5B1MB

The mouse nucleosome structure containing h3.1
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
78
structure length
78
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Testis-Specific Histone Variant H3t Gene Is Essential for Entry into Spermatogenesis
pubmed doi rcsb
source organism Mus musculus
total genus 26
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b1mB00
3KSYA 5BT1C 4J8VD 3B6GC 3W98D 5AVBA 4J8VA 3W98A 5JA4A 3RELA 5AVCB 4NE5A 2FJ7C 1S32D 5B0ZB 1AOIA 1S32A 3R45A 2AROC 5B0YC 1P3PB 3B0DC 4CSRB 4AWLB 4X23C 4NE6A 5E5AB 3UTBD 1KX3D 1HTAA 3UTBA 1TAFB 3MGRB 5C3IC 3LELD 3W96B 1KX5D 3LELA 5F99D 3UTAC 1KX5A 3WA9C 1N1JA 1U35B 5B1LC 1B6WA 4YM6C 2AROB 1P3FD 5B0YB 3B0DB 1P3FA 1M1AD 4R8PC 5AY8D 4J8XD 1ID3A 2IO5C 1P3MC 2YFWB 3X1TA 5BS7C 4QLCA 5C3IB 1TZYD 3MNND 5CPJC 3UTAB 3LZ0D 3X1SD 3MVDC 3KUYD 1F66C 3WA9B 1BH8A 5GSUA 4H9SC 5B1LB 4YM6B 1KX3B 1ULYA 4KGCD 5B31D 4KGCA 3AZHC 5B31A 5CPKC 1P3OD 5F99B 3WAAC 1P3OA 1P3AD 1P3MB 5CHLB 3VH5T 3MGSA 3W99C 5AV5D 1P3LB 3AZKB 5AV5A 1M1AB 4WNNB 5B40C 5CPJB 2NZDC 4CAYA 3MVDB 1F66B 5AY8B 4YS3C 3REHC 3A6ND 3REJC 3AFAD 3AN2D 3AZHB 3KWQC 3AFAA 4J8UD 3AZFC 4JJNB 3AN2A 1TZYB 3MNNB 4J8UA 5AV9A 5CP6A 5CPKB 3WAAB 3LZ0B 2HIOD 3X1SB 3KUYB 1P34D 3REID 4KUDC 4G92C 3AZEC 3REIA 3AYWC 1M19C 3B6FC 1BH9A 2PYOD 5GT3D 3NQJA 2PYOA 5B40B 5GT3A 3AZJC 5G49B 1A7WA 2NZDB 2HUEC 5DNNA 3REHB 3LZ1C 3TU4B 5KDMB 3AZIC 1P3IC 5B32B 5AVCD 3AV1D 5AVCA 3NQUB 3AZGC 4KUDB 5B0ZA 3A6NB 3AYWB 4H9QB 1M19B 3B6FB 5B2IC 1P3PA 5AV6C 3AZJB 4KHAB 3VH6T 2CV5C 3V9RB 5GXQB 4CSRA 5B33C 2HIOB 3LJAB 5E5AD 4WU9A 1P34B 5E5AA 5BT1D 3X1UC 4Z66C 3B6GD 3O62C 5B2JC 2FJ7D 1TAFA 5B31G 3MGRA 3AZGB 3W96A 4H9NB 2YFVB 5JRGC 1U35D 3MGQC 3AV2A 1U35A 2AROD 2AROA 5B0YD 3AZLC 4NFTA 5B0YA 4ZUXC 1WWIA 3VH5W 3AV1B 5DNMC 3REKC 4ZBJB 3KXBC 1P3GC 4WV4B 2YFWA 5B2JB 2BYKB 5GT0C 3C1BC 3UTAD 1EQZC 3WA9D 5CPIC 3WTPC 3MGPC 3UTAA 1P3BC 3WA9A 5B1LD 4Z5TC 4YM6D 3W97C 5B1LA 4YM6A 1KX3A 4XUJC 3B6GB 2NQBC 1KX4C 2FJ7B 4ZUXB 4H9RB 5DNMB 3REKB 5F99A 1P3MD 3X1VC 3KXBB 1P3MA 5AVBC 4J8VC 3RELC 1P3LD 3AZKD 3B0CT 5GT0B 1P3LA 1R4VA 3AZKA 1F1EA 5CPJD 1M1AA 3MVDD 5CPJA 5CPIB 3WTPB 4X23B 1F66D 3MVDA 1AOIC 5AY8A 4J8XA 1HQ3C 2LY8A 4Z5TB 3W97B 4XUJB 2NQBB 3AZHD 4JJND 3AZHA 4JJNA 5CPKD 1TZYA 3MNNA 5CPKA 3WAAD 4Z2MH 3WAAA 3LZ0A 3X1SA 3KUYA 3X1VB 5FUGB 3W99D 5B40D 1H3OA 2NZDD 5B40A 5G49A 4R8PB 1ZLAC 4YS3D 3REHD 2BYMB 2IO5B 3TU4D 1JFIB 1HQ3B 3REHA 1P3AA 3REJD 3TU4A 2RVQC 5KDMA 5B32D 3KWQD 5B32A 3AZFD 3NQUA 1ID3C 4KUDD 3AZED 4KUDA 1P3KC 3WTPE 4WU8C 3A6NA 3X1TC 3AYWD 1M19D 3B6FD 3UT9C 4QLCC 4H9QA 3AYWA 1M19A 3AZJD 3AZJA 4KHAA 5GXQD 1ZLAB 5GSUC 3V9RA 5GXQA 3LZ1D 3LJAD 2HIOA 4XZQC 5BNXB 3LJAA 1P34A 1P3ID 5AV8C 4KGCC 5BO0B 5B31C 3W99B 3WKJC 4H9PB 4EO5C 3AZGD 1P3OC 3AZGA 4H9NA 4YS3B 2YFVA 3MGSC 1P3KB 3REJB 4WU8B 2F8NH 3UT9B 3KWQB 3AZFB 5B2ID 1KU5A 5AV6D 3AV1A 2F8NB 2CV5D 5B33D 5B24C 3B0CW 4XZQB 4G92B 2L5AA 3AZEB 1M18C 3X1UD 5AV8B 4HGAC 3AFAC 5B2JD 3WKJB 4J8UC 5B2JA 4EO5B 5CP6C 5AV9C 2BYKA 3AZNC 1WWSA 2HUEB 4G91C 5JRGD 3LZ1B 3REIC 4WZSB 3AZIB 1P3IB 3B6GA 4ZUXD 5GT3C 2FJ7A 4ZUXA 5DNMD 4H9RA 5DNMA 5DNNC 3REKD 3REKA 5B24B 3C1CC 1M18B 3KXBD 3KXBA 4J8WC 4HGAB 4UUZB 5B2IB 5GT0D 5B32G 5AV6B 3AZNB 5GT0A 2CV5B 5B33B 5CPID 3WTPD 4G91B 4X23D 3MGPD 1P3BD 4LD9C 3WTPA 4X23A 5B0ZC 4Z5TD 3X1UB 3W97D 4Z66B 4Z5TA 4H9OB 3W97A 4XUJD 2NQBD 3O62B 3VH5A 1KX4D 1P3PC 2NQBA 3AZMC 4AWLC 4WU9C 3C1CB 5JRGB 5E5AC 3X1VD 3MGQB 3X1VA 5AVBD 5BNVB 4J8WB 3RELD 5FUGA 3AZLB 5B1MC 3MGRC 3W96C 4R8PD 4LD9B 4R8PA 1AOID 3AV2C 1HQ3D 1JFIA 2BYMA 1U35C 1HQ3A 1P3GB 3W98C 5BS7A 3C1BB 4WNNA 3AZMB 1EQZB 4WU9B 3MGPB 1P3BB 1S32C 1F66A 4H9SA 1KX4B 5B1MB 1ZLAD 4E45A 1ZLAA 3AV2B 3UTBC 5BNXA 1KX3C 2RVQD 3VH6W 5AVBB 4J8VB 3W98B 5JA4B 3RELB 5BO0A 4DRBA 3W99A 4H9PA 3LELC 1KX5C 1ID3D 2NZDA 5F99C 1AOIB 1S32B 3VH6A 4YS3A 3R45B 1P3KD 4WU8D 1P3KA 3X1TD 3REJA 4WU8A 1BFMA 3UT9D 4QLCD 1P3FC 1P3LC 3UT9A 3AZKC 1M1AC 3KWQA 3AZFA 2F8ND 4NE3A 2F8NA 5GSUD 5AY8C 4J8XC 4XZQD 3UTBB 4XZQA 3AZEA 5AV8D 5AV8A 3WKJD 1B67A 3B6FA 3WKJA 4JJNC 1TZYC 3MNNC 3LELB 1KX5B 3LZ0C 3KUYC 1N1JB 3X1SC 3MGSD 3LZ1A 3AZID 3AZIA 1P3IA 1P3FB 2F8NK 4Z2MG 1ID3B 5B24D 4J8XB 1P3AC 1M18D 3TU4C 5B24A 1M18A 3X1TB 5B32C 4QLCB 5AV5C 5AV9D 5CP6D 3AZND 4UUZA 5B2IA 3AZNA 5AV6A 1BH8B 5GSUB 5B33A 2CV5A 4Z66D 3A6NC 3X1UA 4Z66A 4KGCB 4H9OA 5B31B 3O62D 3AN2C 1H3OB 3O62A 1P3OB 5DNND 2CWEA 5GXQC 2HIOC 3C1CD 3LJAC 1P34C 1P3AB 3C1CA 5JRGA 3MGSB 3MGQD 3MGQA 1Q9CA 4J8WD 5BNVA 4J8WA 5AV5B 3AZLD 2PYOC 3AZLA 4E44A 3B0BA 4CAYB 4LD9D 4LD9A 5B0ZD 1P3GD 1P3GA 3AFAB 3AN2B 1P3PD 4J8UB 5AVCC 4M6BA 5AV9B 5CP6B 3C1BD 3AV1C 3C1BA 3AZMD 1EQZD 4WU9D 3AZMA 1EQZA 3REIB 3MGPA 5CPIA 2F8NG 1P3BA 4ZBJC 1BH9B 2JSSA 4XUJA 3NQJB 2PYOB 5B1MD 5GT3B 3MGRD 4DRAA 1KX4A 5B1MA 3W96D 5DNNB 3AV2D
chains in the Genus database with same CATH superfamily
3KSYA 5BT1C 4J8VD 3B6GC 3W98D 5AVBA 4J8VA 3W98A 5JA4A 3RELA 5AVCB 4NE5A 2FJ7C 1S32D 5B0ZB 1AOIA 1S32A 3R45A 2AROC 5B0YC 1P3PB 3B0DC 4CSRB 4AWLB 4X23C 4NE6A 5E5AB 3UTBD 1KX3D 1HTAA 3UTBA 1TAFB 2XD1A 3A1KA 3MGRB 2G5HC 5C3IC 3LELD 3W96B 1KX5D 3LELA 5F99D 3UTAC 1KX5A 3WA9C 2XD5A 1N1JA 1U35B 3AL0C 5B1LC 1B6WA 4YM6C 2AROB 1PZRA 1P3FD 5B0YB 3B0DB 1P3FA 1M1AD 4R8PC 5AY8D 4J8XD 1ID3A 2IO5C 1P3MC 2YFWB 3X1TA 5BS7C 4QLCA 5C3IB 1TZYD 3MNND 5CPJC 3UTAB 3LZ0D 3X1SD 3MVDC 3KUYD 1F66C 3WA9B 1BH8A 5GSUA 4H9SC 5B1LB 4YM6B 1KX3B 1ULYA 4KGCD 5B31D 4KGCA 3AZHC 5B31A 2DQNC 2W8SA 5CPKC 1P3OD 5F99B 3WAAC 1P3OA 1P3AD 1P3MB 5CHLB 3VH5T 3MGSA 3W99C 5AV5D 2Y2OA 2Y2NA 3AZKB 1P3LB 5AV5A 1M1AB 4WNNB 5B40C 5CPJB 2NZDC 4CAYA 3MVDB 1F66B 5AY8B 2FFFB 4YS3C 3REHC 3A6ND 3REJC 3AFAD 3AN2D 3AZHB 3KWQC 3AFAA 4J8UD 3AZFC 4JJNB 3AN2A 1TZYB 3MNNB 4J8UA 5AV9A 5CP6A 5CPKB 3WAAB 3LZ0B 2HIOD 3X1SB 3KUYB 1P34D 3REID 4KUDC 4G92C 3AZEC 3REIA 3AYWC 1M19C 3B6FC 1BH9A 2PYOD 5GT3D 3NQJA 1T3UA 2PYOA 5B40B 5GT3A 3AZJC 5G49B 1A7WA 2NZDB 2HUEC 5DNNA 3REHB 3LZ1C 3TU4B 5KDMB 3AZIC 1P3IC 5B32B 4UPKA 5AVCD 3AV1D 5AVCA 3NQUB 3AZGC 4KUDB 3A1IA 5B0ZA 3A6NB 2ZY2A 3AYWB 4H9QB 1M19B 3B6FB 5B2IC 1P3PA 5AV6C 3AZJB 4KHAB 3VH6T 2CV5C 3V9RB 5GXQB 4CSRA 5B33C 2HIOB 3LJAB 5E5AD 4WU9A 1P34B 5E5AA 5BT1D 3X1UC 4Z66C 3B6GD 3O62C 5B2JC 2FJ7D 1TAFA 5B31G 3MGRA 3AZGB 3W96A 2RIQA 4H9NB 2YFVB 5JRGC 1U35D 3MGQC 2ZM5A 3AV2A 1U35A 2AROD 2AROA 5B0YD 3AZLC 4NFTA 5B0YA 4ZUXC 1WWIA 3VH5W 3AV1B 3EPHA 5DNMC 3REKC 4ZBJB 3KXBC 1P3GC 4WV4B 2YFWA 5B2JB 2BYKB 5GT0C 3C1BC 3UTAD 1EQZC 3WA9D 5CPIC 3WTPC 3MGPC 3UTAA 1P3BC 3WA9A 5B1LD 4Z5TC 4YM6D 3W97C 5B1LA 4YM6A 1KX3A 4XUJC 3B6GB 2BG1A 3EPJA 2NQBC 1KX4C 2FJ7B 4ZUXB 4H9RB 5DNMB 3REKB 5F99A 1P3MD 3X1VC 3KXBB 1P3MA 5AVBC 4J8VC 2ZY3A 3RELC 1P3LD 3AZKD 3B0CT 5GT0B 1P3LA 1R4VA 3AZKA 1F1EA 5CPJD 1M1AA 3MVDD 5CPJA 5CPIB 3WTPB 4X23B 1F66D 3MVDA 1AOIC 5AY8A 4J8XA 1HQ3C 2LY8A 4Z5TB 3W97B 2J8PA 4XUJB 2NQBB 3AZHD 4WJ3C 4JJND 3AZHA 4JJNA 5CPKD 1TZYA 3MNNA 5CPKA 3WAAD 4Z2MH 3WAAA 3LZ0A 3X1SA 3KUYA 3X1VB 5FUGB 3W99D 5B40D 1H3OA 2NZDD 5B40A 2Y2GA 5G49A 4R8PB 1ZLAC 4YS3D 3REHD 2BYMB 2IO5B 3TU4D 1JFIB 1HQ3B 3REHA 1P3AA 3REJD 3TU4A 3H0MC 2RVQC 5KDMA 3H0RC 5B32D 3KWQD 5B32A 3AZFD 3NQUA 1ID3C 4KUDD 2Y2KA 3AZED 4KUDA 1P3KC 3WTPE 4WU8C 3A6NA 3X1TC 3AYWD 1M19D 3B6FD 3UT9C 4QLCC 4H9QA 3AYWA 1M19A 3AZJD 3F6TA 3AZJA 4KHAA 5GXQD 1ZLAB 5GSUC 3V9RA 5GXQA 3LZ1D 3LJAD 2HIOA 4XZQC 5BNXB 3LJAA 1P34A 1P3ID 5AV8C 4KGCC 5BO0B 5B31C 3W99B 3WKJC 4H9PB 4EO5C 3AZGD 1P3OC 1Z2CB 3AZGA 4H9NA 4YS3B 2YFVA 3MGSC 1P3KB 3REJB 4WU8B 2F8NH 3UT9B 3KWQB 3AZFB 5B2ID 1KU5A 5AV6D 3AV1A 2F8NB 2CV5D 5B33D 5B24C 3B0CW 4XZQB 4G92B 2L5AA 3AZEB 1M18C 3X1UD 5AV8B 4HGAC 3AFAC 5B2JD 3WKJB 4J8UC 5B2JA 4EO5B 5CP6C 5AV9C 2BYKA 3AZNC 1WWSA 2HUEB 4G91C 2DF4C 5JRGD 3LZ1B 3REIC 4WZSB 3AZIB 2Y2JA 1W2EA 1P3IB 3B6GA 4ZUXD 5GT3C 2FJ7A 4ZUXA 2Y2HA 5DNMD 2VQRA 4H9RA 5DNMA 5DNNC 3REKD 3REKA 5B24B 3C1CC 1M18B 3KXBD 3KXBA 4J8WC 4HGAB 3FDDA 4UUZB 5B2IB 5GT0D 5B32G 5AV6B 3AZNB 5GT0A 2CV5B 5B33B 2JCHA 3WTPD 4G91B 4X23D 3MGPD 5CPID 1P3BD 4LD9C 3WTPA 4X23A 5B0ZC 4Z5TD 3X1UB 3W97D 4Z66B 4Z5TA 4H9OB 3W97A 4XUJD 2NQBD 3O62B 3VH5A 1KX4D 1P3PC 2NQBA 3AZMC 4AWLC 4WU9C 3C1CB 5JRGB 5E5AC 3X1VD 3MGQB 3X1VA 5AVBD 5BNVB 4J8WB 4DQYB 3RELD 5FUGA 2Y2LA 3AZLB 5B1MC 3MGRC 2UWXA 3W96C 2Y2QA 4R8PD 4LD9B 4R8PA 1AOID 3AV2C 1HQ3D 1JFIA 2BYMA 2ZY4A 1U35C 1HQ3A 1P3GB 3W98C 5BS7A 3C1BB 4WNNA 3AZMB 1EQZB 3H0LC 4WU9B 3MGPB 1P3BB 1S32C 1F66A 4H9SA 1KX4B 5B1MB 1ZLAD 4E45A 1ZLAA 3AV2B 3UTBC 5BNXA 1KX3C 2RVQD 3VH6W 5AVBB 4J8VB 3W98B 2JE5A 5JA4B 3RELB 2ZY5A 5BO0A 4DRBA 3W99A 4H9PA 3LELC 1KX5C 1ID3D 2NZDA 5F99C 1AOIB 1S32B 3VH6A 4YS3A 3R45B 1P3KD 4WU8D 1P3KA 3X1TD 3REJA 4WU8A 1BFMA 3UT9D 4QLCD 1P3FC 1P3LC 3UT9A 3AZKC 3IP4C 1M1AC 3KWQA 3AZFA 2F8ND 4NE3A 2F8NA 5GSUD 5AY8C 4J8XC 4XZQD 3UTBB 4XZQA 3AZEA 5AV8D 5AV8A 3WKJD 1B67A 3B6FA 3WKJA 4JJNC 1TZYC 3MNNC 3LELB 2Y2IA 1KX5B 3LZ0C 3KUYC 1N1JB 3X1SC 3MGSD 3LZ1A 3AZID 3AZIA 1P3IA 3EPLA 1P3FB 2F8NK 4Z2MG 1ID3B 5B24D 4J8XB 1P3AC 1M18D 3TU4C 5B24A 1M18A 3X1TB 5B32C 4QLCB 5AV5C 3EPKA 5AV9D 5CP6D 3AZND 4UUZA 5B2IA 3AZNA 5AV6A 1BH8B 5GSUB 5B33A 2CV5A 3P5JB 4Z66D 3A6NC 3X1UA 4Z66A 4KGCB 4H9OA 5B31B 3O62D 3AN2C 3KFUG 1H3OB 3O62A 1P3OB 5DNND 2CWEA 2G5IC 5GXQC 2HIOC 3C1CD 3LJAC 1P34C 1P3AB 3C1CA 5JRGA 3MGSB 3MGQD 3MGQA 1Q9CA 2Y2MA 4J8WD 5BNVA 4J8WA 5AV5B 3AZLD 2PYOC 3AZLA 4E44A 3B0BA 4CAYB 4LD9D 4LD9A 5B0ZD 1P3GD 1P3GA 3AFAB 3AN2B 1P3PD 4J8UB 5AVCC 4M6BA 5AV9B 5CP6B 3C1BD 3AV1C 3C1BA 2F2AC 3AZMD 1EQZD 4WU9D 3EG5B 3AZMA 1EQZA 3REIB 3MGPA 5CPIA 2F8NG 1P3BA 4ZBJC 1BH9B 2JSSA 4XUJA 3NQJB 2PYOB 5B1MD 5GT3B 3MGRD 4DRAA 1KX4A 5B1MA 2Y2PA 3W96D 5DNNB 3AV2D
chains in the Genus database with same CATH topology
3KSYA 5BT1C 4J8VD 3B6GC 3W98D 5AVBA 4J8VA 3W98A 5JA4A 3RELA 5AVCB 4NE5A 2FJ7C 1S32D 5B0ZB 1AOIA 1S32A 3R45A 2AROC 5B0YC 1P3PB 3B0DC 4CSRB 4AWLB 4X23C 4NE6A 5E5AB 3UTBD 1KX3D 1HTAA 3UTBA 1TAFB 2XD1A 3A1KA 3MGRB 2G5HC 5C3IC 3LELD 3W96B 1KX5D 3LELA 5F99D 3UTAC 1KX5A 3WA9C 2XD5A 1N1JA 1U35B 3AL0C 5B1LC 1B6WA 4YM6C 2AROB 1PZRA 1P3FD 5B0YB 3B0DB 1P3FA 1M1AD 4R8PC 5AY8D 4J8XD 1ID3A 2IO5C 1P3MC 2YFWB 3X1TA 5BS7C 4QLCA 5C3IB 1TZYD 3MNND 5CPJC 3UTAB 3LZ0D 3X1SD 3MVDC 3KUYD 1F66C 3WA9B 1BH8A 5GSUA 4H9SC 5B1LB 4YM6B 1KX3B 1ULYA 4KGCD 5B31D 4KGCA 3AZHC 5B31A 2DQNC 2W8SA 5CPKC 1P3OD 5F99B 3WAAC 1P3OA 1P3AD 1P3MB 5CHLB 3VH5T 3MGSA 3W99C 5AV5D 2Y2OA 2Y2NA 3AZKB 1P3LB 5AV5A 1M1AB 4WNNB 5B40C 5CPJB 2NZDC 4CAYA 3MVDB 1F66B 5AY8B 2FFFB 4YS3C 3REHC 3A6ND 3REJC 3AFAD 3AN2D 3AZHB 3KWQC 3AFAA 4J8UD 3AZFC 4JJNB 3AN2A 1TZYB 3MNNB 4J8UA 5AV9A 5CP6A 5CPKB 3WAAB 3LZ0B 2HIOD 3X1SB 3KUYB 1P34D 3REID 4KUDC 4G92C 3AZEC 3REIA 3AYWC 1M19C 3B6FC 1BH9A 2PYOD 5GT3D 3NQJA 1T3UA 2PYOA 5B40B 5GT3A 3AZJC 5G49B 1A7WA 2NZDB 2HUEC 5DNNA 3REHB 3LZ1C 3TU4B 5KDMB 3AZIC 1P3IC 5B32B 4UPKA 5AVCD 3AV1D 5AVCA 3NQUB 3AZGC 4KUDB 3A1IA 5B0ZA 3A6NB 2ZY2A 3AYWB 4H9QB 1M19B 3B6FB 5B2IC 1P3PA 5AV6C 3AZJB 4KHAB 3VH6T 2CV5C 3V9RB 5GXQB 4CSRA 5B33C 2HIOB 3LJAB 5E5AD 4WU9A 1P34B 5E5AA 5BT1D 3X1UC 4Z66C 3B6GD 3O62C 5B2JC 2FJ7D 1TAFA 5B31G 3MGRA 3AZGB 3W96A 2RIQA 4H9NB 2YFVB 5JRGC 1U35D 3MGQC 2ZM5A 3AV2A 1U35A 2AROD 2AROA 5B0YD 3AZLC 4NFTA 5B0YA 4ZUXC 1WWIA 3VH5W 3AV1B 3EPHA 5DNMC 3REKC 4ZBJB 3KXBC 1P3GC 4WV4B 2YFWA 5B2JB 2BYKB 5GT0C 3C1BC 3UTAD 1EQZC 3WA9D 5CPIC 3WTPC 3MGPC 3UTAA 1P3BC 3WA9A 5B1LD 4Z5TC 4YM6D 3W97C 5B1LA 4YM6A 1KX3A 4XUJC 3B6GB 2BG1A 3EPJA 2NQBC 1KX4C 2FJ7B 4ZUXB 4H9RB 5DNMB 3REKB 5F99A 1P3MD 3X1VC 3KXBB 1P3MA 5AVBC 4J8VC 2ZY3A 3RELC 1P3LD 3AZKD 3B0CT 5GT0B 1P3LA 1R4VA 3AZKA 1F1EA 5CPJD 1M1AA 3MVDD 5CPJA 5CPIB 3WTPB 4X23B 1F66D 3MVDA 1AOIC 5AY8A 4J8XA 1HQ3C 2LY8A 4Z5TB 3W97B 2J8PA 4XUJB 2NQBB 3AZHD 4WJ3C 4JJND 3AZHA 4JJNA 5CPKD 1TZYA 3MNNA 5CPKA 3WAAD 4Z2MH 3WAAA 3LZ0A 3X1SA 3KUYA 3X1VB 5FUGB 3W99D 5B40D 1H3OA 2NZDD 5B40A 2Y2GA 5G49A 4R8PB 1ZLAC 4YS3D 3REHD 2BYMB 2IO5B 3TU4D 1JFIB 1HQ3B 3REHA 1P3AA 3REJD 3TU4A 3H0MC 2RVQC 5KDMA 3H0RC 5B32D 3KWQD 5B32A 3AZFD 3NQUA 1ID3C 4KUDD 2Y2KA 3AZED 4KUDA 1P3KC 3WTPE 4WU8C 3A6NA 3X1TC 3AYWD 1M19D 3B6FD 3UT9C 4QLCC 4H9QA 3AYWA 1M19A 3AZJD 3F6TA 3AZJA 4KHAA 5GXQD 1ZLAB 5GSUC 3V9RA 5GXQA 3LZ1D 3LJAD 2HIOA 4XZQC 5BNXB 3LJAA 1P34A 1P3ID 5AV8C 4KGCC 5BO0B 5B31C 3W99B 3WKJC 4H9PB 4EO5C 3AZGD 1P3OC 1Z2CB 3AZGA 4H9NA 4YS3B 2YFVA 3MGSC 1P3KB 3REJB 4WU8B 2F8NH 3UT9B 3KWQB 3AZFB 5B2ID 1KU5A 5AV6D 3AV1A 2F8NB 2CV5D 5B33D 5B24C 3B0CW 4XZQB 4G92B 2L5AA 3AZEB 1M18C 3X1UD 5AV8B 4HGAC 3AFAC 5B2JD 3WKJB 4J8UC 5B2JA 4EO5B 5CP6C 5AV9C 2BYKA 3AZNC 1WWSA 2HUEB 4G91C 2DF4C 5JRGD 3LZ1B 3REIC 4WZSB 3AZIB 2Y2JA 1W2EA 1P3IB 3B6GA 4ZUXD 5GT3C 2FJ7A 4ZUXA 2Y2HA 5DNMD 2VQRA 4H9RA 5DNMA 5DNNC 3REKD 3REKA 5B24B 3C1CC 1M18B 3KXBD 3KXBA 4J8WC 4HGAB 3FDDA 4UUZB 5B2IB 5GT0D 5B32G 5AV6B 3AZNB 5GT0A 2CV5B 5B33B 2JCHA 3WTPD 4G91B 4X23D 3MGPD 5CPID 1P3BD 4LD9C 3WTPA 4X23A 5B0ZC 4Z5TD 3X1UB 3W97D 4Z66B 4Z5TA 4H9OB 3W97A 4XUJD 2NQBD 3O62B 3VH5A 1KX4D 1P3PC 2NQBA 3AZMC 4AWLC 4WU9C 3C1CB 5JRGB 5E5AC 3X1VD 3MGQB 3X1VA 5AVBD 5BNVB 4J8WB 4DQYB 3RELD 5FUGA 2Y2LA 3AZLB 5B1MC 3MGRC 2UWXA 3W96C 2Y2QA 4R8PD 4LD9B 4R8PA 1AOID 3AV2C 1HQ3D 1JFIA 2BYMA 2ZY4A 1U35C 1HQ3A 1P3GB 3W98C 5BS7A 3C1BB 4WNNA 3AZMB 1EQZB 3H0LC 4WU9B 3MGPB 1P3BB 1S32C 1F66A 4H9SA 1KX4B 5B1MB 1ZLAD 4E45A 1ZLAA 3AV2B 3UTBC 5BNXA 1KX3C 2RVQD 3VH6W 5AVBB 4J8VB 3W98B 2JE5A 5JA4B 3RELB 2ZY5A 5BO0A 4DRBA 3W99A 4H9PA 3LELC 1KX5C 1ID3D 2NZDA 5F99C 1AOIB 1S32B 3VH6A 4YS3A 3R45B 1P3KD 4WU8D 1P3KA 3X1TD 3REJA 4WU8A 1BFMA 3UT9D 4QLCD 1P3FC 1P3LC 3UT9A 3AZKC 3IP4C 1M1AC 3KWQA 3AZFA 2F8ND 4NE3A 2F8NA 5GSUD 5AY8C 4J8XC 4XZQD 3UTBB 4XZQA 3AZEA 5AV8D 5AV8A 3WKJD 1B67A 3B6FA 3WKJA 4JJNC 1TZYC 3MNNC 3LELB 2Y2IA 1KX5B 3LZ0C 3KUYC 1N1JB 3X1SC 3MGSD 3LZ1A 3AZID 3AZIA 1P3IA 3EPLA 1P3FB 2F8NK 4Z2MG 1ID3B 5B24D 4J8XB 1P3AC 1M18D 3TU4C 5B24A 1M18A 3X1TB 5B32C 4QLCB 5AV5C 3EPKA 5AV9D 5CP6D 3AZND 4UUZA 5B2IA 3AZNA 5AV6A 1BH8B 5GSUB 5B33A 2CV5A 3P5JB 4Z66D 3A6NC 3X1UA 4Z66A 4KGCB 4H9OA 5B31B 3O62D 3AN2C 3KFUG 1H3OB 3O62A 1P3OB 5DNND 2CWEA 2G5IC 5GXQC 2HIOC 3C1CD 3LJAC 1P34C 1P3AB 3C1CA 5JRGA 3MGSB 3MGQD 3MGQA 1Q9CA 2Y2MA 4J8WD 5BNVA 4J8WA 5AV5B 3AZLD 2PYOC 3AZLA 4E44A 3B0BA 4CAYB 4LD9D 4LD9A 5B0ZD 1P3GD 1P3GA 3AFAB 3AN2B 1P3PD 4J8UB 5AVCC 4M6BA 5AV9B 5CP6B 3C1BD 3AV1C 3C1BA 2F2AC 3AZMD 1EQZD 4WU9D 3EG5B 3AZMA 1EQZA 3REIB 3MGPA 5CPIA 2F8NG 1P3BA 4ZBJC 1BH9B 2JSSA 4XUJA 3NQJB 2PYOB 5B1MD 5GT3B 3MGRD 4DRAA 1KX4A 5B1MA 2Y2PA 3W96D 5DNNB 3AV2D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KSY A;  5BT1 C;  4J8V D;  3B6G C;  3W98 D;  5AVB A;  4J8V A;  3W98 A;  5JA4 A;  3REL A;  5AVC B;  4NE5 A;  2FJ7 C;  1S32 D;  5B0Z B;  1AOI A;  1S32 A;  3R45 A;  2ARO C;  5B0Y C;  1P3P B;  3B0D C;  4CSR B;  4AWL B;  4X23 C;  4NE6 A;  5E5A B;  3UTB D;  1KX3 D;  1HTA A;  3UTB A;  1TAF B;  3MGR B;  5C3I C;  3LEL D;  3W96 B;  1KX5 D;  3LEL A;  5F99 D;  3UTA C;  1KX5 A;  3WA9 C;  1N1J A;  1U35 B;  5B1L C;  1B6W A;  4YM6 C;  2ARO B;  1P3F D;  5B0Y B;  3B0D B;  1P3F A;  1M1A D;  4R8P C;  5AY8 D;  4J8X D;  1ID3 A;  2IO5 C;  1P3M C;  2YFW B;  3X1T A;  5BS7 C;  4QLC A;  5C3I B;  1TZY D;  3MNN D;  5CPJ C;  3UTA B;  3LZ0 D;  3X1S D;  3MVD C;  3KUY D;  1F66 C;  3WA9 B;  1BH8 A;  5GSU A;  4H9S C;  5B1L B;  4YM6 B;  1KX3 B;  1ULY A;  4KGC D;  5B31 D;  4KGC A;  3AZH C;  5B31 A;  5CPK C;  1P3O D;  5F99 B;  3WAA C;  1P3O A;  1P3A D;  1P3M B;  5CHL B;  3VH5 T;  3MGS A;  3W99 C;  5AV5 D;  1P3L B;  3AZK B;  5AV5 A;  1M1A B;  4WNN B;  5B40 C;  5CPJ B;  2NZD C;  4CAY A;  3MVD B;  1F66 B;  5AY8 B;  4YS3 C;  3REH C;  3A6N D;  3REJ C;  3AFA D;  3AN2 D;  3AZH B;  3KWQ C;  3AFA A;  4J8U D;  3AZF C;  4JJN B;  3AN2 A;  1TZY B;  3MNN B;  4J8U A;  5AV9 A;  5CP6 A;  5CPK B;  3WAA B;  3LZ0 B;  2HIO D;  3X1S B;  3KUY B;  1P34 D;  3REI D;  4KUD C;  4G92 C;  3AZE C;  3REI A;  3AYW C;  1M19 C;  3B6F C;  1BH9 A;  2PYO D;  5GT3 D;  3NQJ A;  2PYO A;  5B40 B;  5GT3 A;  3AZJ C;  5G49 B;  1A7W A;  2NZD B;  2HUE C;  5DNN A;  3REH B;  3LZ1 C;  3TU4 B;  5KDM B;  3AZI C;  1P3I C;  5B32 B;  5AVC D;  3AV1 D;  5AVC A;  3NQU B;  3AZG C;  4KUD B;  5B0Z A;  3A6N B;  3AYW B;  4H9Q B;  1M19 B;  3B6F B;  5B2I C;  1P3P A;  5AV6 C;  3AZJ B;  4KHA B;  3VH6 T;  2CV5 C;  3V9R B;  5GXQ B;  4CSR A;  5B33 C;  2HIO B;  3LJA B;  5E5A D;  4WU9 A;  1P34 B;  5E5A A;  5BT1 D;  3X1U C;  4Z66 C;  3B6G D;  3O62 C;  5B2J C;  2FJ7 D;  1TAF A;  5B31 G;  3MGR A;  3AZG B;  3W96 A;  4H9N B;  2YFV B;  5JRG C;  1U35 D;  3MGQ C;  3AV2 A;  1U35 A;  2ARO D;  2ARO A;  5B0Y D;  3AZL C;  4NFT A;  5B0Y A;  4ZUX C;  1WWI A;  3VH5 W;  3AV1 B;  5DNM C;  3REK C;  4ZBJ B;  3KXB C;  1P3G C;  4WV4 B;  2YFW A;  5B2J B;  2BYK B;  5GT0 C;  3C1B C;  3UTA D;  1EQZ C;  3WA9 D;  5CPI C;  3WTP C;  3MGP C;  3UTA A;  1P3B C;  3WA9 A;  5B1L D;  4Z5T C;  4YM6 D;  3W97 C;  5B1L A;  4YM6 A;  1KX3 A;  4XUJ C;  3B6G B;  2NQB C;  1KX4 C;  2FJ7 B;  4ZUX B;  4H9R B;  5DNM B;  3REK B;  5F99 A;  1P3M D;  3X1V C;  3KXB B;  1P3M A;  5AVB C;  4J8V C;  3REL C;  1P3L D;  3AZK D;  3B0C T;  5GT0 B;  1P3L A;  1R4V A;  3AZK A;  1F1E A;  5CPJ D;  1M1A A;  3MVD D;  5CPJ A;  5CPI B;  3WTP B;  4X23 B;  1F66 D;  3MVD A;  1AOI C;  5AY8 A;  4J8X A;  1HQ3 C;  2LY8 A;  4Z5T B;  3W97 B;  4XUJ B;  2NQB B;  3AZH D;  4JJN D;  3AZH A;  4JJN A;  5CPK D;  1TZY A;  3MNN A;  5CPK A;  3WAA D;  4Z2M H;  3WAA A;  3LZ0 A;  3X1S A;  3KUY A;  3X1V B;  5FUG B;  3W99 D;  5B40 D;  1H3O A;  2NZD D;  5B40 A;  5G49 A;  4R8P B;  1ZLA C;  4YS3 D;  3REH D;  2BYM B;  2IO5 B;  3TU4 D;  1JFI B;  1HQ3 B;  3REH A;  1P3A A;  3REJ D;  3TU4 A;  2RVQ C;  5KDM A;  5B32 D;  3KWQ D;  5B32 A;  3AZF D;  3NQU A;  1ID3 C;  4KUD D;  3AZE D;  4KUD A;  1P3K C;  3WTP E;  4WU8 C;  3A6N A;  3X1T C;  3AYW D;  1M19 D;  3B6F D;  3UT9 C;  4QLC C;  4H9Q A;  3AYW A;  1M19 A;  3AZJ D;  3AZJ A;  4KHA A;  5GXQ D;  1ZLA B;  5GSU C;  3V9R A;  5GXQ A;  3LZ1 D;  3LJA D;  2HIO A;  4XZQ C;  5BNX B;  3LJA A;  1P34 A;  1P3I D;  5AV8 C;  4KGC C;  5BO0 B;  5B31 C;  3W99 B;  3WKJ C;  4H9P B;  4EO5 C;  3AZG D;  1P3O C;  3AZG A;  4H9N A;  4YS3 B;  2YFV A;  3MGS C;  1P3K B;  3REJ B;  4WU8 B;  2F8N H;  3UT9 B;  3KWQ B;  3AZF B;  5B2I D;  1KU5 A;  5AV6 D;  3AV1 A;  2F8N B;  2CV5 D;  5B33 D;  5B24 C;  3B0C W;  4XZQ B;  4G92 B;  2L5A A;  3AZE B;  1M18 C;  3X1U D;  5AV8 B;  4HGA C;  3AFA C;  5B2J D;  3WKJ B;  4J8U C;  5B2J A;  4EO5 B;  5CP6 C;  5AV9 C;  2BYK A;  3AZN C;  1WWS A;  2HUE B;  4G91 C;  5JRG D;  3LZ1 B;  3REI C;  4WZS B;  3AZI B;  1P3I B;  3B6G A;  4ZUX D;  5GT3 C;  2FJ7 A;  4ZUX A;  5DNM D;  4H9R A;  5DNM A;  5DNN C;  3REK D;  3REK A;  5B24 B;  3C1C C;  1M18 B;  3KXB D;  3KXB A;  4J8W C;  4HGA B;  4UUZ B;  5B2I B;  5GT0 D;  5B32 G;  5AV6 B;  3AZN B;  5GT0 A;  2CV5 B;  5B33 B;  5CPI D;  3WTP D;  4G91 B;  4X23 D;  3MGP D;  1P3B D;  4LD9 C;  3WTP A;  4X23 A;  5B0Z C;  4Z5T D;  3X1U B;  3W97 D;  4Z66 B;  4Z5T A;  4H9O B;  3W97 A;  4XUJ D;  2NQB D;  3O62 B;  3VH5 A;  1KX4 D;  1P3P C;  2NQB A;  3AZM C;  4AWL C;  4WU9 C;  3C1C B;  5JRG B;  5E5A C;  3X1V D;  3MGQ B;  3X1V A;  5AVB D;  5BNV B;  4J8W B;  3REL D;  5FUG A;  3AZL B;  5B1M C;  3MGR C;  3W96 C;  4R8P D;  4LD9 B;  4R8P A;  1AOI D;  3AV2 C;  1HQ3 D;  1JFI A;  2BYM A;  1U35 C;  1HQ3 A;  1P3G B;  3W98 C;  5BS7 A;  3C1B B;  4WNN A;  3AZM B;  1EQZ B;  4WU9 B;  3MGP B;  1P3B B;  1S32 C;  1F66 A;  4H9S A;  1KX4 B;  5B1M B;  1ZLA D;  4E45 A;  1ZLA A;  3AV2 B;  3UTB C;  5BNX A;  1KX3 C;  2RVQ D;  3VH6 W;  5AVB B;  4J8V B;  3W98 B;  5JA4 B;  3REL B;  5BO0 A;  4DRB A;  3W99 A;  4H9P A;  3LEL C;  1KX5 C;  1ID3 D;  2NZD A;  5F99 C;  1AOI B;  1S32 B;  3VH6 A;  4YS3 A;  3R45 B;  1P3K D;  4WU8 D;  1P3K A;  3X1T D;  3REJ A;  4WU8 A;  1BFM A;  3UT9 D;  4QLC D;  1P3F C;  1P3L C;  3UT9 A;  3AZK C;  1M1A C;  3KWQ A;  3AZF A;  2F8N D;  4NE3 A;  2F8N A;  5GSU D;  5AY8 C;  4J8X C;  4XZQ D;  3UTB B;  4XZQ A;  3AZE A;  5AV8 D;  5AV8 A;  3WKJ D;  1B67 A;  3B6F A;  3WKJ A;  4JJN C;  1TZY C;  3MNN C;  3LEL B;  1KX5 B;  3LZ0 C;  3KUY C;  1N1J B;  3X1S C;  3MGS D;  3LZ1 A;  3AZI D;  3AZI A;  1P3I A;  1P3F B;  2F8N K;  4Z2M G;  1ID3 B;  5B24 D;  4J8X B;  1P3A C;  1M18 D;  3TU4 C;  5B24 A;  1M18 A;  3X1T B;  5B32 C;  4QLC B;  5AV5 C;  5AV9 D;  5CP6 D;  3AZN D;  4UUZ A;  5B2I A;  3AZN A;  5AV6 A;  1BH8 B;  5GSU B;  5B33 A;  2CV5 A;  4Z66 D;  3A6N C;  3X1U A;  4Z66 A;  4KGC B;  4H9O A;  5B31 B;  3O62 D;  3AN2 C;  1H3O B;  3O62 A;  1P3O B;  5DNN D;  2CWE A;  5GXQ C;  2HIO C;  3C1C D;  3LJA C;  1P34 C;  1P3A B;  3C1C A;  5JRG A;  3MGS B;  3MGQ D;  3MGQ A;  1Q9C A;  4J8W D;  5BNV A;  4J8W A;  5AV5 B;  3AZL D;  2PYO C;  3AZL A;  4E44 A;  3B0B A;  4CAY B;  4LD9 D;  4LD9 A;  5B0Z D;  1P3G D;  1P3G A;  3AFA B;  3AN2 B;  1P3P D;  4J8U B;  5AVC C;  4M6B A;  5AV9 B;  5CP6 B;  3C1B D;  3AV1 C;  3C1B A;  3AZM D;  1EQZ D;  4WU9 D;  3AZM A;  1EQZ A;  3REI B;  3MGP A;  5CPI A;  2F8N G;  1P3B A;  4ZBJ C;  1BH9 B;  2JSS A;  4XUJ A;  3NQJ B;  2PYO B;  5B1M D;  5GT3 B;  3MGR D;  4DRA A;  1KX4 A;  5B1M A;  3W96 D;  5DNN B;  3AV2 D; 
#chains in the Genus database with same CATH topology
 3KSY A;  5BT1 C;  4J8V D;  3B6G C;  3W98 D;  5AVB A;  4J8V A;  3W98 A;  5JA4 A;  3REL A;  5AVC B;  4NE5 A;  2FJ7 C;  1S32 D;  5B0Z B;  1AOI A;  1S32 A;  3R45 A;  2ARO C;  5B0Y C;  1P3P B;  3B0D C;  4CSR B;  4AWL B;  4X23 C;  4NE6 A;  5E5A B;  3UTB D;  1KX3 D;  1HTA A;  3UTB A;  1TAF B;  2XD1 A;  3A1K A;  3MGR B;  2G5H C;  5C3I C;  3LEL D;  3W96 B;  1KX5 D;  3LEL A;  5F99 D;  3UTA C;  1KX5 A;  3WA9 C;  2XD5 A;  1N1J A;  1U35 B;  3AL0 C;  5B1L C;  1B6W A;  4YM6 C;  2ARO B;  1PZR A;  1P3F D;  5B0Y B;  3B0D B;  1P3F A;  1M1A D;  4R8P C;  5AY8 D;  4J8X D;  1ID3 A;  2IO5 C;  1P3M C;  2YFW B;  3X1T A;  5BS7 C;  4QLC A;  5C3I B;  1TZY D;  3MNN D;  5CPJ C;  3UTA B;  3LZ0 D;  3X1S D;  3MVD C;  3KUY D;  1F66 C;  3WA9 B;  1BH8 A;  5GSU A;  4H9S C;  5B1L B;  4YM6 B;  1KX3 B;  1ULY A;  4KGC D;  5B31 D;  4KGC A;  3AZH C;  5B31 A;  2DQN C;  2W8S A;  5CPK C;  1P3O D;  5F99 B;  3WAA C;  1P3O A;  1P3A D;  1P3M B;  5CHL B;  3VH5 T;  3MGS A;  3W99 C;  5AV5 D;  2Y2O A;  2Y2N A;  3AZK B;  1P3L B;  5AV5 A;  1M1A B;  4WNN B;  5B40 C;  5CPJ B;  2NZD C;  4CAY A;  3MVD B;  1F66 B;  5AY8 B;  2FFF B;  4YS3 C;  3REH C;  3A6N D;  3REJ C;  3AFA D;  3AN2 D;  3AZH B;  3KWQ C;  3AFA A;  4J8U D;  3AZF C;  4JJN B;  3AN2 A;  1TZY B;  3MNN B;  4J8U A;  5AV9 A;  5CP6 A;  5CPK B;  3WAA B;  3LZ0 B;  2HIO D;  3X1S B;  3KUY B;  1P34 D;  3REI D;  4KUD C;  4G92 C;  3AZE C;  3REI A;  3AYW C;  1M19 C;  3B6F C;  1BH9 A;  2PYO D;  5GT3 D;  3NQJ A;  1T3U A;  2PYO A;  5B40 B;  5GT3 A;  3AZJ C;  5G49 B;  1A7W A;  2NZD B;  2HUE C;  5DNN A;  3REH B;  3LZ1 C;  3TU4 B;  5KDM B;  3AZI C;  1P3I C;  5B32 B;  4UPK A;  5AVC D;  3AV1 D;  5AVC A;  3NQU B;  3AZG C;  4KUD B;  3A1I A;  5B0Z A;  3A6N B;  2ZY2 A;  3AYW B;  4H9Q B;  1M19 B;  3B6F B;  5B2I C;  1P3P A;  5AV6 C;  3AZJ B;  4KHA B;  3VH6 T;  2CV5 C;  3V9R B;  5GXQ B;  4CSR A;  5B33 C;  2HIO B;  3LJA B;  5E5A D;  4WU9 A;  1P34 B;  5E5A A;  5BT1 D;  3X1U C;  4Z66 C;  3B6G D;  3O62 C;  5B2J C;  2FJ7 D;  1TAF A;  5B31 G;  3MGR A;  3AZG B;  3W96 A;  2RIQ A;  4H9N B;  2YFV B;  5JRG C;  1U35 D;  3MGQ C;  2ZM5 A;  3AV2 A;  1U35 A;  2ARO D;  2ARO A;  5B0Y D;  3AZL C;  4NFT A;  5B0Y A;  4ZUX C;  1WWI A;  3VH5 W;  3AV1 B;  3EPH A;  5DNM C;  3REK C;  4ZBJ B;  3KXB C;  1P3G C;  4WV4 B;  2YFW A;  5B2J B;  2BYK B;  5GT0 C;  3C1B C;  3UTA D;  1EQZ C;  3WA9 D;  5CPI C;  3WTP C;  3MGP C;  3UTA A;  1P3B C;  3WA9 A;  5B1L D;  4Z5T C;  4YM6 D;  3W97 C;  5B1L A;  4YM6 A;  1KX3 A;  4XUJ C;  3B6G B;  2BG1 A;  3EPJ A;  2NQB C;  1KX4 C;  2FJ7 B;  4ZUX B;  4H9R B;  5DNM B;  3REK B;  5F99 A;  1P3M D;  3X1V C;  3KXB B;  1P3M A;  5AVB C;  4J8V C;  2ZY3 A;  3REL C;  1P3L D;  3AZK D;  3B0C T;  5GT0 B;  1P3L A;  1R4V A;  3AZK A;  1F1E A;  5CPJ D;  1M1A A;  3MVD D;  5CPJ A;  5CPI B;  3WTP B;  4X23 B;  1F66 D;  3MVD A;  1AOI C;  5AY8 A;  4J8X A;  1HQ3 C;  2LY8 A;  4Z5T B;  3W97 B;  2J8P A;  4XUJ B;  2NQB B;  3AZH D;  4WJ3 C;  4JJN D;  3AZH A;  4JJN A;  5CPK D;  1TZY A;  3MNN A;  5CPK A;  3WAA D;  4Z2M H;  3WAA A;  3LZ0 A;  3X1S A;  3KUY A;  3X1V B;  5FUG B;  3W99 D;  5B40 D;  1H3O A;  2NZD D;  5B40 A;  2Y2G A;  5G49 A;  4R8P B;  1ZLA C;  4YS3 D;  3REH D;  2BYM B;  2IO5 B;  3TU4 D;  1JFI B;  1HQ3 B;  3REH A;  1P3A A;  3REJ D;  3TU4 A;  3H0M C;  2RVQ C;  5KDM A;  3H0R C;  5B32 D;  3KWQ D;  5B32 A;  3AZF D;  3NQU A;  1ID3 C;  4KUD D;  2Y2K A;  3AZE D;  4KUD A;  1P3K C;  3WTP E;  4WU8 C;  3A6N A;  3X1T C;  3AYW D;  1M19 D;  3B6F D;  3UT9 C;  4QLC C;  4H9Q A;  3AYW A;  1M19 A;  3AZJ D;  3F6T A;  3AZJ A;  4KHA A;  5GXQ D;  1ZLA B;  5GSU C;  3V9R A;  5GXQ A;  3LZ1 D;  3LJA D;  2HIO A;  4XZQ C;  5BNX B;  3LJA A;  1P34 A;  1P3I D;  5AV8 C;  4KGC C;  5BO0 B;  5B31 C;  3W99 B;  3WKJ C;  4H9P B;  4EO5 C;  3AZG D;  1P3O C;  1Z2C B;  3AZG A;  4H9N A;  4YS3 B;  2YFV A;  3MGS C;  1P3K B;  3REJ B;  4WU8 B;  2F8N H;  3UT9 B;  3KWQ B;  3AZF B;  5B2I D;  1KU5 A;  5AV6 D;  3AV1 A;  2F8N B;  2CV5 D;  5B33 D;  5B24 C;  3B0C W;  4XZQ B;  4G92 B;  2L5A A;  3AZE B;  1M18 C;  3X1U D;  5AV8 B;  4HGA C;  3AFA C;  5B2J D;  3WKJ B;  4J8U C;  5B2J A;  4EO5 B;  5CP6 C;  5AV9 C;  2BYK A;  3AZN C;  1WWS A;  2HUE B;  4G91 C;  2DF4 C;  5JRG D;  3LZ1 B;  3REI C;  4WZS B;  3AZI B;  2Y2J A;  1W2E A;  1P3I B;  3B6G A;  4ZUX D;  5GT3 C;  2FJ7 A;  4ZUX A;  2Y2H A;  5DNM D;  2VQR A;  4H9R A;  5DNM A;  5DNN C;  3REK D;  3REK A;  5B24 B;  3C1C C;  1M18 B;  3KXB D;  3KXB A;  4J8W C;  4HGA B;  3FDD A;  4UUZ B;  5B2I B;  5GT0 D;  5B32 G;  5AV6 B;  3AZN B;  5GT0 A;  2CV5 B;  5B33 B;  2JCH A;  3WTP D;  4G91 B;  4X23 D;  3MGP D;  5CPI D;  1P3B D;  4LD9 C;  3WTP A;  4X23 A;  5B0Z C;  4Z5T D;  3X1U B;  3W97 D;  4Z66 B;  4Z5T A;  4H9O B;  3W97 A;  4XUJ D;  2NQB D;  3O62 B;  3VH5 A;  1KX4 D;  1P3P C;  2NQB A;  3AZM C;  4AWL C;  4WU9 C;  3C1C B;  5JRG B;  5E5A C;  3X1V D;  3MGQ B;  3X1V A;  5AVB D;  5BNV B;  4J8W B;  4DQY B;  3REL D;  5FUG A;  2Y2L A;  3AZL B;  5B1M C;  3MGR C;  2UWX A;  3W96 C;  2Y2Q A;  4R8P D;  4LD9 B;  4R8P A;  1AOI D;  3AV2 C;  1HQ3 D;  1JFI A;  2BYM A;  2ZY4 A;  1U35 C;  1HQ3 A;  1P3G B;  3W98 C;  5BS7 A;  3C1B B;  4WNN A;  3AZM B;  1EQZ B;  3H0L C;  4WU9 B;  3MGP B;  1P3B B;  1S32 C;  1F66 A;  4H9S A;  1KX4 B;  5B1M B;  1ZLA D;  4E45 A;  1ZLA A;  3AV2 B;  3UTB C;  5BNX A;  1KX3 C;  2RVQ D;  3VH6 W;  5AVB B;  4J8V B;  3W98 B;  2JE5 A;  5JA4 B;  3REL B;  2ZY5 A;  5BO0 A;  4DRB A;  3W99 A;  4H9P A;  3LEL C;  1KX5 C;  1ID3 D;  2NZD A;  5F99 C;  1AOI B;  1S32 B;  3VH6 A;  4YS3 A;  3R45 B;  1P3K D;  4WU8 D;  1P3K A;  3X1T D;  3REJ A;  4WU8 A;  1BFM A;  3UT9 D;  4QLC D;  1P3F C;  1P3L C;  3UT9 A;  3AZK C;  3IP4 C;  1M1A C;  3KWQ A;  3AZF A;  2F8N D;  4NE3 A;  2F8N A;  5GSU D;  5AY8 C;  4J8X C;  4XZQ D;  3UTB B;  4XZQ A;  3AZE A;  5AV8 D;  5AV8 A;  3WKJ D;  1B67 A;  3B6F A;  3WKJ A;  4JJN C;  1TZY C;  3MNN C;  3LEL B;  2Y2I A;  1KX5 B;  3LZ0 C;  3KUY C;  1N1J B;  3X1S C;  3MGS D;  3LZ1 A;  3AZI D;  3AZI A;  1P3I A;  3EPL A;  1P3F B;  2F8N K;  4Z2M G;  1ID3 B;  5B24 D;  4J8X B;  1P3A C;  1M18 D;  3TU4 C;  5B24 A;  1M18 A;  3X1T B;  5B32 C;  4QLC B;  5AV5 C;  3EPK A;  5AV9 D;  5CP6 D;  3AZN D;  4UUZ A;  5B2I A;  3AZN A;  5AV6 A;  1BH8 B;  5GSU B;  5B33 A;  2CV5 A;  3P5J B;  4Z66 D;  3A6N C;  3X1U A;  4Z66 A;  4KGC B;  4H9O A;  5B31 B;  3O62 D;  3AN2 C;  3KFU G;  1H3O B;  3O62 A;  1P3O B;  5DNN D;  2CWE A;  2G5I C;  5GXQ C;  2HIO C;  3C1C D;  3LJA C;  1P34 C;  1P3A B;  3C1C A;  5JRG A;  3MGS B;  3MGQ D;  3MGQ A;  1Q9C A;  2Y2M A;  4J8W D;  5BNV A;  4J8W A;  5AV5 B;  3AZL D;  2PYO C;  3AZL A;  4E44 A;  3B0B A;  4CAY B;  4LD9 D;  4LD9 A;  5B0Z D;  1P3G D;  1P3G A;  3AFA B;  3AN2 B;  1P3P D;  4J8U B;  5AVC C;  4M6B A;  5AV9 B;  5CP6 B;  3C1B D;  3AV1 C;  3C1B A;  2F2A C;  3AZM D;  1EQZ D;  4WU9 D;  3EG5 B;  3AZM A;  1EQZ A;  3REI B;  3MGP A;  5CPI A;  2F8N G;  1P3B A;  4ZBJ C;  1BH9 B;  2JSS A;  4XUJ A;  3NQJ B;  2PYO B;  5B1M D;  5GT3 B;  3MGR D;  4DRA A;  1KX4 A;  5B1M A;  2Y2P A;  3W96 D;  5DNN B;  3AV2 D; 
#chains in the Genus database with same CATH homology
 3KSY A;  5BT1 C;  4J8V D;  3B6G C;  3W98 D;  5AVB A;  4J8V A;  3W98 A;  5JA4 A;  3REL A;  5AVC B;  4NE5 A;  2FJ7 C;  1S32 D;  5B0Z B;  1AOI A;  1S32 A;  3R45 A;  2ARO C;  5B0Y C;  1P3P B;  3B0D C;  4CSR B;  4AWL B;  4X23 C;  4NE6 A;  5E5A B;  3UTB D;  1KX3 D;  1HTA A;  3UTB A;  1TAF B;  2XD1 A;  3A1K A;  3MGR B;  2G5H C;  5C3I C;  3LEL D;  3W96 B;  1KX5 D;  3LEL A;  5F99 D;  3UTA C;  1KX5 A;  3WA9 C;  2XD5 A;  1N1J A;  1U35 B;  3AL0 C;  5B1L C;  1B6W A;  4YM6 C;  2ARO B;  1PZR A;  1P3F D;  5B0Y B;  3B0D B;  1P3F A;  1M1A D;  4R8P C;  5AY8 D;  4J8X D;  1ID3 A;  2IO5 C;  1P3M C;  2YFW B;  3X1T A;  5BS7 C;  4QLC A;  5C3I B;  1TZY D;  3MNN D;  5CPJ C;  3UTA B;  3LZ0 D;  3X1S D;  3MVD C;  3KUY D;  1F66 C;  3WA9 B;  1BH8 A;  5GSU A;  4H9S C;  5B1L B;  4YM6 B;  1KX3 B;  1ULY A;  4KGC D;  5B31 D;  4KGC A;  3AZH C;  5B31 A;  2DQN C;  2W8S A;  5CPK C;  1P3O D;  5F99 B;  3WAA C;  1P3O A;  1P3A D;  1P3M B;  5CHL B;  3VH5 T;  3MGS A;  3W99 C;  5AV5 D;  2Y2O A;  2Y2N A;  3AZK B;  1P3L B;  5AV5 A;  1M1A B;  4WNN B;  5B40 C;  5CPJ B;  2NZD C;  4CAY A;  3MVD B;  1F66 B;  5AY8 B;  2FFF B;  4YS3 C;  3REH C;  3A6N D;  3REJ C;  3AFA D;  3AN2 D;  3AZH B;  3KWQ C;  3AFA A;  4J8U D;  3AZF C;  4JJN B;  3AN2 A;  1TZY B;  3MNN B;  4J8U A;  5AV9 A;  5CP6 A;  5CPK B;  3WAA B;  3LZ0 B;  2HIO D;  3X1S B;  3KUY B;  1P34 D;  3REI D;  4KUD C;  4G92 C;  3AZE C;  3REI A;  3AYW C;  1M19 C;  3B6F C;  1BH9 A;  2PYO D;  5GT3 D;  3NQJ A;  1T3U A;  2PYO A;  5B40 B;  5GT3 A;  3AZJ C;  5G49 B;  1A7W A;  2NZD B;  2HUE C;  5DNN A;  3REH B;  3LZ1 C;  3TU4 B;  5KDM B;  3AZI C;  1P3I C;  5B32 B;  4UPK A;  5AVC D;  3AV1 D;  5AVC A;  3NQU B;  3AZG C;  4KUD B;  3A1I A;  5B0Z A;  3A6N B;  2ZY2 A;  3AYW B;  4H9Q B;  1M19 B;  3B6F B;  5B2I C;  1P3P A;  5AV6 C;  3AZJ B;  4KHA B;  3VH6 T;  2CV5 C;  3V9R B;  5GXQ B;  4CSR A;  5B33 C;  2HIO B;  3LJA B;  5E5A D;  4WU9 A;  1P34 B;  5E5A A;  5BT1 D;  3X1U C;  4Z66 C;  3B6G D;  3O62 C;  5B2J C;  2FJ7 D;  1TAF A;  5B31 G;  3MGR A;  3AZG B;  3W96 A;  2RIQ A;  4H9N B;  2YFV B;  5JRG C;  1U35 D;  3MGQ C;  2ZM5 A;  3AV2 A;  1U35 A;  2ARO D;  2ARO A;  5B0Y D;  3AZL C;  4NFT A;  5B0Y A;  4ZUX C;  1WWI A;  3VH5 W;  3AV1 B;  3EPH A;  5DNM C;  3REK C;  4ZBJ B;  3KXB C;  1P3G C;  4WV4 B;  2YFW A;  5B2J B;  2BYK B;  5GT0 C;  3C1B C;  3UTA D;  1EQZ C;  3WA9 D;  5CPI C;  3WTP C;  3MGP C;  3UTA A;  1P3B C;  3WA9 A;  5B1L D;  4Z5T C;  4YM6 D;  3W97 C;  5B1L A;  4YM6 A;  1KX3 A;  4XUJ C;  3B6G B;  2BG1 A;  3EPJ A;  2NQB C;  1KX4 C;  2FJ7 B;  4ZUX B;  4H9R B;  5DNM B;  3REK B;  5F99 A;  1P3M D;  3X1V C;  3KXB B;  1P3M A;  5AVB C;  4J8V C;  2ZY3 A;  3REL C;  1P3L D;  3AZK D;  3B0C T;  5GT0 B;  1P3L A;  1R4V A;  3AZK A;  1F1E A;  5CPJ D;  1M1A A;  3MVD D;  5CPJ A;  5CPI B;  3WTP B;  4X23 B;  1F66 D;  3MVD A;  1AOI C;  5AY8 A;  4J8X A;  1HQ3 C;  2LY8 A;  4Z5T B;  3W97 B;  2J8P A;  4XUJ B;  2NQB B;  3AZH D;  4WJ3 C;  4JJN D;  3AZH A;  4JJN A;  5CPK D;  1TZY A;  3MNN A;  5CPK A;  3WAA D;  4Z2M H;  3WAA A;  3LZ0 A;  3X1S A;  3KUY A;  3X1V B;  5FUG B;  3W99 D;  5B40 D;  1H3O A;  2NZD D;  5B40 A;  2Y2G A;  5G49 A;  4R8P B;  1ZLA C;  4YS3 D;  3REH D;  2BYM B;  2IO5 B;  3TU4 D;  1JFI B;  1HQ3 B;  3REH A;  1P3A A;  3REJ D;  3TU4 A;  3H0M C;  2RVQ C;  5KDM A;  3H0R C;  5B32 D;  3KWQ D;  5B32 A;  3AZF D;  3NQU A;  1ID3 C;  4KUD D;  2Y2K A;  3AZE D;  4KUD A;  1P3K C;  3WTP E;  4WU8 C;  3A6N A;  3X1T C;  3AYW D;  1M19 D;  3B6F D;  3UT9 C;  4QLC C;  4H9Q A;  3AYW A;  1M19 A;  3AZJ D;  3F6T A;  3AZJ A;  4KHA A;  5GXQ D;  1ZLA B;  5GSU C;  3V9R A;  5GXQ A;  3LZ1 D;  3LJA D;  2HIO A;  4XZQ C;  5BNX B;  3LJA A;  1P34 A;  1P3I D;  5AV8 C;  4KGC C;  5BO0 B;  5B31 C;  3W99 B;  3WKJ C;  4H9P B;  4EO5 C;  3AZG D;  1P3O C;  1Z2C B;  3AZG A;  4H9N A;  4YS3 B;  2YFV A;  3MGS C;  1P3K B;  3REJ B;  4WU8 B;  2F8N H;  3UT9 B;  3KWQ B;  3AZF B;  5B2I D;  1KU5 A;  5AV6 D;  3AV1 A;  2F8N B;  2CV5 D;  5B33 D;  5B24 C;  3B0C W;  4XZQ B;  4G92 B;  2L5A A;  3AZE B;  1M18 C;  3X1U D;  5AV8 B;  4HGA C;  3AFA C;  5B2J D;  3WKJ B;  4J8U C;  5B2J A;  4EO5 B;  5CP6 C;  5AV9 C;  2BYK A;  3AZN C;  1WWS A;  2HUE B;  4G91 C;  2DF4 C;  5JRG D;  3LZ1 B;  3REI C;  4WZS B;  3AZI B;  2Y2J A;  1W2E A;  1P3I B;  3B6G A;  4ZUX D;  5GT3 C;  2FJ7 A;  4ZUX A;  2Y2H A;  5DNM D;  2VQR A;  4H9R A;  5DNM A;  5DNN C;  3REK D;  3REK A;  5B24 B;  3C1C C;  1M18 B;  3KXB D;  3KXB A;  4J8W C;  4HGA B;  3FDD A;  4UUZ B;  5B2I B;  5GT0 D;  5B32 G;  5AV6 B;  3AZN B;  5GT0 A;  2CV5 B;  5B33 B;  2JCH A;  3WTP D;  4G91 B;  4X23 D;  3MGP D;  5CPI D;  1P3B D;  4LD9 C;  3WTP A;  4X23 A;  5B0Z C;  4Z5T D;  3X1U B;  3W97 D;  4Z66 B;  4Z5T A;  4H9O B;  3W97 A;  4XUJ D;  2NQB D;  3O62 B;  3VH5 A;  1KX4 D;  1P3P C;  2NQB A;  3AZM C;  4AWL C;  4WU9 C;  3C1C B;  5JRG B;  5E5A C;  3X1V D;  3MGQ B;  3X1V A;  5AVB D;  5BNV B;  4J8W B;  4DQY B;  3REL D;  5FUG A;  2Y2L A;  3AZL B;  5B1M C;  3MGR C;  2UWX A;  3W96 C;  2Y2Q A;  4R8P D;  4LD9 B;  4R8P A;  1AOI D;  3AV2 C;  1HQ3 D;  1JFI A;  2BYM A;  2ZY4 A;  1U35 C;  1HQ3 A;  1P3G B;  3W98 C;  5BS7 A;  3C1B B;  4WNN A;  3AZM B;  1EQZ B;  3H0L C;  4WU9 B;  3MGP B;  1P3B B;  1S32 C;  1F66 A;  4H9S A;  1KX4 B;  5B1M B;  1ZLA D;  4E45 A;  1ZLA A;  3AV2 B;  3UTB C;  5BNX A;  1KX3 C;  2RVQ D;  3VH6 W;  5AVB B;  4J8V B;  3W98 B;  2JE5 A;  5JA4 B;  3REL B;  2ZY5 A;  5BO0 A;  4DRB A;  3W99 A;  4H9P A;  3LEL C;  1KX5 C;  1ID3 D;  2NZD A;  5F99 C;  1AOI B;  1S32 B;  3VH6 A;  4YS3 A;  3R45 B;  1P3K D;  4WU8 D;  1P3K A;  3X1T D;  3REJ A;  4WU8 A;  1BFM A;  3UT9 D;  4QLC D;  1P3F C;  1P3L C;  3UT9 A;  3AZK C;  3IP4 C;  1M1A C;  3KWQ A;  3AZF A;  2F8N D;  4NE3 A;  2F8N A;  5GSU D;  5AY8 C;  4J8X C;  4XZQ D;  3UTB B;  4XZQ A;  3AZE A;  5AV8 D;  5AV8 A;  3WKJ D;  1B67 A;  3B6F A;  3WKJ A;  4JJN C;  1TZY C;  3MNN C;  3LEL B;  2Y2I A;  1KX5 B;  3LZ0 C;  3KUY C;  1N1J B;  3X1S C;  3MGS D;  3LZ1 A;  3AZI D;  3AZI A;  1P3I A;  3EPL A;  1P3F B;  2F8N K;  4Z2M G;  1ID3 B;  5B24 D;  4J8X B;  1P3A C;  1M18 D;  3TU4 C;  5B24 A;  1M18 A;  3X1T B;  5B32 C;  4QLC B;  5AV5 C;  3EPK A;  5AV9 D;  5CP6 D;  3AZN D;  4UUZ A;  5B2I A;  3AZN A;  5AV6 A;  1BH8 B;  5GSU B;  5B33 A;  2CV5 A;  3P5J B;  4Z66 D;  3A6N C;  3X1U A;  4Z66 A;  4KGC B;  4H9O A;  5B31 B;  3O62 D;  3AN2 C;  3KFU G;  1H3O B;  3O62 A;  1P3O B;  5DNN D;  2CWE A;  2G5I C;  5GXQ C;  2HIO C;  3C1C D;  3LJA C;  1P34 C;  1P3A B;  3C1C A;  5JRG A;  3MGS B;  3MGQ D;  3MGQ A;  1Q9C A;  2Y2M A;  4J8W D;  5BNV A;  4J8W A;  5AV5 B;  3AZL D;  2PYO C;  3AZL A;  4E44 A;  3B0B A;  4CAY B;  4LD9 D;  4LD9 A;  5B0Z D;  1P3G D;  1P3G A;  3AFA B;  3AN2 B;  1P3P D;  4J8U B;  5AVC C;  4M6B A;  5AV9 B;  5CP6 B;  3C1B D;  3AV1 C;  3C1B A;  2F2A C;  3AZM D;  1EQZ D;  4WU9 D;  3EG5 B;  3AZM A;  1EQZ A;  3REI B;  3MGP A;  5CPI A;  2F8N G;  1P3B A;  4ZBJ C;  1BH9 B;  2JSS A;  4XUJ A;  3NQJ B;  2PYO B;  5B1M D;  5GT3 B;  3MGR D;  4DRA A;  1KX4 A;  5B1M A;  2Y2P A;  3W96 D;  5DNN B;  3AV2 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...