;  5GT3 B;  4KGC D;  3X1U D;  3UTB A;  3MVD C;  3B0C W;  5CPK A;  2PYO A;  3KUY A;  1M19 A;  4X23 B;  4WU8 B;  3REH B;  1P3O A;  1F1E A;  5B1L C;  3AFA C;  5B40 B;  4XZQ B;  1H3O B;  3MVD D;  5B33 C;  3WTP B;  1P3F A;  3O62 A;  3AFA D;  1P34 A;  3B6G B;  1U35 B;  5E5A A;  1AOI C;  4CSR B;  3X1T B;  2NQB C;  1ZLA A;  4Z66 C;  3LZ0 A;  1P3A C;  5GT0 B;  3AZK B;  5CPJ C;  3AZM B;  5B0Y D;  1AOI D;  1P3P C;  3REK C;  1EQZ A;  5B2I A;  2NQB D;  1KX5 C;  4J8U A;  1P3A D;  3NQJ B;  1P3M B;  5CPJ D;  3X1U B;  2F8N G;  3MGS C;  4KUD A;  4AWL B;  3REK D;  1M18 D;  5B32 G;  4YS3 A;  3AZH D;  3REI A;  1P3G D;  3MVD B;  1HTA A;  5B31 C;  5GXQ C;  1WWS A;  2JCH A;  5B1L B;  3AFA B;  5FUG A;  5B1M C;  5B2J C;  5B33 B;  5CHL B;  3W98 C;  4ZBJ C;  3AZG C;  3REJ A;  3KFU G;  3AV1 C;  3LJA C;  1AOI B;  3MGQ D;  4KHA A;  3W98 D;  4QLC A;  4R8P A;  2NQB B;  4Z66 B;  1P3A B;  3AZE C;  2JSS A;  4YM6 A;  3WKJ A;  2BYK A;  3LJA D;  5B0Z A;  3REK B;  1P3P B;  1JFI B;  1KX5 B;  5F99 C;  3KWQ A;  3AZE D;  2Y2H A;  3X1V A;  4EO5 C;  3MGS B;  3EPK A;  3AZN C;  2NZD A;  1KX3 C;  4Z66 A;  3MGR C;  5B31 B;  5KDM B;  5GXQ B;  3VH5 W;  4M6B A;  3VH6 T;  3AZF A;  3TU4 C;  1KX3 D;  2Y2J A;  5B1M B;  4NE3 A;  3MGR D;  3UT9 C;  3W99 D;  2ZY3 A;  4NE5 A;  5AVB C;  5B2J B;  4HGA C;  3C1B A;  3AN2 A;  5CPI C;  3W98 B;  4ZBJ B;  3AZG B;  3A1K A;  3AZJ A;  3AV1 B;  5AVB D;  4J8W C;  4CAY A;  5CPI D;  1P3L C;  1TZY C;  5AVC C;  3H0L C;  3W97 C;  1N1J A;  3AZE B;  4Z5T C;  1M1A C;  3MNN A;  4JJN D;  2F8N K;  1P3L D;  1TZY D;  2BG1 A;  5AVC D;  3LEL C;  4Z2M H;  5F99 B;  4Z5T D;  1F66 A;  1S32 C;  4EO5 B;  2XD5 A;  3AZN B;  2ZY4 A;  4UUZ B;  1BH9 A;  3KXB A;  3LEL D;  5AY8 A;  1KX3 B;  3MGR B;  1BH8 A;  2HIO A;  3EG5 B;  1S32 D;  2Y2N A;  3UTA C;  3TU4 B;  1P3O D;  1HQ3 A;  3UT9 B;  4WU9 C;  5AVB B;  5DNN A;  4HGA B;  3X1S A;  5CPI B;  1WWI A;  3AZN A;  3UTA D;  3AZL C;  2YFV B;  4H9R B;  4J8V C;  2DQN C;  5B32 A;  4WU9 D;  4J8X A;  4J8W B;  4KGC C;  1P3L B;  4E45 A;  1TZY B;  5AVC B;  1P3K A;  2FJ7 C;  3W97 B;  3AZL D;  3AV2 C;  3A6N A;  3TU4 A;  4Z5T B;  2CWE A;  3LZ0 D;  5BS7 C;  1P3I A;  1M1A B;  5B31 G;  3LEL B;  2FJ7 D;  3AV2 D;  5AV8 A;  1S32 B;  2Y2O A;  3B0B A;  4XUJ A;  4J8W A;  1ID3 A;  1P3B A;  2ARO A;  3EPL A;  5BO0 A;  5AV9 C;  3REI D;  2XD1 A;  5BT1 C;  5GT3 A;  5B0Y C;  3UTA B;  3R45 B;  4X23 A;  3NQU B;  4WU8 A;  3REH A;  1TAF B;  5AV9 D;  4WU9 B;  5BT1 D;  5B40 A;  4XZQ A;  1H3O A;  3WTP A;  3AZL B;  3AZI C;  1M18 C;  5JRG D;  3REJ D;  4J8V B;  5BNV B;  3B6F C;  3AZH C;  3B6G A;  1P3G C;  4KGC B;  1U35 A;  4QLC D;  3LZ1 C;  2FJ7 B;  3FDD A;  3AZI D;  3AV2 B;  4CSR A;  3X1T A;  4H9Q B;  3B6F D;  5GT0 A;  3AZK A;  3WA9 D;  3AZM A;  5B0Z D;  3LZ1 D;  3REL C;  3X1V D;  1T3U A;  3NQJ A;  1P3M A;  2FFF B;  4KGC A;  3X1U A;  3MGQ C;  5GSU D;  5DNM C;  4ZUX C;  3WAA C;  3REL D;  5AV9 B;  4H9O B;  5G49 B;  4H9Q A;  1KX4 C;  4H9S C;  5B0Y B;  3MVD A;  5DNM D;  4ZUX D;  4DRB A;  3WAA D;  5CPJ B;  5B1L A;  3AFA A;  1KX4 D;  5C3I C;  5B33 A;  3AZI B;  1M18 B;  4H9N B;  4Z2M G;  5BNX B;  3AZJ D;  3B6F B;  3AZH B;  1P3G B;  3AYW C;  3LZ1 B;  1AOI A;  5AV5 D;  3A1I A;  3IP4 C;  2NQB A;  3C1C C;  1P3A A;  3W99 C;  3AYW D;  5CPJ A;  3F6T A;  3MGP C;  1Z2C B;  2CV5 C;  1P3P A;  3REK A;  1JFI A;  3REL B;  1KX5 A;  5B24 C;  3C1C D;  3MGQ B;  3MGP D;  3MGS A;  5DNM B;  4ZUX B;  2CV5 D;  3P5J B;  5AV6 C;  5AY8 D;  3WAA B;  4LD9 C;  4WZS B;  4DRA A;  5B24 D;  5CP6 C;  1KX4 B;  4JJN C;  3LJA B;  5B31 A;  2Y2L A;  5KDM A;  5GXQ A;  4LD9 D;  5AV6 D;  3B0D C;  1HQ3 D;  2G5H C;  2F2A C;  5CP6 D;  5B1M A;  5C3I B;  5B2J A;  2F8N D;  3W98 A;  3EPJ A;  3AZG A;  3W96 C;  5B32 D;  4J8X D;  3AYW B;  4G91 C;  3AV1 A;  3UTB C;  1R4V A;  5CPK C;  3V9R B;  3LJA A;  2PYO C;  3KUY C;  2HUE C;  1M19 C;  2L5A A;  1P3O C;  1W2E A;  3C1C B;  3W96 D;  3W99 B;  3AZE A;  3UTB D;  3MGP B;  5CPK D;  1P3F C;  2PYO D;  4H9P B;  3KUY D;  2CV5 B;  1M19 D;  2RIQ A;  5F99 A;  5B24 B;  3O62 C;  3EPH A;  5E5A C;  1ID3 D;  1P3F D;  1P3B D;  4UUZ A;  4LD9 B;  5AV6 B;  2ARO D;  1ZLA C;  1KX3 A;  3LZ0 C;  5CP6 B;  3O62 D;  1P34 D;  3MGR A;  2Y2P A;  4JJN B;  5E5A D;  2F8N B;  4NE6 A;  1EQZ C;  5B2I C;  3B0D B;  4G92 C;  2Y2I A;  1ZLA D;  4J8U C;  3REH D;  3UT9 A;  2BYM B;  2YFW B;  5AVB A;  5CPI A;  4KUD C;  1EQZ D;  5B2I D;  4YS3 C;  4J8U D;  3W96 B;  2LY8 A;  2YFV A;  4H9R A;  4G91 B;  3B6G D;  3REI C;  3UTB B;  5CPK B;  2PYO B;  3KUY B;  2G5I C;  2HUE B;  1M19 B;  4KUD D;  1P3L A;  1TZY A;  1P3O B;  5AVC A;  3W97 A;  4YS3 D;  4Z5T A;  5GT0 D;  1M1A A;  1P3F B;  3LEL A;  5JRG C;  3REJ C;  3O62 B;  5E5A B;  1S32 A;  1P3M D;  4R8P C;  4QLC C;  1U35 C;  1ZLA B;  3VH6 W;  3LZ0 B;  4YM6 C;  3WKJ C;  1ULY A;  3WA9 C;  2DF4 C;  5B0Z C;  4R8P D;  1EQZ B;  5B2I B;  3R45 A;  4NFT A;  4G92 B;  3UTA A;  4J8U B;  3NQU A;  3KWQ C;  3X1V C;  1TAF A;  5B1L D;  4YM6 D;  3WKJ D;  4WU9 A;  4WV4 B;  5B33 D;  4KUD B;  5GSU C;  2NZD C;  3AL0 C;  4YS3 B;  3AZL A;  3KWQ D;  4J8V A;  3REI B;  5BNV A;  2NZD D;  3AZF C;  2FJ7 A;  3AV2 A;  5FUG B;  4Z66 D;  3H0R C;  5BS7 A;  3C1B C;  3AN2 C;  4E44 A;  4UPK A;  1P3P D;  3VH5 A;  3AZF D;  5JRG B;  3REJ B;  1KX5 D;  4WNN B;  3AZJ C;  1PZR A;  3C1B D;  3AN2 D;  4KHA B;  3MGS D;  4QLC B;  4R8P B;  4DQY B;  5AV5 C;  4YM6 B;  5AV9 A;  3WKJ B;  4H9O A;  2BYK B;  5G49 A;  3MNN C;  3WA9 B;  2ZM5 A;  5B31 D;  5B0Z B;  5GXQ D;  5B0Y A;  5JRG A;  3KWQ B;  3X1V B;  1F66 C;  4WNN A;  5B1M D;  3MNN D;  5B2J D;  3B0C T;  5GSU B;  3KXB C;  2NZD B;  5AY8 C;  3AZI A;  1M18 A;  3AZG D;  2HIO C;  4H9N A;  5BNX A;  1F66 D;  3AV1 D;  3B6F A;  3AZH A;  1P3G A;  3WA9 A;  3KXB D;  4WJ3 C;  3LZ1 A;  3AZF B;  1HQ3 C;  2UWX A;  2HIO D;  3C1B B;  5DNN C;  3X1S C;  3AN2 B;  2F8N H;  2VQR A;  5GSU A;  5F99 D;  3REL A;  3AZJ B;  5B32 C;  4J8X C;  5DNN D;  3X1S D;  4CAY B;  2IO5 C;  3MGQ A;  3AZN D;  5DNM A;  4ZUX A;  1N1J B;  5AV5 B;  1P3K C;  3A6N C;  3WAA A;  1P3I C;  3MNN B;  1A7W A;  2J8P A;  1KX4 A;  1BFM A;  4H9S A;  1P3K D;  3A6N D;  3TU4 D;  2Y2K A;  1F66 B;  1P3I D;  3UT9 D;  5AV8 C;  2ZY2 A;  2Y2G A;  4XUJ C;  1ID3 C;  1BH9 B;  3KXB B;  1P3B C;  5AY8 B;  2ARO C;  5AV5 A;  1BH8 B;  2HIO B;  5AV8 D;  1P34 C;  5GT3 C;  3AYW A;  4XUJ D;  4J8W D;  3V9R A;  2RVQ C;  3H0M C;  1HQ3 B;  1Q9C A;  4X23 C;  4WU8 C;  3REH C;  3W97 D;  5DNN B;  3X1S B;  3C1C A;  1M1A D;  5GT3 D;  3WTP E;  3W99 A;  5JA4 B;  5B40 C;  1KU5 A;  4XZQ C;  3MGP A;  3WTP C;  3KSY A;  2RVQ D;  4H9P A;  2CV5 A;  4X23 D;  4WU8 D;  2JE5 A;  5B32 B;  4J8X B;  5B24 A;  3B6G C;  2IO5 B;  5B40 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...