5B1MB

The mouse nucleosome structure containing h3.1
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
78
structure length
78
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Testis-Specific Histone Variant H3t Gene Is Essential for Entry into Spermatogenesis
pubmed doi rcsb
source organism Mus musculus
molecule tags Structural protein/dna
total genus 26
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b1mB00
4H9OB 3AZJA 5JA4B 3AFAC 3KWQD 1P3AB 5GSUC 4XUJC 3TU4D 2HIOB 1P3AA 3KXBC 4KUDB 2HIOA 3REKB 1P3GD 3REKA 3LZ1C 3LJAD 3AN2B 1M1AB 4R8PB 3AZFC 5AVCD 5B32B 3AYWB 3AYWA 2AROD 1P3OD 5JRGB 3MNND 4XZQB 5B2JA 3X1SD 3UTAA 3AV2C 5JRGA 3O62A 4NFTA 3AZIB 3AZJC 3W98B 4H9NB 3AZIA 3W98A 4KGCA 1P3AC 2HIOC 4ZBJB 3VH5A 4KUDC 5AV6B 3REKC 1ID3B 5AV6A 3KUYD 1H3OB 5CPKA 2FJ7B 1M1AC 3AN2C 1H3OA 4KHAA 4R8PC 3X1UD 1AOIB 1P3PD 5B32C 3AYWC 1AOIA 3LZ0D 5JRGC 4XZQC 3X1TB 5B24B 3A6ND 5KDMB 3MGQA 3AZIC 3W98C 5B24A 2BYKA 5KDMA 4M6BA 1EQZB 3AZED 4J8VD 4ZBJC 3WAAD 4WNNB 4EO5B 5AV6C 1ID3C 3W96D 3UT9B 3X1VB 2FJ7C 5BT1C 1KX4A 2HUEB 2YFVB 1M18B 2YFVA 1M18A 1AOIC 5AV5D 3REHA 5BO0A 4H9SC 4WU9B 4WU9A 1B6WA 5B24C 3X1TC 3AZNB 3B6GA 3AZNA 5GXQB 5E5AD 5B31G 3WTPB 4Z2MH 1TZYB 5GXQA 1EQZC 5CPID 4EO5C 3LELB 1S32D 3WKJA 5B2IB 3LELA 3UT9C 3X1VC 3REJA 2HUEC 1M18C 1P3KD 3W97B 4J8UB 3LZ1D 3W97A 4J8UA 5AVBB 5B1LD 5BS7C 5B40B 3AZLD 3AZNC 3B6FB 5GXQC 1P3ID 3B6FA 4YM6B 3WTPC 3AZJD 5B0YB 1TZYC 2L5AA 3AZHB 5B0YA 2F8NG 3LELC 1P3AD 5B2IC 1F66B 1F66A 3W97C 4J8UC 2RVQD 1M19B 3AZGB 5BNXB 1HQ3A 1M19A 4NE5A 2NQBB 3AV2B 5AVBC 1U35A 5B40C 3AYWD 4Z2MG 5B31A 5B2JD 3UTAD 3B6FC 3O62D 4X23B 4YM6C 5B0YC 3AZID 3W98D 4X23A 3AZHC 4KGCD 3W99B 4JJNA 1TAFA 1P3MB 3W99A 4WU8A 4H9QB 1F66C 5B32G 5AV6D 5CPKD 3AFAA 1M19C 2NZDB 5DNMB 3AZGC 4XUJA 5GSUA 2NQBC 5AV9D 1AOID 3KXBA 5B1MB 5B1MA 4Z66B 3MGQD 4J8WB 1KX5D 5B24D 4X23C 2F8NA 4CSRB 4J8WA 3WA9B 3WA9A 3W99C 1JFIA 3R45A 5B0ZB 3MGPB 1P3MC 3MGRD 3AZMD 5C3IB 4NE3A 3AV2A 1KX4D 4H9OA 3C1CB 5JA4A 2NZDC 5DNMC 1M18D 3REHD 1P3BB 5F99B 4KUDA 5B1MC 4WU9D 4Z66C 3V9RB 1M1AA 4J8WC 3AN2A 3B6GD 5GT3B 3AZND 3WA9C 4R8PA 5B32A 5GXQD 4LD9B 3RELB 5B0ZC 3MGPC 3UTBB 5DNNB 4LD9A 3UTBA 5AV8B 4XZQA 5C3IC 5DNNA 3C1BB 3WKJD 3LELD 3C1BA 3REJD 4H9NA 3C1CC 1BFMA 3W97D 4J8UD 1P3LD 1P3BC 5F99C 5CPJB 1ID3A 2FJ7A 3VH5T 3NQJB 5GT3C 3NQJA 1Q9CA 3NQUB 4LD9C 3RELC 4H9SA 3UTBC 5B0YD 5DNNC 5AV8C 3C1BC 3X1TA 5GT0B 4CAYB 5G49B 5G49A 5CHLB 1EQZA 1P34D 4WNNA 1HQ3D 5CPJC 1U35D 2CV5B 3UT9A 4YS3B 3X1VA 5B31D 4WZSB 1P3FD 2F8NH 3B0CT 2PYOB 3KSYA 2PYOA 4X23D 4JJND 4ZUXB 4J8XB 3W99D 5BS7A 4WU8D 5GT0C 3VH5W 3WTPA 1TZYA 3AFAD 3MGSB 4H9RB 4XUJD 5GSUD 4H9RA 3KWQB 5B2IA 3KXBD 2CV5C 4YS3C 3TU4B 4G91B 2PYOC 3TU4A 5B1MD 2F8ND 5CP6B 3AZFD 3WA9D 5CP6A 4ZUXC 5AVBA 4J8XC 5B40A 3AV2D 2AROB 3B0CW 1P3OB 4YM6A 3MNNB 2AROA 3X1SB 3MGSC 3AZHA 2HIOD 4NE6A 3KWQC 4KUDD 4UUZB 3REKD 3TU4C 4G91C 4UUZA 4DRBA 1M1AD 3AN2D 1P3GC 4R8PD 3KUYB 5CP6C 3AZGA 3LJAC 5FUGB 5BNXA 2NQBA 5B32D 1WWIA 4LD9D 3X1UB 4G92B 3UTBD 5JRGD 5DNND 4XZQD 1P3PB 3X1UA 2AROC 1P3OC 3LZ0B 3MNNC 1KX3B 3X1SC 2IO5B 3A6NB 2BYMB 1KX3A 2BYMA 1P3MA 4H9QA 3AZEB 1KU5A 1ID3D 3WAAB 2FJ7D 5BT1D 1B67A 2NZDA 5DNMA 3KUYC 3X1UC 4G92C 4Z5TB 4DRAA 5AY8B 3X1TD 3MVDB 1P3PC 3B0BA 4Z66A 4Z5TA 5AY8A 3MVDA 3LZ0C 4CSRA 1KX3C 2IO5C 3A6NC 1EQZD 4QLCB 5B0ZA 3MGPA 4QLCA 1BH9B 3AZEC 3UT9D 3WAAC 3X1VD 5CPIB 1S32B 3C1CA 2LY8A 5CPIA 1S32A 2PYOD 5BNVB 1P3BA 1P3KB 5F99A 4WV4B 4Z5TC 5AY8C 3MVDC 3V9RA 3REIB 1ZLAB 5GT3A 2JSSA 5B1LB 3AZLB 3REIA 1ZLAA 3WTPD 1TZYD 3RELA 4QLCC 1P3IB 5AV8A 4E44A 1P3IA 5B2ID 5CPIC 1S32C 1F1EA 1P3KC 1WWSA 5CP6D 5CPJA 5AVBD 4E45A 1A7WA 5B40D 2CWEA 3REIC 1ZLAC 3B6FD 5B1LC 3AZLC 4YM6D 1R4VA 3NQUA 5B2JB 3UTAB 3AZHD 3O62B 1P3IC 3AV1B 3AV1A 4KGCB 5GT0A 1F66D 4CAYA 5B33B 5B33A 3WTPE 1M19D 3AZGD 5CPKB 2NQBD 2RVQC 2CV5A 4KHAB 1ULYA 4YS3A 5AV9B 5AV9A 3AZKB 5B2JC 3AZKA 3UTAC 1HTAA 3O62C 3MGQB 1KX3D 1KX5B 2BYKB 4ZUXA 3AV1C 1P3MD 4J8XA 1KX5A 4KGCC 4HGAB 5B33C 1N1JB 3MGRB 3AZMB 1N1JA 3MGRA 3AZMA 3MGSA 2NZDD 3VH6A 5DNMD 5CPKC 1KX4B 3KWQA 3REHB 5AV9C 3VH6T 5BO0B 4Z66D 1P3GB 4Z5TD 5AY8D 3MVDD 4J8WD 3AZKC 3LJAB 1P3GA 3LJAA 3MGQC 1KX5C 1BH8B 3B6GB 5B0ZD 3MGPD 5AVCB 1BH8A 4QLCD 5AVCA 4HGAC 3MGRC 1P3OA 3AZMC 2YFWB 3C1CD 3MNNA 3WKJB 3X1SA 2YFWA 3REJB 1KX4C 3B0DB 1P3BD 5F99D 3REHC 1P3LB 1P3LA 5GT3D 4WU9C 3REID 3KUYA 1ZLAD 5FUGA 3B6GC 3RELD 5AVCC 5AV8D 1P3PA 3C1BD 3VH6W 3LZ0A 3WKJC 3A6NA 3REJC 3B0DC 4J8VB 5CPJD 3AZEA 4J8VA 1P34B 1P3LC 3WAAA 1HQ3B 1P34A 3W96B 1U35B 3W96A 5B31B 2F8NK 1P3FB 4AWLB 1P3FA 5AV5B 5AV5A 3AV1D 5GT0D 4JJNB 1TAFB 4WU8B 5B33D 5E5AB 5E5AA 4J8VC 1BH9A 3AFAB 2CV5D 1P34C 4YS3D 5GSUB 4XUJB 1HQ3C 3W96C 3KXBB 1U35C 5B31C 5BNVA 1P3FC 4AWLC 3AZKD 3LZ1B 1P3KA 5AV5C 4ZUXD 2F8NB 3LZ1A 4J8XD 4H9PB 3AZFB 4JJNC 4H9PA 3R45B 1JFIB 3AZFA 5B1LA 3AZLA 4WU8C 5E5AC 3MGSD 3AZJB
chains in the Genus database with same CATH superfamily
4H9OB 3AZJA 5JA4B 3AFAC 3KWQD 1P3AB 5GSUC 4XUJC 3TU4D 2HIOB 1P3AA 2F2AC 3KXBC 4KUDB 2HIOA 3REKB 1P3GD 3REKA 3LZ1C 3LJAD 3AN2B 1M1AB 4R8PB 3AZFC 5AVCD 5B32B 3AYWB 3KFUG 3AL0C 3AYWA 2AROD 1P3OD 5JRGB 3MNND 4XZQB 5B2JA 3X1SD 3UTAA 3AV2C 5JRGA 3O62A 4NFTA 3AZIB 3AZJC 3W98B 4H9NB 3AZIA 3W98A 4KGCA 1P3AC 1W2EA 2HIOC 4ZBJB 3VH5A 4KUDC 5AV6B 3REKC 1ID3B 5AV6A 3KUYD 1H3OB 5CPKA 2FJ7B 1M1AC 3EPJA 3AN2C 1H3OA 4KHAA 4R8PC 3X1UD 1AOIB 1P3PD 5B32C 3AYWC 1AOIA 3LZ0D 5JRGC 4XZQC 3X1TB 5B24B 2Y2PA 3A6ND 5KDMB 3MGQA 2DQNC 3AZIC 3W98C 5B24A 2BYKA 5KDMA 4M6BA 1EQZB 3A1KA 3AZED 4J8VD 4ZBJC 3WAAD 4WNNB 4EO5B 5AV6C 1ID3C 3W96D 3UT9B 3X1VB 2FJ7C 5BT1C 1KX4A 2HUEB 2YFVB 1M18B 2YFVA 1M18A 1AOIC 5AV5D 3REHA 5BO0A 4H9SC 2XD5A 4WU9B 4WU9A 1B6WA 5B24C 3X1TC 3AZNB 3B6GA 3AZNA 5GXQB 5E5AD 5B31G 2Y2OA 3WTPB 4Z2MH 1TZYB 5GXQA 1EQZC 5CPID 4EO5C 3LELB 1S32D 3WKJA 5B2IB 3LELA 3UT9C 3X1VC 3REJA 2Y2JA 2HUEC 1M18C 1P3KD 3W97B 4J8UB 3LZ1D 3W97A 4J8UA 5AVBB 5B1LD 5BS7C 5B40B 3AZLD 2W8SA 3AZNC 3B6FB 5GXQC 1P3ID 3B6FA 4YM6B 3WTPC 3AZJD 5B0YB 1TZYC 2L5AA 3AZHB 5B0YA 1T3UA 2RIQA 2F8NG 3LELC 1P3AD 5B2IC 1F66B 1F66A 3W97C 4J8UC 2RVQD 1M19B 3AZGB 5BNXB 1HQ3A 1M19A 4NE5A 2NQBB 3AV2B 5AVBC 1U35A 5B40C 3AYWD 2Y2GA 4Z2MG 5B31A 5B2JD 3UTAD 3B6FC 3O62D 4X23B 4YM6C 5B0YC 3AZID 3W98D 4X23A 3AZHC 4KGCD 3W99B 2J8PA 4JJNA 1TAFA 1P3MB 3W99A 4WU8A 4H9QB 1F66C 5B32G 4WJ3C 5AV6D 5CPKD 2Y2IA 2ZY3A 3AFAA 1M19C 2NZDB 5DNMB 3AZGC 4XUJA 5GSUA 2NQBC 5AV9D 1AOID 2JE5A 3KXBA 5B1MB 5B1MA 4Z66B 3MGQD 4J8WB 1KX5D 5B24D 4X23C 2F8NA 4CSRB 4J8WA 3WA9B 3WA9A 3W99C 1Z2CB 1JFIA 3R45A 5B0ZB 3MGPB 1P3MC 3MGRD 3AZMD 5C3IB 4NE3A 3AV2A 2XD1A 1KX4D 4H9OA 3C1CB 5JA4A 3H0RC 5DNMC 1M18D 2Y2QA 2NZDC 3REHD 1P3BB 5F99B 4KUDA 5B1MC 4WU9D 4Z66C 3V9RB 1M1AA 4J8WC 3AN2A 3B6GD 5GT3B 3AZND 3WA9C 4R8PA 5B32A 5GXQD 4LD9B 3RELB 5B0ZC 3MGPC 3UTBB 5DNNB 4LD9A 3UTBA 5AV8B 3FDDA 4XZQA 5C3IC 5DNNA 3C1BB 3WKJD 3LELD 3C1BA 3REJD 4H9NA 3C1CC 1BFMA 3W97D 4J8UD 1P3LD 1P3BC 5F99C 2UWXA 5CPJB 1ID3A 2FJ7A 3VH5T 3NQJB 5GT3C 4UPKA 3NQJA 1Q9CA 3NQUB 4LD9C 3RELC 4H9SA 3UTBC 5B0YD 5DNNC 5AV8C 3C1BC 3X1TA 5GT0B 4CAYB 2BG1A 5G49B 5G49A 3F6TA 5CHLB 2Y2HA 1EQZA 3A1IA 1P34D 3EPLA 4WNNA 1HQ3D 5CPJC 1U35D 2CV5B 2ZY5A 3UT9A 4YS3B 3X1VA 5B31D 4WZSB 2Y2MA 1P3FD 2F8NH 3B0CT 2PYOB 3KSYA 2PYOA 4X23D 4JJND 4ZUXB 4J8XB 3W99D 5BS7A 4WU8D 5GT0C 3VH5W 2G5IC 3WTPA 1TZYA 3AFAD 3MGSB 4H9RB 4XUJD 5GSUD 4H9RA 3KWQB 5B2IA 3KXBD 2CV5C 3EPKA 4YS3C 3TU4B 4G91B 2PYOC 3TU4A 5B1MD 2F8ND 5CP6B 3AZFD 3WA9D 2VQRA 5CP6A 4ZUXC 5AVBA 4J8XC 5B40A 3AV2D 2AROB 3B0CW 1P3OB 4YM6A 3MNNB 2AROA 3X1SB 3MGSC 3AZHA 2HIOD 4NE6A 3KWQC 4KUDD 3EG5B 4UUZB 3REKD 3TU4C 4G91C 4UUZA 4DRBA 1M1AD 3AN2D 1P3GC 2Y2LA 4R8PD 3KUYB 5CP6C 3AZGA 3LJAC 5FUGB 5BNXA 2NQBA 5B32D 1WWIA 4LD9D 3X1UB 4G92B 3UTBD 5JRGD 5DNND 4XZQD 1P3PB 3X1UA 2AROC 1P3OC 3LZ0B 3MNNC 1KX3B 3X1SC 2IO5B 3A6NB 2BYMB 1KX3A 4DQYB 2BYMA 1P3MA 4H9QA 3AZEB 1KU5A 1ID3D 3WAAB 2FJ7D 5BT1D 1B67A 2NZDA 5DNMA 3KUYC 3X1UC 4G92C 4Z5TB 4DRAA 5AY8B 3X1TD 3MVDB 1P3PC 3B0BA 4Z66A 2DF4C 4Z5TA 5AY8A 3MVDA 3LZ0C 4CSRA 1KX3C 3H0MC 2IO5C 3A6NC 1EQZD 4QLCB 5B0ZA 3MGPA 4QLCA 1BH9B 3AZEC 2Y2NA 3WAAC 3UT9D 3X1VD 5CPIB 1S32B 3C1CA 2LY8A 5CPIA 1S32A 3EPHA 2PYOD 5BNVB 1P3BA 1P3KB 5F99A 4WV4B 4Z5TC 5AY8C 3MVDC 3V9RA 3REIB 1ZLAB 5GT3A 2JSSA 5B1LB 3AZLB 3REIA 1ZLAA 3WTPD 1TZYD 3RELA 4QLCC 1P3IB 5AV8A 2JCHA 4E44A 5B2ID 1P3IA 5CPIC 1S32C 2ZY2A 1F1EA 1P3KC 1WWSA 5CP6D 5CPJA 5AVBD 4E45A 1A7WA 5B40D 2CWEA 3REIC 1ZLAC 3B6FD 2Y2KA 5B1LC 3AZLC 4YM6D 1R4VA 3NQUA 5B2JB 3UTAB 3AZHD 3O62B 1P3IC 3AV1B 3AV1A 4KGCB 5GT0A 1F66D 4CAYA 5B33B 5B33A 3WTPE 1M19D 3AZGD 5CPKB 2NQBD 2RVQC 2CV5A 4KHAB 1ULYA 4YS3A 5AV9B 5AV9A 3AZKB 5B2JC 3AZKA 3UTAC 1HTAA 3O62C 3MGQB 1KX3D 1KX5B 2BYKB 4ZUXA 3AV1C 1P3MD 4J8XA 1KX5A 4KGCC 4HGAB 5B33C 1N1JB 3MGRB 3AZMB 3IP4C 1N1JA 3MGRA 3AZMA 3MGSA 2NZDD 3VH6A 5DNMD 5CPKC 1KX4B 3KWQA 3REHB 5AV9C 3VH6T 5BO0B 4Z66D 1P3GB 4Z5TD 5AY8D 3MVDD 4J8WD 3AZKC 3LJAB 1P3GA 2FFFB 3LJAA 3MGQC 1KX5C 1BH8B 3B6GB 5B0ZD 3MGPD 5AVCB 1BH8A 4QLCD 5AVCA 4HGAC 3MGRC 1P3OA 3AZMC 2YFWB 3C1CD 3MNNA 3WKJB 3X1SA 2YFWA 3REJB 1KX4C 3B0DB 1P3BD 5F99D 3REHC 1P3LB 1P3LA 5GT3D 4WU9C 3REID 3KUYA 1ZLAD 5FUGA 3B6GC 3RELD 5AVCC 5AV8D 1P3PA 3C1BD 3VH6W 3LZ0A 3WKJC 3A6NA 3REJC 3B0DC 2ZY4A 4J8VB 5CPJD 3AZEA 4J8VA 1P34B 1P3LC 3WAAA 1HQ3B 1P34A 3W96B 1U35B 3W96A 5B31B 2F8NK 1P3FB 4AWLB 1P3FA 5AV5B 5AV5A 3AV1D 5GT0D 4JJNB 1TAFB 2G5HC 4WU8B 5B33D 5E5AB 5E5AA 4J8VC 1BH9A 3AFAB 2CV5D 1P34C 4YS3D 5GSUB 4XUJB 1HQ3C 2ZM5A 3W96C 1PZRA 3KXBB 1U35C 5B31C 5BNVA 1P3FC 4AWLC 3AZKD 3LZ1B 1P3KA 5AV5C 4ZUXD 2F8NB 3LZ1A 3P5JB 4J8XD 4H9PB 3AZFB 4JJNC 3H0LC 3R45B 4H9PA 3AZFA 1JFIB 5B1LA 3AZLA 4WU8C 5E5AC 3MGSD 3AZJB
chains in the Genus database with same CATH topology
4H9OB 3AZJA 5JA4B 3AFAC 3KWQD 1P3AB 5GSUC 4XUJC 3TU4D 2HIOB 1P3AA 2F2AC 3KXBC 4KUDB 2HIOA 3REKB 1P3GD 3REKA 3LZ1C 3LJAD 3AN2B 1M1AB 4R8PB 3AZFC 5AVCD 5B32B 3AYWB 3KFUG 3AL0C 3AYWA 2AROD 1P3OD 5JRGB 3MNND 4XZQB 5B2JA 3X1SD 3UTAA 3AV2C 5JRGA 3O62A 4NFTA 3AZIB 3AZJC 3W98B 4H9NB 3AZIA 3W98A 4KGCA 1P3AC 1W2EA 2HIOC 4ZBJB 3VH5A 4KUDC 5AV6B 3REKC 1ID3B 5AV6A 3KUYD 1H3OB 5CPKA 2FJ7B 1M1AC 3EPJA 3AN2C 1H3OA 4KHAA 4R8PC 3X1UD 1AOIB 1P3PD 5B32C 3AYWC 1AOIA 3LZ0D 5JRGC 4XZQC 3X1TB 5B24B 2Y2PA 3A6ND 5KDMB 3MGQA 2DQNC 3AZIC 3W98C 5B24A 2BYKA 5KDMA 4M6BA 1EQZB 3A1KA 3AZED 4J8VD 4ZBJC 3WAAD 4WNNB 4EO5B 5AV6C 1ID3C 3W96D 3UT9B 3X1VB 2FJ7C 5BT1C 1KX4A 2HUEB 2YFVB 1M18B 2YFVA 1M18A 1AOIC 5AV5D 3REHA 5BO0A 4H9SC 2XD5A 4WU9B 4WU9A 1B6WA 5B24C 3X1TC 3AZNB 3B6GA 3AZNA 5GXQB 5E5AD 5B31G 2Y2OA 3WTPB 4Z2MH 1TZYB 5GXQA 1EQZC 5CPID 4EO5C 3LELB 1S32D 3WKJA 5B2IB 3LELA 3UT9C 3X1VC 3REJA 2Y2JA 2HUEC 1M18C 1P3KD 3W97B 4J8UB 3LZ1D 3W97A 4J8UA 5AVBB 5B1LD 5BS7C 5B40B 3AZLD 2W8SA 3AZNC 3B6FB 5GXQC 1P3ID 3B6FA 4YM6B 3WTPC 3AZJD 5B0YB 1TZYC 2L5AA 3AZHB 5B0YA 1T3UA 2RIQA 2F8NG 3LELC 1P3AD 5B2IC 1F66B 1F66A 3W97C 4J8UC 2RVQD 1M19B 3AZGB 5BNXB 1HQ3A 1M19A 4NE5A 2NQBB 3AV2B 5AVBC 1U35A 5B40C 3AYWD 2Y2GA 4Z2MG 5B31A 5B2JD 3UTAD 3B6FC 3O62D 4X23B 4YM6C 5B0YC 3AZID 3W98D 4X23A 3AZHC 4KGCD 3W99B 2J8PA 4JJNA 1TAFA 1P3MB 3W99A 4WU8A 4H9QB 1F66C 5B32G 4WJ3C 5AV6D 5CPKD 2Y2IA 2ZY3A 3AFAA 1M19C 2NZDB 5DNMB 3AZGC 4XUJA 5GSUA 2NQBC 5AV9D 1AOID 2JE5A 3KXBA 5B1MB 5B1MA 4Z66B 3MGQD 4J8WB 1KX5D 5B24D 4X23C 2F8NA 4CSRB 4J8WA 3WA9B 3WA9A 3W99C 1Z2CB 1JFIA 3R45A 5B0ZB 3MGPB 1P3MC 3MGRD 3AZMD 5C3IB 4NE3A 3AV2A 2XD1A 1KX4D 4H9OA 3C1CB 5JA4A 3H0RC 5DNMC 1M18D 2Y2QA 2NZDC 3REHD 1P3BB 5F99B 4KUDA 5B1MC 4WU9D 4Z66C 3V9RB 1M1AA 4J8WC 3AN2A 3B6GD 5GT3B 3AZND 3WA9C 4R8PA 5B32A 5GXQD 4LD9B 3RELB 5B0ZC 3MGPC 3UTBB 5DNNB 4LD9A 3UTBA 5AV8B 3FDDA 4XZQA 5C3IC 5DNNA 3C1BB 3WKJD 3LELD 3C1BA 3REJD 4H9NA 3C1CC 1BFMA 3W97D 4J8UD 1P3LD 1P3BC 5F99C 2UWXA 5CPJB 1ID3A 2FJ7A 3VH5T 3NQJB 5GT3C 4UPKA 3NQJA 1Q9CA 3NQUB 4LD9C 3RELC 4H9SA 3UTBC 5B0YD 5DNNC 5AV8C 3C1BC 3X1TA 5GT0B 4CAYB 2BG1A 5G49B 5G49A 3F6TA 5CHLB 2Y2HA 1EQZA 3A1IA 1P34D 3EPLA 4WNNA 1HQ3D 5CPJC 1U35D 2CV5B 2ZY5A 3UT9A 4YS3B 3X1VA 5B31D 4WZSB 2Y2MA 1P3FD 2F8NH 3B0CT 2PYOB 3KSYA 2PYOA 4X23D 4JJND 4ZUXB 4J8XB 3W99D 5BS7A 4WU8D 5GT0C 3VH5W 2G5IC 3WTPA 1TZYA 3AFAD 3MGSB 4H9RB 4XUJD 5GSUD 4H9RA 3KWQB 5B2IA 3KXBD 2CV5C 3EPKA 4YS3C 3TU4B 4G91B 2PYOC 3TU4A 5B1MD 2F8ND 5CP6B 3AZFD 3WA9D 2VQRA 5CP6A 4ZUXC 5AVBA 4J8XC 5B40A 3AV2D 2AROB 3B0CW 1P3OB 4YM6A 3MNNB 2AROA 3X1SB 3MGSC 3AZHA 2HIOD 4NE6A 3KWQC 4KUDD 3EG5B 4UUZB 3REKD 3TU4C 4G91C 4UUZA 4DRBA 1M1AD 3AN2D 1P3GC 2Y2LA 4R8PD 3KUYB 5CP6C 3AZGA 3LJAC 5FUGB 5BNXA 2NQBA 5B32D 1WWIA 4LD9D 3X1UB 4G92B 3UTBD 5JRGD 5DNND 4XZQD 1P3PB 3X1UA 2AROC 1P3OC 3LZ0B 3MNNC 1KX3B 3X1SC 2IO5B 3A6NB 2BYMB 1KX3A 4DQYB 2BYMA 1P3MA 4H9QA 3AZEB 1KU5A 1ID3D 3WAAB 2FJ7D 5BT1D 1B67A 2NZDA 5DNMA 3KUYC 3X1UC 4G92C 4Z5TB 4DRAA 5AY8B 3X1TD 3MVDB 1P3PC 3B0BA 4Z66A 2DF4C 4Z5TA 5AY8A 3MVDA 3LZ0C 4CSRA 1KX3C 3H0MC 2IO5C 3A6NC 1EQZD 4QLCB 5B0ZA 3MGPA 4QLCA 1BH9B 3AZEC 2Y2NA 3WAAC 3UT9D 3X1VD 5CPIB 1S32B 3C1CA 2LY8A 5CPIA 1S32A 3EPHA 2PYOD 5BNVB 1P3BA 1P3KB 5F99A 4WV4B 4Z5TC 5AY8C 3MVDC 3V9RA 3REIB 1ZLAB 5GT3A 2JSSA 5B1LB 3AZLB 3REIA 1ZLAA 3WTPD 1TZYD 3RELA 4QLCC 1P3IB 5AV8A 2JCHA 4E44A 5B2ID 1P3IA 5CPIC 1S32C 2ZY2A 1F1EA 1P3KC 1WWSA 5CP6D 5CPJA 5AVBD 4E45A 1A7WA 5B40D 2CWEA 3REIC 1ZLAC 3B6FD 2Y2KA 5B1LC 3AZLC 4YM6D 1R4VA 3NQUA 5B2JB 3UTAB 3AZHD 3O62B 1P3IC 3AV1B 3AV1A 4KGCB 5GT0A 1F66D 4CAYA 5B33B 5B33A 3WTPE 1M19D 3AZGD 5CPKB 2NQBD 2RVQC 2CV5A 4KHAB 1ULYA 4YS3A 5AV9B 5AV9A 3AZKB 5B2JC 3AZKA 3UTAC 1HTAA 3O62C 3MGQB 1KX3D 1KX5B 2BYKB 4ZUXA 3AV1C 1P3MD 4J8XA 1KX5A 4KGCC 4HGAB 5B33C 1N1JB 3MGRB 3AZMB 3IP4C 1N1JA 3MGRA 3AZMA 3MGSA 2NZDD 3VH6A 5DNMD 5CPKC 1KX4B 3KWQA 3REHB 5AV9C 3VH6T 5BO0B 4Z66D 1P3GB 4Z5TD 5AY8D 3MVDD 4J8WD 3AZKC 3LJAB 1P3GA 2FFFB 3LJAA 3MGQC 1KX5C 1BH8B 3B6GB 5B0ZD 3MGPD 5AVCB 1BH8A 4QLCD 5AVCA 4HGAC 3MGRC 1P3OA 3AZMC 2YFWB 3C1CD 3MNNA 3WKJB 3X1SA 2YFWA 3REJB 1KX4C 3B0DB 1P3BD 5F99D 3REHC 1P3LB 1P3LA 5GT3D 4WU9C 3REID 3KUYA 1ZLAD 5FUGA 3B6GC 3RELD 5AVCC 5AV8D 1P3PA 3C1BD 3VH6W 3LZ0A 3WKJC 3A6NA 3REJC 3B0DC 2ZY4A 4J8VB 5CPJD 3AZEA 4J8VA 1P34B 1P3LC 3WAAA 1HQ3B 1P34A 3W96B 1U35B 3W96A 5B31B 2F8NK 1P3FB 4AWLB 1P3FA 5AV5B 5AV5A 3AV1D 5GT0D 4JJNB 1TAFB 2G5HC 4WU8B 5B33D 5E5AB 5E5AA 4J8VC 1BH9A 3AFAB 2CV5D 1P34C 4YS3D 5GSUB 4XUJB 1HQ3C 2ZM5A 3W96C 1PZRA 3KXBB 1U35C 5B31C 5BNVA 1P3FC 4AWLC 3AZKD 3LZ1B 1P3KA 5AV5C 4ZUXD 2F8NB 3LZ1A 3P5JB 4J8XD 4H9PB 3AZFB 4JJNC 3H0LC 3R45B 4H9PA 3AZFA 1JFIB 5B1LA 3AZLA 4WU8C 5E5AC 3MGSD 3AZJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H9O B;  3AZJ A;  5JA4 B;  3AFA C;  3KWQ D;  1P3A B;  5GSU C;  4XUJ C;  3TU4 D;  2HIO B;  1P3A A;  3KXB C;  4KUD B;  2HIO A;  3REK B;  1P3G D;  3REK A;  3LZ1 C;  3LJA D;  3AN2 B;  1M1A B;  4R8P B;  3AZF C;  5AVC D;  5B32 B;  3AYW B;  3AYW A;  2ARO D;  1P3O D;  5JRG B;  3MNN D;  4XZQ B;  5B2J A;  3X1S D;  3UTA A;  3AV2 C;  5JRG A;  3O62 A;  4NFT A;  3AZI B;  3AZJ C;  3W98 B;  4H9N B;  3AZI A;  3W98 A;  4KGC A;  1P3A C;  2HIO C;  4ZBJ B;  3VH5 A;  4KUD C;  5AV6 B;  3REK C;  1ID3 B;  5AV6 A;  3KUY D;  1H3O B;  5CPK A;  2FJ7 B;  1M1A C;  3AN2 C;  1H3O A;  4KHA A;  4R8P C;  3X1U D;  1AOI B;  1P3P D;  5B32 C;  3AYW C;  1AOI A;  3LZ0 D;  5JRG C;  4XZQ C;  3X1T B;  5B24 B;  3A6N D;  5KDM B;  3MGQ A;  3AZI C;  3W98 C;  5B24 A;  2BYK A;  5KDM A;  4M6B A;  1EQZ B;  3AZE D;  4J8V D;  4ZBJ C;  3WAA D;  4WNN B;  4EO5 B;  5AV6 C;  1ID3 C;  3W96 D;  3UT9 B;  3X1V B;  2FJ7 C;  5BT1 C;  1KX4 A;  2HUE B;  2YFV B;  1M18 B;  2YFV A;  1M18 A;  1AOI C;  5AV5 D;  3REH A;  5BO0 A;  4H9S C;  4WU9 B;  4WU9 A;  1B6W A;  5B24 C;  3X1T C;  3AZN B;  3B6G A;  3AZN A;  5GXQ B;  5E5A D;  5B31 G;  3WTP B;  4Z2M H;  1TZY B;  5GXQ A;  1EQZ C;  5CPI D;  4EO5 C;  3LEL B;  1S32 D;  3WKJ A;  5B2I B;  3LEL A;  3UT9 C;  3X1V C;  3REJ A;  2HUE C;  1M18 C;  1P3K D;  3W97 B;  4J8U B;  3LZ1 D;  3W97 A;  4J8U A;  5AVB B;  5B1L D;  5BS7 C;  5B40 B;  3AZL D;  3AZN C;  3B6F B;  5GXQ C;  1P3I D;  3B6F A;  4YM6 B;  3WTP C;  3AZJ D;  5B0Y B;  1TZY C;  2L5A A;  3AZH B;  5B0Y A;  2F8N G;  3LEL C;  1P3A D;  5B2I C;  1F66 B;  1F66 A;  3W97 C;  4J8U C;  2RVQ D;  1M19 B;  3AZG B;  5BNX B;  1HQ3 A;  1M19 A;  4NE5 A;  2NQB B;  3AV2 B;  5AVB C;  1U35 A;  5B40 C;  3AYW D;  4Z2M G;  5B31 A;  5B2J D;  3UTA D;  3B6F C;  3O62 D;  4X23 B;  4YM6 C;  5B0Y C;  3AZI D;  3W98 D;  4X23 A;  3AZH C;  4KGC D;  3W99 B;  4JJN A;  1TAF A;  1P3M B;  3W99 A;  4WU8 A;  4H9Q B;  1F66 C;  5B32 G;  5AV6 D;  5CPK D;  3AFA A;  1M19 C;  2NZD B;  5DNM B;  3AZG C;  4XUJ A;  5GSU A;  2NQB C;  5AV9 D;  1AOI D;  3KXB A;  5B1M B;  5B1M A;  4Z66 B;  3MGQ D;  4J8W B;  1KX5 D;  5B24 D;  4X23 C;  2F8N A;  4CSR B;  4J8W A;  3WA9 B;  3WA9 A;  3W99 C;  1JFI A;  3R45 A;  5B0Z B;  3MGP B;  1P3M C;  3MGR D;  3AZM D;  5C3I B;  4NE3 A;  3AV2 A;  1KX4 D;  4H9O A;  3C1C B;  5JA4 A;  2NZD C;  5DNM C;  1M18 D;  3REH D;  1P3B B;  5F99 B;  4KUD A;  5B1M C;  4WU9 D;  4Z66 C;  3V9R B;  1M1A A;  4J8W C;  3AN2 A;  3B6G D;  5GT3 B;  3AZN D;  3WA9 C;  4R8P A;  5B32 A;  5GXQ D;  4LD9 B;  3REL B;  5B0Z C;  3MGP C;  3UTB B;  5DNN B;  4LD9 A;  3UTB A;  5AV8 B;  4XZQ A;  5C3I C;  5DNN A;  3C1B B;  3WKJ D;  3LEL D;  3C1B A;  3REJ D;  4H9N A;  3C1C C;  1BFM A;  3W97 D;  4J8U D;  1P3L D;  1P3B C;  5F99 C;  5CPJ B;  1ID3 A;  2FJ7 A;  3VH5 T;  3NQJ B;  5GT3 C;  3NQJ A;  1Q9C A;  3NQU B;  4LD9 C;  3REL C;  4H9S A;  3UTB C;  5B0Y D;  5DNN C;  5AV8 C;  3C1B C;  3X1T A;  5GT0 B;  4CAY B;  5G49 B;  5G49 A;  5CHL B;  1EQZ A;  1P34 D;  4WNN A;  1HQ3 D;  5CPJ C;  1U35 D;  2CV5 B;  3UT9 A;  4YS3 B;  3X1V A;  5B31 D;  4WZS B;  1P3F D;  2F8N H;  3B0C T;  2PYO B;  3KSY A;  2PYO A;  4X23 D;  4JJN D;  4ZUX B;  4J8X B;  3W99 D;  5BS7 A;  4WU8 D;  5GT0 C;  3VH5 W;  3WTP A;  1TZY A;  3AFA D;  3MGS B;  4H9R B;  4XUJ D;  5GSU D;  4H9R A;  3KWQ B;  5B2I A;  3KXB D;  2CV5 C;  4YS3 C;  3TU4 B;  4G91 B;  2PYO C;  3TU4 A;  5B1M D;  2F8N D;  5CP6 B;  3AZF D;  3WA9 D;  5CP6 A;  4ZUX C;  5AVB A;  4J8X C;  5B40 A;  3AV2 D;  2ARO B;  3B0C W;  1P3O B;  4YM6 A;  3MNN B;  2ARO A;  3X1S B;  3MGS C;  3AZH A;  2HIO D;  4NE6 A;  3KWQ C;  4KUD D;  4UUZ B;  3REK D;  3TU4 C;  4G91 C;  4UUZ A;  4DRB A;  1M1A D;  3AN2 D;  1P3G C;  4R8P D;  3KUY B;  5CP6 C;  3AZG A;  3LJA C;  5FUG B;  5BNX A;  2NQB A;  5B32 D;  1WWI A;  4LD9 D;  3X1U B;  4G92 B;  3UTB D;  5JRG D;  5DNN D;  4XZQ D;  1P3P B;  3X1U A;  2ARO C;  1P3O C;  3LZ0 B;  3MNN C;  1KX3 B;  3X1S C;  2IO5 B;  3A6N B;  2BYM B;  1KX3 A;  2BYM A;  1P3M A;  4H9Q A;  3AZE B;  1KU5 A;  1ID3 D;  3WAA B;  2FJ7 D;  5BT1 D;  1B67 A;  2NZD A;  5DNM A;  3KUY C;  3X1U C;  4G92 C;  4Z5T B;  4DRA A;  5AY8 B;  3X1T D;  3MVD B;  1P3P C;  3B0B A;  4Z66 A;  4Z5T A;  5AY8 A;  3MVD A;  3LZ0 C;  4CSR A;  1KX3 C;  2IO5 C;  3A6N C;  1EQZ D;  4QLC B;  5B0Z A;  3MGP A;  4QLC A;  1BH9 B;  3AZE C;  3UT9 D;  3WAA C;  3X1V D;  5CPI B;  1S32 B;  3C1C A;  2LY8 A;  5CPI A;  1S32 A;  2PYO D;  5BNV B;  1P3B A;  1P3K B;  5F99 A;  4WV4 B;  4Z5T C;  5AY8 C;  3MVD C;  3V9R A;  3REI B;  1ZLA B;  5GT3 A;  2JSS A;  5B1L B;  3AZL B;  3REI A;  1ZLA A;  3WTP D;  1TZY D;  3REL A;  4QLC C;  1P3I B;  5AV8 A;  4E44 A;  1P3I A;  5B2I D;  5CPI C;  1S32 C;  1F1E A;  1P3K C;  1WWS A;  5CP6 D;  5CPJ A;  5AVB D;  4E45 A;  1A7W A;  5B40 D;  2CWE A;  3REI C;  1ZLA C;  3B6F D;  5B1L C;  3AZL C;  4YM6 D;  1R4V A;  3NQU A;  5B2J B;  3UTA B;  3AZH D;  3O62 B;  1P3I C;  3AV1 B;  3AV1 A;  4KGC B;  5GT0 A;  1F66 D;  4CAY A;  5B33 B;  5B33 A;  3WTP E;  1M19 D;  3AZG D;  5CPK B;  2NQB D;  2RVQ C;  2CV5 A;  4KHA B;  1ULY A;  4YS3 A;  5AV9 B;  5AV9 A;  3AZK B;  5B2J C;  3AZK A;  3UTA C;  1HTA A;  3O62 C;  3MGQ B;  1KX3 D;  1KX5 B;  2BYK B;  4ZUX A;  3AV1 C;  1P3M D;  4J8X A;  1KX5 A;  4KGC C;  4HGA B;  5B33 C;  1N1J B;  3MGR B;  3AZM B;  1N1J A;  3MGR A;  3AZM A;  3MGS A;  2NZD D;  3VH6 A;  5DNM D;  5CPK C;  1KX4 B;  3KWQ A;  3REH B;  5AV9 C;  3VH6 T;  5BO0 B;  4Z66 D;  1P3G B;  4Z5T D;  5AY8 D;  3MVD D;  4J8W D;  3AZK C;  3LJA B;  1P3G A;  3LJA A;  3MGQ C;  1KX5 C;  1BH8 B;  3B6G B;  5B0Z D;  3MGP D;  5AVC B;  1BH8 A;  4QLC D;  5AVC A;  4HGA C;  3MGR C;  1P3O A;  3AZM C;  2YFW B;  3C1C D;  3MNN A;  3WKJ B;  3X1S A;  2YFW A;  3REJ B;  1KX4 C;  3B0D B;  1P3B D;  5F99 D;  3REH C;  1P3L B;  1P3L A;  5GT3 D;  4WU9 C;  3REI D;  3KUY A;  1ZLA D;  5FUG A;  3B6G C;  3REL D;  5AVC C;  5AV8 D;  1P3P A;  3C1B D;  3VH6 W;  3LZ0 A;  3WKJ C;  3A6N A;  3REJ C;  3B0D C;  4J8V B;  5CPJ D;  3AZE A;  4J8V A;  1P34 B;  1P3L C;  3WAA A;  1HQ3 B;  1P34 A;  3W96 B;  1U35 B;  3W96 A;  5B31 B;  2F8N K;  1P3F B;  4AWL B;  1P3F A;  5AV5 B;  5AV5 A;  3AV1 D;  5GT0 D;  4JJN B;  1TAF B;  4WU8 B;  5B33 D;  5E5A B;  5E5A A;  4J8V C;  1BH9 A;  3AFA B;  2CV5 D;  1P34 C;  4YS3 D;  5GSU B;  4XUJ B;  1HQ3 C;  3W96 C;  3KXB B;  1U35 C;  5B31 C;  5BNV A;  1P3F C;  4AWL C;  3AZK D;  3LZ1 B;  1P3K A;  5AV5 C;  4ZUX D;  2F8N B;  3LZ1 A;  4J8X D;  4H9P B;  3AZF B;  4JJN C;  4H9P A;  3R45 B;  1JFI B;  3AZF A;  5B1L A;  3AZL A;  4WU8 C;  5E5A C;  3MGS D;  3AZJ B; 
#chains in the Genus database with same CATH topology
 4H9O B;  3AZJ A;  5JA4 B;  3AFA C;  3KWQ D;  1P3A B;  5GSU C;  4XUJ C;  3TU4 D;  2HIO B;  1P3A A;  2F2A C;  3KXB C;  4KUD B;  2HIO A;  3REK B;  1P3G D;  3REK A;  3LZ1 C;  3LJA D;  3AN2 B;  1M1A B;  4R8P B;  3AZF C;  5AVC D;  5B32 B;  3AYW B;  3KFU G;  3AL0 C;  3AYW A;  2ARO D;  1P3O D;  5JRG B;  3MNN D;  4XZQ B;  5B2J A;  3X1S D;  3UTA A;  3AV2 C;  5JRG A;  3O62 A;  4NFT A;  3AZI B;  3AZJ C;  3W98 B;  4H9N B;  3AZI A;  3W98 A;  4KGC A;  1P3A C;  1W2E A;  2HIO C;  4ZBJ B;  3VH5 A;  4KUD C;  5AV6 B;  3REK C;  1ID3 B;  5AV6 A;  3KUY D;  1H3O B;  5CPK A;  2FJ7 B;  1M1A C;  3EPJ A;  3AN2 C;  1H3O A;  4KHA A;  4R8P C;  3X1U D;  1AOI B;  1P3P D;  5B32 C;  3AYW C;  1AOI A;  3LZ0 D;  5JRG C;  4XZQ C;  3X1T B;  5B24 B;  2Y2P A;  3A6N D;  5KDM B;  3MGQ A;  2DQN C;  3AZI C;  3W98 C;  5B24 A;  2BYK A;  5KDM A;  4M6B A;  1EQZ B;  3A1K A;  3AZE D;  4J8V D;  4ZBJ C;  3WAA D;  4WNN B;  4EO5 B;  5AV6 C;  1ID3 C;  3W96 D;  3UT9 B;  3X1V B;  2FJ7 C;  5BT1 C;  1KX4 A;  2HUE B;  2YFV B;  1M18 B;  2YFV A;  1M18 A;  1AOI C;  5AV5 D;  3REH A;  5BO0 A;  4H9S C;  2XD5 A;  4WU9 B;  4WU9 A;  1B6W A;  5B24 C;  3X1T C;  3AZN B;  3B6G A;  3AZN A;  5GXQ B;  5E5A D;  5B31 G;  2Y2O A;  3WTP B;  4Z2M H;  1TZY B;  5GXQ A;  1EQZ C;  5CPI D;  4EO5 C;  3LEL B;  1S32 D;  3WKJ A;  5B2I B;  3LEL A;  3UT9 C;  3X1V C;  3REJ A;  2Y2J A;  2HUE C;  1M18 C;  1P3K D;  3W97 B;  4J8U B;  3LZ1 D;  3W97 A;  4J8U A;  5AVB B;  5B1L D;  5BS7 C;  5B40 B;  3AZL D;  2W8S A;  3AZN C;  3B6F B;  5GXQ C;  1P3I D;  3B6F A;  4YM6 B;  3WTP C;  3AZJ D;  5B0Y B;  1TZY C;  2L5A A;  3AZH B;  5B0Y A;  1T3U A;  2RIQ A;  2F8N G;  3LEL C;  1P3A D;  5B2I C;  1F66 B;  1F66 A;  3W97 C;  4J8U C;  2RVQ D;  1M19 B;  3AZG B;  5BNX B;  1HQ3 A;  1M19 A;  4NE5 A;  2NQB B;  3AV2 B;  5AVB C;  1U35 A;  5B40 C;  3AYW D;  2Y2G A;  4Z2M G;  5B31 A;  5B2J D;  3UTA D;  3B6F C;  3O62 D;  4X23 B;  4YM6 C;  5B0Y C;  3AZI D;  3W98 D;  4X23 A;  3AZH C;  4KGC D;  3W99 B;  2J8P A;  4JJN A;  1TAF A;  1P3M B;  3W99 A;  4WU8 A;  4H9Q B;  1F66 C;  5B32 G;  4WJ3 C;  5AV6 D;  5CPK D;  2Y2I A;  2ZY3 A;  3AFA A;  1M19 C;  2NZD B;  5DNM B;  3AZG C;  4XUJ A;  5GSU A;  2NQB C;  5AV9 D;  1AOI D;  2JE5 A;  3KXB A;  5B1M B;  5B1M A;  4Z66 B;  3MGQ D;  4J8W B;  1KX5 D;  5B24 D;  4X23 C;  2F8N A;  4CSR B;  4J8W A;  3WA9 B;  3WA9 A;  3W99 C;  1Z2C B;  1JFI A;  3R45 A;  5B0Z B;  3MGP B;  1P3M C;  3MGR D;  3AZM D;  5C3I B;  4NE3 A;  3AV2 A;  2XD1 A;  1KX4 D;  4H9O A;  3C1C B;  5JA4 A;  3H0R C;  5DNM C;  1M18 D;  2Y2Q A;  2NZD C;  3REH D;  1P3B B;  5F99 B;  4KUD A;  5B1M C;  4WU9 D;  4Z66 C;  3V9R B;  1M1A A;  4J8W C;  3AN2 A;  3B6G D;  5GT3 B;  3AZN D;  3WA9 C;  4R8P A;  5B32 A;  5GXQ D;  4LD9 B;  3REL B;  5B0Z C;  3MGP C;  3UTB B;  5DNN B;  4LD9 A;  3UTB A;  5AV8 B;  3FDD A;  4XZQ A;  5C3I C;  5DNN A;  3C1B B;  3WKJ D;  3LEL D;  3C1B A;  3REJ D;  4H9N A;  3C1C C;  1BFM A;  3W97 D;  4J8U D;  1P3L D;  1P3B C;  5F99 C;  2UWX A;  5CPJ B;  1ID3 A;  2FJ7 A;  3VH5 T;  3NQJ B;  5GT3 C;  4UPK A;  3NQJ A;  1Q9C A;  3NQU B;  4LD9 C;  3REL C;  4H9S A;  3UTB C;  5B0Y D;  5DNN C;  5AV8 C;  3C1B C;  3X1T A;  5GT0 B;  4CAY B;  2BG1 A;  5G49 B;  5G49 A;  3F6T A;  5CHL B;  2Y2H A;  1EQZ A;  3A1I A;  1P34 D;  3EPL A;  4WNN A;  1HQ3 D;  5CPJ C;  1U35 D;  2CV5 B;  2ZY5 A;  3UT9 A;  4YS3 B;  3X1V A;  5B31 D;  4WZS B;  2Y2M A;  1P3F D;  2F8N H;  3B0C T;  2PYO B;  3KSY A;  2PYO A;  4X23 D;  4JJN D;  4ZUX B;  4J8X B;  3W99 D;  5BS7 A;  4WU8 D;  5GT0 C;  3VH5 W;  2G5I C;  3WTP A;  1TZY A;  3AFA D;  3MGS B;  4H9R B;  4XUJ D;  5GSU D;  4H9R A;  3KWQ B;  5B2I A;  3KXB D;  2CV5 C;  3EPK A;  4YS3 C;  3TU4 B;  4G91 B;  2PYO C;  3TU4 A;  5B1M D;  2F8N D;  5CP6 B;  3AZF D;  3WA9 D;  2VQR A;  5CP6 A;  4ZUX C;  5AVB A;  4J8X C;  5B40 A;  3AV2 D;  2ARO B;  3B0C W;  1P3O B;  4YM6 A;  3MNN B;  2ARO A;  3X1S B;  3MGS C;  3AZH A;  2HIO D;  4NE6 A;  3KWQ C;  4KUD D;  3EG5 B;  4UUZ B;  3REK D;  3TU4 C;  4G91 C;  4UUZ A;  4DRB A;  1M1A D;  3AN2 D;  1P3G C;  2Y2L A;  4R8P D;  3KUY B;  5CP6 C;  3AZG A;  3LJA C;  5FUG B;  5BNX A;  2NQB A;  5B32 D;  1WWI A;  4LD9 D;  3X1U B;  4G92 B;  3UTB D;  5JRG D;  5DNN D;  4XZQ D;  1P3P B;  3X1U A;  2ARO C;  1P3O C;  3LZ0 B;  3MNN C;  1KX3 B;  3X1S C;  2IO5 B;  3A6N B;  2BYM B;  1KX3 A;  4DQY B;  2BYM A;  1P3M A;  4H9Q A;  3AZE B;  1KU5 A;  1ID3 D;  3WAA B;  2FJ7 D;  5BT1 D;  1B67 A;  2NZD A;  5DNM A;  3KUY C;  3X1U C;  4G92 C;  4Z5T B;  4DRA A;  5AY8 B;  3X1T D;  3MVD B;  1P3P C;  3B0B A;  4Z66 A;  2DF4 C;  4Z5T A;  5AY8 A;  3MVD A;  3LZ0 C;  4CSR A;  1KX3 C;  3H0M C;  2IO5 C;  3A6N C;  1EQZ D;  4QLC B;  5B0Z A;  3MGP A;  4QLC A;  1BH9 B;  3AZE C;  2Y2N A;  3WAA C;  3UT9 D;  3X1V D;  5CPI B;  1S32 B;  3C1C A;  2LY8 A;  5CPI A;  1S32 A;  3EPH A;  2PYO D;  5BNV B;  1P3B A;  1P3K B;  5F99 A;  4WV4 B;  4Z5T C;  5AY8 C;  3MVD C;  3V9R A;  3REI B;  1ZLA B;  5GT3 A;  2JSS A;  5B1L B;  3AZL B;  3REI A;  1ZLA A;  3WTP D;  1TZY D;  3REL A;  4QLC C;  1P3I B;  5AV8 A;  2JCH A;  4E44 A;  5B2I D;  1P3I A;  5CPI C;  1S32 C;  2ZY2 A;  1F1E A;  1P3K C;  1WWS A;  5CP6 D;  5CPJ A;  5AVB D;  4E45 A;  1A7W A;  5B40 D;  2CWE A;  3REI C;  1ZLA C;  3B6F D;  2Y2K A;  5B1L C;  3AZL C;  4YM6 D;  1R4V A;  3NQU A;  5B2J B;  3UTA B;  3AZH D;  3O62 B;  1P3I C;  3AV1 B;  3AV1 A;  4KGC B;  5GT0 A;  1F66 D;  4CAY A;  5B33 B;  5B33 A;  3WTP E;  1M19 D;  3AZG D;  5CPK B;  2NQB D;  2RVQ C;  2CV5 A;  4KHA B;  1ULY A;  4YS3 A;  5AV9 B;  5AV9 A;  3AZK B;  5B2J C;  3AZK A;  3UTA C;  1HTA A;  3O62 C;  3MGQ B;  1KX3 D;  1KX5 B;  2BYK B;  4ZUX A;  3AV1 C;  1P3M D;  4J8X A;  1KX5 A;  4KGC C;  4HGA B;  5B33 C;  1N1J B;  3MGR B;  3AZM B;  3IP4 C;  1N1J A;  3MGR A;  3AZM A;  3MGS A;  2NZD D;  3VH6 A;  5DNM D;  5CPK C;  1KX4 B;  3KWQ A;  3REH B;  5AV9 C;  3VH6 T;  5BO0 B;  4Z66 D;  1P3G B;  4Z5T D;  5AY8 D;  3MVD D;  4J8W D;  3AZK C;  3LJA B;  1P3G A;  2FFF B;  3LJA A;  3MGQ C;  1KX5 C;  1BH8 B;  3B6G B;  5B0Z D;  3MGP D;  5AVC B;  1BH8 A;  4QLC D;  5AVC A;  4HGA C;  3MGR C;  1P3O A;  3AZM C;  2YFW B;  3C1C D;  3MNN A;  3WKJ B;  3X1S A;  2YFW A;  3REJ B;  1KX4 C;  3B0D B;  1P3B D;  5F99 D;  3REH C;  1P3L B;  1P3L A;  5GT3 D;  4WU9 C;  3REI D;  3KUY A;  1ZLA D;  5FUG A;  3B6G C;  3REL D;  5AVC C;  5AV8 D;  1P3P A;  3C1B D;  3VH6 W;  3LZ0 A;  3WKJ C;  3A6N A;  3REJ C;  3B0D C;  2ZY4 A;  4J8V B;  5CPJ D;  3AZE A;  4J8V A;  1P34 B;  1P3L C;  3WAA A;  1HQ3 B;  1P34 A;  3W96 B;  1U35 B;  3W96 A;  5B31 B;  2F8N K;  1P3F B;  4AWL B;  1P3F A;  5AV5 B;  5AV5 A;  3AV1 D;  5GT0 D;  4JJN B;  1TAF B;  2G5H C;  4WU8 B;  5B33 D;  5E5A B;  5E5A A;  4J8V C;  1BH9 A;  3AFA B;  2CV5 D;  1P34 C;  4YS3 D;  5GSU B;  4XUJ B;  1HQ3 C;  2ZM5 A;  3W96 C;  1PZR A;  3KXB B;  1U35 C;  5B31 C;  5BNV A;  1P3F C;  4AWL C;  3AZK D;  3LZ1 B;  1P3K A;  5AV5 C;  4ZUX D;  2F8N B;  3LZ1 A;  3P5J B;  4J8X D;  4H9P B;  3AZF B;  4JJN C;  3H0L C;  3R45 B;  4H9P A;  3AZF A;  1JFI B;  5B1L A;  3AZL A;  4WU8 C;  5E5A C;  3MGS D;  3AZJ B; 
#chains in the Genus database with same CATH homology
 4H9O B;  3AZJ A;  5JA4 B;  3AFA C;  3KWQ D;  1P3A B;  5GSU C;  4XUJ C;  3TU4 D;  2HIO B;  1P3A A;  2F2A C;  3KXB C;  4KUD B;  2HIO A;  3REK B;  1P3G D;  3REK A;  3LZ1 C;  3LJA D;  3AN2 B;  1M1A B;  4R8P B;  3AZF C;  5AVC D;  5B32 B;  3AYW B;  3KFU G;  3AL0 C;  3AYW A;  2ARO D;  1P3O D;  5JRG B;  3MNN D;  4XZQ B;  5B2J A;  3X1S D;  3UTA A;  3AV2 C;  5JRG A;  3O62 A;  4NFT A;  3AZI B;  3AZJ C;  3W98 B;  4H9N B;  3AZI A;  3W98 A;  4KGC A;  1P3A C;  1W2E A;  2HIO C;  4ZBJ B;  3VH5 A;  4KUD C;  5AV6 B;  3REK C;  1ID3 B;  5AV6 A;  3KUY D;  1H3O B;  5CPK A;  2FJ7 B;  1M1A C;  3EPJ A;  3AN2 C;  1H3O A;  4KHA A;  4R8P C;  3X1U D;  1AOI B;  1P3P D;  5B32 C;  3AYW C;  1AOI A;  3LZ0 D;  5JRG C;  4XZQ C;  3X1T B;  5B24 B;  2Y2P A;  3A6N D;  5KDM B;  3MGQ A;  2DQN C;  3AZI C;  3W98 C;  5B24 A;  2BYK A;  5KDM A;  4M6B A;  1EQZ B;  3A1K A;  3AZE D;  4J8V D;  4ZBJ C;  3WAA D;  4WNN B;  4EO5 B;  5AV6 C;  1ID3 C;  3W96 D;  3UT9 B;  3X1V B;  2FJ7 C;  5BT1 C;  1KX4 A;  2HUE B;  2YFV B;  1M18 B;  2YFV A;  1M18 A;  1AOI C;  5AV5 D;  3REH A;  5BO0 A;  4H9S C;  2XD5 A;  4WU9 B;  4WU9 A;  1B6W A;  5B24 C;  3X1T C;  3AZN B;  3B6G A;  3AZN A;  5GXQ B;  5E5A D;  5B31 G;  2Y2O A;  3WTP B;  4Z2M H;  1TZY B;  5GXQ A;  1EQZ C;  5CPI D;  4EO5 C;  3LEL B;  1S32 D;  3WKJ A;  5B2I B;  3LEL A;  3UT9 C;  3X1V C;  3REJ A;  2Y2J A;  2HUE C;  1M18 C;  1P3K D;  3W97 B;  4J8U B;  3LZ1 D;  3W97 A;  4J8U A;  5AVB B;  5B1L D;  5BS7 C;  5B40 B;  3AZL D;  2W8S A;  3AZN C;  3B6F B;  5GXQ C;  1P3I D;  3B6F A;  4YM6 B;  3WTP C;  3AZJ D;  5B0Y B;  1TZY C;  2L5A A;  3AZH B;  5B0Y A;  1T3U A;  2RIQ A;  2F8N G;  3LEL C;  1P3A D;  5B2I C;  1F66 B;  1F66 A;  3W97 C;  4J8U C;  2RVQ D;  1M19 B;  3AZG B;  5BNX B;  1HQ3 A;  1M19 A;  4NE5 A;  2NQB B;  3AV2 B;  5AVB C;  1U35 A;  5B40 C;  3AYW D;  2Y2G A;  4Z2M G;  5B31 A;  5B2J D;  3UTA D;  3B6F C;  3O62 D;  4X23 B;  4YM6 C;  5B0Y C;  3AZI D;  3W98 D;  4X23 A;  3AZH C;  4KGC D;  3W99 B;  2J8P A;  4JJN A;  1TAF A;  1P3M B;  3W99 A;  4WU8 A;  4H9Q B;  1F66 C;  5B32 G;  4WJ3 C;  5AV6 D;  5CPK D;  2Y2I A;  2ZY3 A;  3AFA A;  1M19 C;  2NZD B;  5DNM B;  3AZG C;  4XUJ A;  5GSU A;  2NQB C;  5AV9 D;  1AOI D;  2JE5 A;  3KXB A;  5B1M B;  5B1M A;  4Z66 B;  3MGQ D;  4J8W B;  1KX5 D;  5B24 D;  4X23 C;  2F8N A;  4CSR B;  4J8W A;  3WA9 B;  3WA9 A;  3W99 C;  1Z2C B;  1JFI A;  3R45 A;  5B0Z B;  3MGP B;  1P3M C;  3MGR D;  3AZM D;  5C3I B;  4NE3 A;  3AV2 A;  2XD1 A;  1KX4 D;  4H9O A;  3C1C B;  5JA4 A;  3H0R C;  5DNM C;  1M18 D;  2Y2Q A;  2NZD C;  3REH D;  1P3B B;  5F99 B;  4KUD A;  5B1M C;  4WU9 D;  4Z66 C;  3V9R B;  1M1A A;  4J8W C;  3AN2 A;  3B6G D;  5GT3 B;  3AZN D;  3WA9 C;  4R8P A;  5B32 A;  5GXQ D;  4LD9 B;  3REL B;  5B0Z C;  3MGP C;  3UTB B;  5DNN B;  4LD9 A;  3UTB A;  5AV8 B;  3FDD A;  4XZQ A;  5C3I C;  5DNN A;  3C1B B;  3WKJ D;  3LEL D;  3C1B A;  3REJ D;  4H9N A;  3C1C C;  1BFM A;  3W97 D;  4J8U D;  1P3L D;  1P3B C;  5F99 C;  2UWX A;  5CPJ B;  1ID3 A;  2FJ7 A;  3VH5 T;  3NQJ B;  5GT3 C;  4UPK A;  3NQJ A;  1Q9C A;  3NQU B;  4LD9 C;  3REL C;  4H9S A;  3UTB C;  5B0Y D;  5DNN C;  5AV8 C;  3C1B C;  3X1T A;  5GT0 B;  4CAY B;  2BG1 A;  5G49 B;  5G49 A;  3F6T A;  5CHL B;  2Y2H A;  1EQZ A;  3A1I A;  1P34 D;  3EPL A;  4WNN A;  1HQ3 D;  5CPJ C;  1U35 D;  2CV5 B;  2ZY5 A;  3UT9 A;  4YS3 B;  3X1V A;  5B31 D;  4WZS B;  2Y2M A;  1P3F D;  2F8N H;  3B0C T;  2PYO B;  3KSY A;  2PYO A;  4X23 D;  4JJN D;  4ZUX B;  4J8X B;  3W99 D;  5BS7 A;  4WU8 D;  5GT0 C;  3VH5 W;  2G5I C;  3WTP A;  1TZY A;  3AFA D;  3MGS B;  4H9R B;  4XUJ D;  5GSU D;  4H9R A;  3KWQ B;  5B2I A;  3KXB D;  2CV5 C;  3EPK A;  4YS3 C;  3TU4 B;  4G91 B;  2PYO C;  3TU4 A;  5B1M D;  2F8N D;  5CP6 B;  3AZF D;  3WA9 D;  2VQR A;  5CP6 A;  4ZUX C;  5AVB A;  4J8X C;  5B40 A;  3AV2 D;  2ARO B;  3B0C W;  1P3O B;  4YM6 A;  3MNN B;  2ARO A;  3X1S B;  3MGS C;  3AZH A;  2HIO D;  4NE6 A;  3KWQ C;  4KUD D;  3EG5 B;  4UUZ B;  3REK D;  3TU4 C;  4G91 C;  4UUZ A;  4DRB A;  1M1A D;  3AN2 D;  1P3G C;  2Y2L A;  4R8P D;  3KUY B;  5CP6 C;  3AZG A;  3LJA C;  5FUG B;  5BNX A;  2NQB A;  5B32 D;  1WWI A;  4LD9 D;  3X1U B;  4G92 B;  3UTB D;  5JRG D;  5DNN D;  4XZQ D;  1P3P B;  3X1U A;  2ARO C;  1P3O C;  3LZ0 B;  3MNN C;  1KX3 B;  3X1S C;  2IO5 B;  3A6N B;  2BYM B;  1KX3 A;  4DQY B;  2BYM A;  1P3M A;  4H9Q A;  3AZE B;  1KU5 A;  1ID3 D;  3WAA B;  2FJ7 D;  5BT1 D;  1B67 A;  2NZD A;  5DNM A;  3KUY C;  3X1U C;  4G92 C;  4Z5T B;  4DRA A;  5AY8 B;  3X1T D;  3MVD B;  1P3P C;  3B0B A;  4Z66 A;  2DF4 C;  4Z5T A;  5AY8 A;  3MVD A;  3LZ0 C;  4CSR A;  1KX3 C;  3H0M C;  2IO5 C;  3A6N C;  1EQZ D;  4QLC B;  5B0Z A;  3MGP A;  4QLC A;  1BH9 B;  3AZE C;  2Y2N A;  3WAA C;  3UT9 D;  3X1V D;  5CPI B;  1S32 B;  3C1C A;  2LY8 A;  5CPI A;  1S32 A;  3EPH A;  2PYO D;  5BNV B;  1P3B A;  1P3K B;  5F99 A;  4WV4 B;  4Z5T C;  5AY8 C;  3MVD C;  3V9R A;  3REI B;  1ZLA B;  5GT3 A;  2JSS A;  5B1L B;  3AZL B;  3REI A;  1ZLA A;  3WTP D;  1TZY D;  3REL A;  4QLC C;  1P3I B;  5AV8 A;  2JCH A;  4E44 A;  5B2I D;  1P3I A;  5CPI C;  1S32 C;  2ZY2 A;  1F1E A;  1P3K C;  1WWS A;  5CP6 D;  5CPJ A;  5AVB D;  4E45 A;  1A7W A;  5B40 D;  2CWE A;  3REI C;  1ZLA C;  3B6F D;  2Y2K A;  5B1L C;  3AZL C;  4YM6 D;  1R4V A;  3NQU A;  5B2J B;  3UTA B;  3AZH D;  3O62 B;  1P3I C;  3AV1 B;  3AV1 A;  4KGC B;  5GT0 A;  1F66 D;  4CAY A;  5B33 B;  5B33 A;  3WTP E;  1M19 D;  3AZG D;  5CPK B;  2NQB D;  2RVQ C;  2CV5 A;  4KHA B;  1ULY A;  4YS3 A;  5AV9 B;  5AV9 A;  3AZK B;  5B2J C;  3AZK A;  3UTA C;  1HTA A;  3O62 C;  3MGQ B;  1KX3 D;  1KX5 B;  2BYK B;  4ZUX A;  3AV1 C;  1P3M D;  4J8X A;  1KX5 A;  4KGC C;  4HGA B;  5B33 C;  1N1J B;  3MGR B;  3AZM B;  3IP4 C;  1N1J A;  3MGR A;  3AZM A;  3MGS A;  2NZD D;  3VH6 A;  5DNM D;  5CPK C;  1KX4 B;  3KWQ A;  3REH B;  5AV9 C;  3VH6 T;  5BO0 B;  4Z66 D;  1P3G B;  4Z5T D;  5AY8 D;  3MVD D;  4J8W D;  3AZK C;  3LJA B;  1P3G A;  2FFF B;  3LJA A;  3MGQ C;  1KX5 C;  1BH8 B;  3B6G B;  5B0Z D;  3MGP D;  5AVC B;  1BH8 A;  4QLC D;  5AVC A;  4HGA C;  3MGR C;  1P3O A;  3AZM C;  2YFW B;  3C1C D;  3MNN A;  3WKJ B;  3X1S A;  2YFW A;  3REJ B;  1KX4 C;  3B0D B;  1P3B D;  5F99 D;  3REH C;  1P3L B;  1P3L A;  5GT3 D;  4WU9 C;  3REI D;  3KUY A;  1ZLA D;  5FUG A;  3B6G C;  3REL D;  5AVC C;  5AV8 D;  1P3P A;  3C1B D;  3VH6 W;  3LZ0 A;  3WKJ C;  3A6N A;  3REJ C;  3B0D C;  2ZY4 A;  4J8V B;  5CPJ D;  3AZE A;  4J8V A;  1P34 B;  1P3L C;  3WAA A;  1HQ3 B;  1P34 A;  3W96 B;  1U35 B;  3W96 A;  5B31 B;  2F8N K;  1P3F B;  4AWL B;  1P3F A;  5AV5 B;  5AV5 A;  3AV1 D;  5GT0 D;  4JJN B;  1TAF B;  2G5H C;  4WU8 B;  5B33 D;  5E5A B;  5E5A A;  4J8V C;  1BH9 A;  3AFA B;  2CV5 D;  1P34 C;  4YS3 D;  5GSU B;  4XUJ B;  1HQ3 C;  2ZM5 A;  3W96 C;  1PZR A;  3KXB B;  1U35 C;  5B31 C;  5BNV A;  1P3F C;  4AWL C;  3AZK D;  3LZ1 B;  1P3K A;  5AV5 C;  4ZUX D;  2F8N B;  3LZ1 A;  3P5J B;  4J8X D;  4H9P B;  3AZF B;  4JJN C;  3H0L C;  3R45 B;  4H9P A;  3AZF A;  1JFI B;  5B1L A;  3AZL A;  4WU8 C;  5E5A C;  3MGS D;  3AZJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...