5B1MB

The mouse nucleosome structure containing h3.1
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
78
structure length
78
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Testis-Specific Histone Variant H3t Gene Is Essential for Entry into Spermatogenesis
pubmed doi rcsb
source organism Mus musculus
molecule tags Structural protein/dna
total genus 26
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b1mB00
3AV1C 4XZQC 1P3LC 1P3IA 3AZNB 4NE6A 4H9PA 3W96C 3AZJD 5F99C 3AZMA 2PYOD 1WWSA 5B32G 4X23C 3WKJA 5B40A 2YFVB 3W97A 5AY8D 2BYKA 3REJC 5B1LA 3UT9A 4UUZA 1P34D 4KUDB 4WV4B 5GSUD 5B0YB 5CPKB 1KX4D 1KX3D 5B33A 1F66B 3B6GA 5B2IC 5B0YA 2YFWA 1BH8A 3MGQA 4JJNC 3AZGD 3C1CC 5DNNC 2HIOC 3WA9C 1HQ3D 4G92B 3W98C 5C3IB 4YM6A 3AZND 2AROB 3R45B 1P3GC 4XUJC 3MGSA 2IO5C 4H9RB 5B2JA 4H9NB 2F8NK 4KUDD 5AV6B 5B0YD 5CPKD 1F66D 3KXBA 3MGPA 3AYWB 2HUEC 1A7WA 1P3BB 3AZJC 3AZIB 4G91C 1ID3B 1P3BA 3X1UB 2FJ7B 2CV5C 2AROD 4KHAB 5AY8C 1P34C 5GSUC 4WNNA 1KX3C 3X1SA 4ZUXA 2LY8A 5B1MA 5B31A 3AZGC 1HQ3C 5AV6D 1P3IC 5GT3A 1ZLAB 3AYWD 4J8WA 5DNMB 3AZNC 1BH9B 3LELA 1AOIB 1P3BD 3WKJC 3AZID 2F8NA 5B40C 2NZDA 1ID3D 3X1UD 2FJ7D 3UT9C 5E5AB 5B1LC 3KUYA 5B33C 3B6GC 4KUDC 5B0YC 4XZQA 1M19A 5FUGB 1P3LA 2NQBB 4Z5TB 4YM6C 2NQBA 1ZLAD 5B0ZB 2CWEA 5DNMD 1TZYB 3AZHB 4J8XB 2AROC 3B0BA 1AOID 4WZSB 2BYMB 3LJAB 3REJA 4WU8A 5BO0A 5E5AD 3MGRB 3KWQB 5B2IA 4R8PB 3C1CA 5DNNA 3WA9A 5AV6C 5GXQB 3W98A 3AYWC 4DRAA 5B32B 4Z5TD 1P3BC 5B32A 3AZIC 3TU4B 1R4VA 4XUJA 5B0ZD 3AZKB 1P3FB 3X1UC 1TZYD 3AZHD 1BFMA 1ULYA 4J8XD 3O62B 3REHA 4CSRA 3LJAD 3AV2B 1H3OA 1KX5B 3O62A 5AV5B 4ZUXC 1S32B 5B31C 3MGRD 3KWQD 4R8PD 4J8VB 5GT3C 1B6WA 3VH5T 3AZJA 5GXQD 4H9OB 2PYOA 5B32D 3B6FB 3TU4D 3W99B 5AY8A 3AZKD 1P3FD 1P34A 1F1EA 3KUYC 1M18B 5GSUA 1KX4A 4LD9B 1KX3A 4NE3A 3O62D 5CPIB 5JA4A 5B24B 3AV2D 3AZGA 1M19C 1KX5D 1HQ3A 5AV5D 1S32D 3VH5W 3A6NB 5AV9B 4J8VD 3AZNA 2NQBC 5AVCB 4ZBJC 1P3OB 5GT0B 5AV8B 5AVCA 1TZYC 3B6FD 2YFVA 4J8XC 2RVQD 3LJAC 3W99D 4WU8C 3AZEB 4KUDA 1M18D 5CPKA 4LD9D 1F66A 3MGRC 5CPID 5B24D 4R8PC 5AVBB 3NQJB 5B32C 3A6ND 5AV9D 2AROA 3R45A 5AVCD 1P3OD 5GT0D 5AV8D 3AZKC 1P3FC 3REHC 3AZLB 3NQUB 3O62C 3AV2C 4H9RA 1P3KB 3B0DB 3AZED 1KX5C 4H9NA 5AV6A 3VH5A 1S32C 5KDMB 3AYWA 4AWLC 3MNNB 3X1VB 5AVBD 2PYOC 1P3PB 4E44A 3AZIA 1ID3A 5BNXB 3X1UA 2FJ7A 3B6FC 2RVQC 3AZFB 3W99C 4KHAA 1KX4C 4WU9B 1EQZB 3AZFA 3WTPB 3LZ0B 3AZLD 5CP6B 4LD9C 5CPIC 2JSSA 3LZ0A 1P3KD 3AFAB 1ZLAA 4J8UB 5DNMA 3MNND 3A6NC 3REKB 3X1VD 1BH9A 1TAFB 3REIB 1AOIA 5AVCC 1P3PD 5GT0C 5E5AA 3AZFD 4KGCB 5CPKC 1F66C 4WU9D 1EQZD 1M1AB 3WTPD 3LZ0D 1P3AB 5CP6D 4KGCA 4G92C 5FUGA 3AFAD 3UTBB 5AVBC 4Z5TA 4H9SA 5C3IC 3UTBA 2F8NH 4H9QB 5B0ZA 4J8UD 1TZYA 4Z2MH 3RELB 3REKD 3AZHA 4J8XA 3REID 4H9QA 2BYMA 3LJAA 1P3MB 4DRBA 1P3MA 3AV1B 3MGRA 3KWQA 2L5AA 4KGCD 4R8PA 3B0DC 1WWIA 4YS3B 1M1AD 1P3AD 3UTAB 5BNVB 5GXQA 5F99B 3MVDB 4X23B 3UTBD 5JRGB 1ID3C 2FJ7C 1P3PC 3TU4A 3AZKA 1P3FA 3RELD 1JFIB 3AZFC 1P3MD 3AN2B 4JJNB 3AV2A 1KX5A 5G49B 2HIOB 5AV5A 3LZ0C 3AV1D 5CP6C 1S32A 4NFTA 5B31G 3AFAC 4J8VA 1ZLAC 4YS3D 5DNMC 3UTAD 5CPJB 1P3GB 5F99D 3MVDD 4H9OA 1AOIC 4J8UC 3B6FA 4X23D 2F8NG 3REKC 3REIC 5JRGD 4Z2MG 3W99A 5E5AC 3LZ1B 1M18A 4LD9A 5CPIA 4Z66B 4JJND 5B24A 3AN2D 3C1BB 4KGCC 4QLCB 2HIOD 4G91B 4Z5TC 4H9SC 1N1JB 3UTBC 3A6NA 4CAYB 5AV9A 2CV5B 5BS7C 3WAAB 5B0ZC 5CPJD 3AZHC 1P3OA 3VH6T 5GT0A 1P3GD 5AV8A 3RELC 1P3MC 3AZEA 3KWQC 3LZ1D 1P3IB 4H9PB 4Z66D 3C1BD 5GXQC 5AVBA 4QLCD 4YS3C 3AZMB 1B67A 3UTAC 3WKJB 5B40B 3W97B 3MVDC 3NQJA 3VH6W 3TU4C 2CV5D 3UT9B 2BYKB 3WAAD 5B1LB 5JRGC 4UUZB 5B33B 3B6GB 3AZLA 2YFWB 1BH8B 3MGQB 3NQUA 5AV5C 3AN2C 1P3KA 4YM6B 4E45A 1P3ID 4J8VC 5KDMA 3MNNA 3X1VA 3MGSB 3AZMD 1Q9CA 1P3PA 5CPJC 3WKJD 5B40D 3W97D 5BNXA 3UT9D 5B1LD 5B2JB 1M18C 4EO5B 5B33D 3KXBB 3MGPB 4WU9A 1EQZA 3B6GD 3LZ1C 3WTPA 4M6BA 5B24C 5CP6A 3MGQD 1U35B 4Z66C 1U35A 3AFAA 3C1BC 4QLCC 4YM6D 5AV9C 3VH6A 4J8UA 1P3OC 3REKA 3WAAC 1TAFA 3MGSD 5AV8C 3REIA 4WNNB 5BT1D 3X1SB 4ZUXB 5B1MB 5B31B 5B2JD 3AZEC 4HGAB 5GT3B 3KXBD 3MGPD 5CHLB 4J8WB 1M1AA 1P3AA 1U35D 3X1TB 3LELB 2F8NB 3X1TA 5BS7A 1HTAA 2NZDB 3AZMC 3W97C 3KUYB 3RELA 3B0CT 3AZLC 4XZQB 1M19B 3X1SD 4ZUXD 3AV1A 1P3LB 5B1MD 5B31D 3MGQC 1P3KC 3W96B 5GT3D 4YS3A 4J8WD 3W96A 3UTAA 4ZBJB 3MNNC 5BNVA 3X1TD 5F99A 3X1VC 3MVDA 3LELD 4X23A 2F8ND 3REJB 3MGSC 5JRGA 2NZDD 4WU8B 5BO0B 5BT1C 5B2IB 3B0CW 3KUYD 1JFIA 5B2JC 3C1CB 5DNNB 4WU9C 1EQZC 3WA9B 3WTPC 3AN2A 4JJNA 4EO5C 4XZQD 3KXBC 3MGPC 5G49A 1M19D 2HIOA 3W98B 1P3LD 1U35C 3V9RB 3W96D 2NQBD 4NE5A 4XUJB 3V9RA 3KSYA 5CPJA 1P3GA 2IO5B 3REHB 4CSRB 1H3OB 3REJD 4WU8D 2HUEB 5B2ID 3LZ1A 3X1SC 5B1MC 3C1CD 5DNND 4AWLB 1M1AC 1KU5A 3WA9D 4Z66A 3AZJB 1P3AC 4HGAC 3C1BA 3W98D 4QLCA 4J8WC 2PYOB 3WTPE 3X1TC 3LELC 1N1JA 4CAYA 2CV5A 5AY8B 3WAAA 4XUJD 2NZDC 1P34B 5GSUB 1KX4B 1KX3B 3REHD 5JA4B 3AZGB 1HQ3B
chains in the Genus database with same CATH superfamily
3AV1C 4XZQC 1P3LC 2Y2GA 3AZNB 4NE6A 1P3IA 2ZY2A 3H0MC 4H9PA 3W96C 3AZJD 5F99C 3AZMA 2PYOD 1WWSA 5B32G 4X23C 3WKJA 5B40A 2YFVB 3W97A 3P5JB 5AY8D 2BYKA 3REJC 5B1LA 3UT9A 4UUZA 1P34D 4WJ3C 4KUDB 4WV4B 5GSUD 5B0YB 5CPKB 1KX4D 1KX3D 5B33A 1F66B 3B6GA 5B2IC 5B0YA 2YFWA 1BH8A 3MGQA 4JJNC 3AZGD 3C1CC 5DNNC 2HIOC 3WA9C 1HQ3D 4G92B 3W98C 5C3IB 4YM6A 2XD1A 3AZND 2AROB 3R45B 1P3GC 4XUJC 3MGSA 1Z2CB 2IO5C 4H9RB 5B2JA 4H9NB 2F8NK 4KUDD 5AV6B 5B0YD 5CPKD 1F66D 3KXBA 3MGPA 3AYWB 2HUEC 1A7WA 1P3BB 3AZJC 3AZIB 4G91C 1ID3B 1P3BA 3X1UB 2FJ7B 2CV5C 2AROD 3EG5B 4KHAB 5AY8C 1P34C 4DQYB 5GSUC 4WNNA 1KX3C 3X1SA 4ZUXA 2LY8A 5B1MA 5B31A 3AZGC 1HQ3C 5AV6D 1P3IC 5GT3A 1ZLAB 3AYWD 4J8WA 5DNMB 3AZNC 1BH9B 3LELA 1AOIB 1P3BD 3WKJC 3AZID 2F8NA 5B40C 2NZDA 1ID3D 3X1UD 2FJ7D 3UT9C 5E5AB 5B1LC 3KUYA 5B33C 3B6GC 4KUDC 5B0YC 4XZQA 1M19A 4UPKA 5FUGB 1P3LA 2NQBB 4Z5TB 4YM6C 2NQBA 1ZLAD 5B0ZB 2CWEA 5DNMD 1TZYB 1PZRA 3AZHB 4J8XB 2AROC 3B0BA 1AOID 2RIQA 4WZSB 2BYMB 3LJAB 3H0LC 3REJA 2ZY5A 4WU8A 5BO0A 5E5AD 3MGRB 3KWQB 5B2IA 4R8PB 3C1CA 5DNNA 3WA9A 5AV6C 5GXQB 3W98A 3AYWC 4DRAA 5B32B 2Y2NA 4Z5TD 1P3BC 3EPHA 5B32A 3AZIC 3TU4B 1R4VA 4XUJA 5B0ZD 3AZKB 1P3FB 3X1UC 1TZYD 3AZHD 1BFMA 1ULYA 4J8XD 3O62B 3REHA 4CSRA 3LJAD 3AV2B 1H3OA 1KX5B 3O62A 5AV5B 4ZUXC 1S32B 5B31C 3MGRD 3KWQD 3FDDA 4R8PD 2ZM5A 5GT3C 4J8VB 1B6WA 3VH5T 3AZJA 5GXQD 4H9OB 2PYOA 5B32D 3B6FB 3KFUG 3TU4D 3W99B 5AY8A 3AZKD 1P3FD 1P34A 1F1EA 3KUYC 1M18B 5GSUA 1KX4A 4LD9B 1KX3A 4NE3A 3O62D 5CPIB 5JA4A 5B24B 3AV2D 3AZGA 1M19C 1KX5D 1HQ3A 5AV5D 1S32D 3VH5W 3A6NB 5AV9B 4J8VD 3AZNA 2NQBC 5AVCB 4ZBJC 1P3OB 5GT0B 5AV8B 5AVCA 1TZYC 3B6FD 2YFVA 4J8XC 2RVQD 3LJAC 3W99D 4WU8C 3AZEB 2UWXA 4KUDA 1M18D 5CPKA 4LD9D 1F66A 3MGRC 5CPID 5B24D 4R8PC 2VQRA 5AVBB 3F6TA 1T3UA 3NQJB 2DF4C 5B32C 3A6ND 5AV9D 2AROA 3R45A 5AVCD 1P3OD 5GT0D 5AV8D 3AZKC 1P3FC 3REHC 3AZLB 2Y2MA 3NQUB 3O62C 2Y2PA 3AV2C 4H9RA 1P3KB 3B0DB 3AZED 1KX5C 4H9NA 5AV6A 3VH5A 1S32C 2Y2KA 5KDMB 3AYWA 4AWLC 3MNNB 3X1VB 5AVBD 2PYOC 1P3PB 4E44A 3AZIA 1ID3A 5BNXB 3X1UA 2FJ7A 3B6FC 2RVQC 3AZFB 3W99C 4KHAA 1KX4C 4WU9B 1EQZB 3AZFA 2BG1A 3WTPB 3LZ0B 3AZLD 5CP6B 4LD9C 5CPIC 2JSSA 3LZ0A 1P3KD 3AFAB 1ZLAA 4J8UB 2FFFB 5DNMA 3MNND 3A6NC 3REKB 3X1VD 1BH9A 1TAFB 3REIB 1AOIA 5AVCC 1P3PD 2Y2IA 5GT0C 5E5AA 3AZFD 4KGCB 5CPKC 1F66C 4WU9D 1EQZD 1M1AB 3WTPD 3LZ0D 1P3AB 5CP6D 4KGCA 4G92C 5FUGA 3AFAD 3UTBB 5AVBC 4Z5TA 4H9SA 5C3IC 3UTBA 2F8NH 4H9QB 5B0ZA 4J8UD 1TZYA 4Z2MH 3RELB 3EPLA 3REKD 4J8XA 3REID 3AZHA 4H9QA 2BYMA 3LJAA 1P3MB 4DRBA 1P3MA 3AV1B 3MGRA 3KWQA 2L5AA 4KGCD 4R8PA 3B0DC 1WWIA 4YS3B 1M1AD 1P3AD 3UTAB 5BNVB 5GXQA 5F99B 3MVDB 4X23B 3UTBD 5JRGB 1ID3C 2FJ7C 1P3PC 3TU4A 3AZKA 1P3FA 3RELD 1JFIB 3AZFC 1P3MD 3AN2B 4JJNB 2XD5A 3AV2A 1KX5A 5G49B 2HIOB 5AV5A 3LZ0C 3AV1D 5CP6C 1S32A 4NFTA 5B31G 2Y2QA 3AFAC 4J8VA 1ZLAC 4YS3D 5DNMC 3UTAD 5CPJB 1P3GB 5F99D 3MVDD 4H9OA 1AOIC 4J8UC 3B6FA 4X23D 2F8NG 3REKC 3REIC 5JRGD 4Z2MG 3W99A 5E5AC 3LZ1B 1M18A 3H0RC 4LD9A 5CPIA 4Z66B 4JJND 5B24A 3AN2D 3C1BB 4KGCC 4QLCB 2HIOD 4G91B 4Z5TC 4H9SC 1N1JB 3UTBC 3A6NA 4CAYB 5AV9A 2CV5B 5BS7C 3WAAB 5B0ZC 5CPJD 3AZHC 1P3OA 3VH6T 5GT0A 1P3GD 5AV8A 3RELC 2JCHA 1P3MC 3A1KA 3AZEA 3KWQC 3LZ1D 1P3IB 4H9PB 4Z66D 3C1BD 5GXQC 5AVBA 4QLCD 4YS3C 3AZMB 1B67A 3UTAC 3EPKA 3WKJB 5B40B 3W97B 3MVDC 3NQJA 2G5HC 3VH6W 3TU4C 2CV5D 3UT9B 2BYKB 3WAAD 5B1LB 5JRGC 4UUZB 5B33B 3B6GB 3AZLA 2YFWB 1BH8B 3MGQB 3NQUA 5AV5C 2G5IC 3AN2C 1P3KA 3A1IA 4YM6B 4E45A 1P3ID 4J8VC 5KDMA 3MNNA 3X1VA 2JE5A 3MGSB 3AZMD 2J8PA 1Q9CA 1P3PA 5CPJC 3WKJD 5B40D 3W97D 5BNXA 3UT9D 5B1LD 5B2JB 1M18C 4EO5B 5B33D 3KXBB 3MGPB 4WU9A 1EQZA 3B6GD 3LZ1C 3WTPA 4M6BA 5B24C 5CP6A 3MGQD 1U35B 4Z66C 1U35A 3AFAA 3C1BC 4QLCC 4YM6D 5AV9C 3VH6A 4J8UA 1P3OC 3REKA 3WAAC 1TAFA 3MGSD 5AV8C 3REIA 4WNNB 5BT1D 3IP4C 3X1SB 2ZY3A 4ZUXB 5B1MB 5B31B 5B2JD 3AZEC 2Y2LA 4HGAB 5GT3B 3KXBD 3MGPD 5CHLB 4J8WB 1M1AA 1P3AA 1U35D 3X1TB 3LELB 3AL0C 2F8NB 3X1TA 5BS7A 1HTAA 2NZDB 3AZMC 2Y2JA 2F2AC 3W97C 3KUYB 3RELA 2Y2HA 3B0CT 3AZLC 4XZQB 1M19B 3X1SD 4ZUXD 3AV1A 1P3LB 5B1MD 5B31D 3MGQC 1P3KC 3W96B 5GT3D 4YS3A 4J8WD 3W96A 3UTAA 4ZBJB 3MNNC 5BNVA 3X1TD 5F99A 3X1VC 3MVDA 3LELD 3EPJA 4X23A 2F8ND 3REJB 3MGSC 5JRGA 2NZDD 4WU8B 5BO0B 5BT1C 5B2IB 3B0CW 3KUYD 1JFIA 5B2JC 3C1CB 2Y2OA 5DNNB 4WU9C 1EQZC 3WA9B 3WTPC 3AN2A 4JJNA 4EO5C 4XZQD 3KXBC 3MGPC 5G49A 1M19D 2HIOA 3W98B 1P3LD 1U35C 1W2EA 3V9RB 2W8SA 3W96D 2NQBD 2DQNC 4NE5A 4XUJB 3V9RA 3KSYA 5CPJA 1P3GA 2IO5B 3REHB 4CSRB 1H3OB 3REJD 4WU8D 2HUEB 5B2ID 3LZ1A 3X1SC 5B1MC 3C1CD 5DNND 4AWLB 1M1AC 1KU5A 3WA9D 4Z66A 3AZJB 1P3AC 4HGAC 3C1BA 3W98D 4QLCA 4J8WC 2PYOB 3WTPE 3X1TC 3LELC 1N1JA 4CAYA 2CV5A 5AY8B 3WAAA 4XUJD 2NZDC 1P34B 5GSUB 1KX4B 1KX3B 3REHD 5JA4B 2ZY4A 3AZGB 1HQ3B
chains in the Genus database with same CATH topology
3AV1C 4XZQC 1P3LC 2Y2GA 3AZNB 4NE6A 1P3IA 2ZY2A 3H0MC 4H9PA 3W96C 3AZJD 5F99C 3AZMA 2PYOD 1WWSA 5B32G 4X23C 3WKJA 5B40A 2YFVB 3W97A 3P5JB 5AY8D 2BYKA 3REJC 5B1LA 3UT9A 4UUZA 1P34D 4WJ3C 4KUDB 4WV4B 5GSUD 5B0YB 5CPKB 1KX4D 1KX3D 5B33A 1F66B 3B6GA 5B2IC 5B0YA 2YFWA 1BH8A 3MGQA 4JJNC 3AZGD 3C1CC 5DNNC 2HIOC 3WA9C 1HQ3D 4G92B 3W98C 5C3IB 4YM6A 2XD1A 3AZND 2AROB 3R45B 1P3GC 4XUJC 3MGSA 1Z2CB 2IO5C 4H9RB 5B2JA 4H9NB 2F8NK 4KUDD 5AV6B 5B0YD 5CPKD 1F66D 3KXBA 3MGPA 3AYWB 2HUEC 1A7WA 1P3BB 3AZJC 3AZIB 4G91C 1ID3B 1P3BA 3X1UB 2FJ7B 2CV5C 2AROD 3EG5B 4KHAB 5AY8C 1P34C 4DQYB 5GSUC 4WNNA 1KX3C 3X1SA 4ZUXA 2LY8A 5B1MA 5B31A 3AZGC 1HQ3C 5AV6D 1P3IC 5GT3A 1ZLAB 3AYWD 4J8WA 5DNMB 3AZNC 1BH9B 3LELA 1AOIB 1P3BD 3WKJC 3AZID 2F8NA 5B40C 2NZDA 1ID3D 3X1UD 2FJ7D 3UT9C 5E5AB 5B1LC 3KUYA 5B33C 3B6GC 4KUDC 5B0YC 4XZQA 1M19A 4UPKA 5FUGB 1P3LA 2NQBB 4Z5TB 4YM6C 2NQBA 1ZLAD 5B0ZB 2CWEA 5DNMD 1TZYB 1PZRA 3AZHB 4J8XB 2AROC 3B0BA 1AOID 2RIQA 4WZSB 2BYMB 3LJAB 3H0LC 3REJA 2ZY5A 4WU8A 5BO0A 5E5AD 3MGRB 3KWQB 5B2IA 4R8PB 3C1CA 5DNNA 3WA9A 5AV6C 5GXQB 3W98A 3AYWC 4DRAA 5B32B 2Y2NA 4Z5TD 1P3BC 3EPHA 5B32A 3AZIC 3TU4B 1R4VA 4XUJA 5B0ZD 3AZKB 1P3FB 3X1UC 1TZYD 3AZHD 1BFMA 1ULYA 4J8XD 3O62B 3REHA 4CSRA 3LJAD 3AV2B 1H3OA 1KX5B 3O62A 5AV5B 4ZUXC 1S32B 5B31C 3MGRD 3KWQD 3FDDA 4R8PD 2ZM5A 5GT3C 4J8VB 1B6WA 3VH5T 3AZJA 5GXQD 4H9OB 2PYOA 5B32D 3B6FB 3KFUG 3TU4D 3W99B 5AY8A 3AZKD 1P3FD 1P34A 1F1EA 3KUYC 1M18B 5GSUA 1KX4A 4LD9B 1KX3A 4NE3A 3O62D 5CPIB 5JA4A 5B24B 3AV2D 3AZGA 1M19C 1KX5D 1HQ3A 5AV5D 1S32D 3VH5W 3A6NB 5AV9B 4J8VD 3AZNA 2NQBC 5AVCB 4ZBJC 1P3OB 5GT0B 5AV8B 5AVCA 1TZYC 3B6FD 2YFVA 4J8XC 2RVQD 3LJAC 3W99D 4WU8C 3AZEB 2UWXA 4KUDA 1M18D 5CPKA 4LD9D 1F66A 3MGRC 5CPID 5B24D 4R8PC 2VQRA 5AVBB 3F6TA 1T3UA 3NQJB 2DF4C 5B32C 3A6ND 5AV9D 2AROA 3R45A 5AVCD 1P3OD 5GT0D 5AV8D 3AZKC 1P3FC 3REHC 3AZLB 2Y2MA 3NQUB 3O62C 2Y2PA 3AV2C 4H9RA 1P3KB 3B0DB 3AZED 1KX5C 4H9NA 5AV6A 3VH5A 1S32C 2Y2KA 5KDMB 3AYWA 4AWLC 3MNNB 3X1VB 5AVBD 2PYOC 1P3PB 4E44A 3AZIA 1ID3A 5BNXB 3X1UA 2FJ7A 3B6FC 2RVQC 3AZFB 3W99C 4KHAA 1KX4C 4WU9B 1EQZB 3AZFA 2BG1A 3WTPB 3LZ0B 3AZLD 5CP6B 4LD9C 5CPIC 2JSSA 3LZ0A 1P3KD 3AFAB 1ZLAA 4J8UB 2FFFB 5DNMA 3MNND 3A6NC 3REKB 3X1VD 1BH9A 1TAFB 3REIB 1AOIA 5AVCC 1P3PD 2Y2IA 5GT0C 5E5AA 3AZFD 4KGCB 5CPKC 1F66C 4WU9D 1EQZD 1M1AB 3WTPD 3LZ0D 1P3AB 5CP6D 4KGCA 4G92C 5FUGA 3AFAD 3UTBB 5AVBC 4Z5TA 4H9SA 5C3IC 3UTBA 2F8NH 4H9QB 5B0ZA 4J8UD 1TZYA 4Z2MH 3RELB 3EPLA 3REKD 4J8XA 3REID 3AZHA 4H9QA 2BYMA 3LJAA 1P3MB 4DRBA 1P3MA 3AV1B 3MGRA 3KWQA 2L5AA 4KGCD 4R8PA 3B0DC 1WWIA 4YS3B 1M1AD 1P3AD 3UTAB 5BNVB 5GXQA 5F99B 3MVDB 4X23B 3UTBD 5JRGB 1ID3C 2FJ7C 1P3PC 3TU4A 3AZKA 1P3FA 3RELD 1JFIB 3AZFC 1P3MD 3AN2B 4JJNB 2XD5A 3AV2A 1KX5A 5G49B 2HIOB 5AV5A 3LZ0C 3AV1D 5CP6C 1S32A 4NFTA 5B31G 2Y2QA 3AFAC 4J8VA 1ZLAC 4YS3D 5DNMC 3UTAD 5CPJB 1P3GB 5F99D 3MVDD 4H9OA 1AOIC 4J8UC 3B6FA 4X23D 2F8NG 3REKC 3REIC 5JRGD 4Z2MG 3W99A 5E5AC 3LZ1B 1M18A 3H0RC 4LD9A 5CPIA 4Z66B 4JJND 5B24A 3AN2D 3C1BB 4KGCC 4QLCB 2HIOD 4G91B 4Z5TC 4H9SC 1N1JB 3UTBC 3A6NA 4CAYB 5AV9A 2CV5B 5BS7C 3WAAB 5B0ZC 5CPJD 3AZHC 1P3OA 3VH6T 5GT0A 1P3GD 5AV8A 3RELC 2JCHA 1P3MC 3A1KA 3AZEA 3KWQC 3LZ1D 1P3IB 4H9PB 4Z66D 3C1BD 5GXQC 5AVBA 4QLCD 4YS3C 3AZMB 1B67A 3UTAC 3EPKA 3WKJB 5B40B 3W97B 3MVDC 3NQJA 2G5HC 3VH6W 3TU4C 2CV5D 3UT9B 2BYKB 3WAAD 5B1LB 5JRGC 4UUZB 5B33B 3B6GB 3AZLA 2YFWB 1BH8B 3MGQB 3NQUA 5AV5C 2G5IC 3AN2C 1P3KA 3A1IA 4YM6B 4E45A 1P3ID 4J8VC 5KDMA 3MNNA 3X1VA 2JE5A 3MGSB 3AZMD 2J8PA 1Q9CA 1P3PA 5CPJC 3WKJD 5B40D 3W97D 5BNXA 3UT9D 5B1LD 5B2JB 1M18C 4EO5B 5B33D 3KXBB 3MGPB 4WU9A 1EQZA 3B6GD 3LZ1C 3WTPA 4M6BA 5B24C 5CP6A 3MGQD 1U35B 4Z66C 1U35A 3AFAA 3C1BC 4QLCC 4YM6D 5AV9C 3VH6A 4J8UA 1P3OC 3REKA 3WAAC 1TAFA 3MGSD 5AV8C 3REIA 4WNNB 5BT1D 3IP4C 3X1SB 2ZY3A 4ZUXB 5B1MB 5B31B 5B2JD 3AZEC 2Y2LA 4HGAB 5GT3B 3KXBD 3MGPD 5CHLB 4J8WB 1M1AA 1P3AA 1U35D 3X1TB 3LELB 3AL0C 2F8NB 3X1TA 5BS7A 1HTAA 2NZDB 3AZMC 2Y2JA 2F2AC 3W97C 3KUYB 3RELA 2Y2HA 3B0CT 3AZLC 4XZQB 1M19B 3X1SD 4ZUXD 3AV1A 1P3LB 5B1MD 5B31D 3MGQC 1P3KC 3W96B 5GT3D 4YS3A 4J8WD 3W96A 3UTAA 4ZBJB 3MNNC 5BNVA 3X1TD 5F99A 3X1VC 3MVDA 3LELD 3EPJA 4X23A 2F8ND 3REJB 3MGSC 5JRGA 2NZDD 4WU8B 5BO0B 5BT1C 5B2IB 3B0CW 3KUYD 1JFIA 5B2JC 3C1CB 2Y2OA 5DNNB 4WU9C 1EQZC 3WA9B 3WTPC 3AN2A 4JJNA 4EO5C 4XZQD 3KXBC 3MGPC 5G49A 1M19D 2HIOA 3W98B 1P3LD 1U35C 1W2EA 3V9RB 2W8SA 3W96D 2NQBD 2DQNC 4NE5A 4XUJB 3V9RA 3KSYA 5CPJA 1P3GA 2IO5B 3REHB 4CSRB 1H3OB 3REJD 4WU8D 2HUEB 5B2ID 3LZ1A 3X1SC 5B1MC 3C1CD 5DNND 4AWLB 1M1AC 1KU5A 3WA9D 4Z66A 3AZJB 1P3AC 4HGAC 3C1BA 3W98D 4QLCA 4J8WC 2PYOB 3WTPE 3X1TC 3LELC 1N1JA 4CAYA 2CV5A 5AY8B 3WAAA 4XUJD 2NZDC 1P34B 5GSUB 1KX4B 1KX3B 3REHD 5JA4B 2ZY4A 3AZGB 1HQ3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AV1 C;  4XZQ C;  1P3L C;  1P3I A;  3AZN B;  4NE6 A;  4H9P A;  3W96 C;  3AZJ D;  5F99 C;  3AZM A;  2PYO D;  1WWS A;  5B32 G;  4X23 C;  3WKJ A;  5B40 A;  2YFV B;  3W97 A;  5AY8 D;  2BYK A;  3REJ C;  5B1L A;  3UT9 A;  4UUZ A;  1P34 D;  4KUD B;  4WV4 B;  5GSU D;  5B0Y B;  5CPK B;  1KX4 D;  1KX3 D;  5B33 A;  1F66 B;  3B6G A;  5B2I C;  5B0Y A;  2YFW A;  1BH8 A;  3MGQ A;  4JJN C;  3AZG D;  3C1C C;  5DNN C;  2HIO C;  3WA9 C;  1HQ3 D;  4G92 B;  3W98 C;  5C3I B;  4YM6 A;  3AZN D;  2ARO B;  3R45 B;  1P3G C;  4XUJ C;  3MGS A;  2IO5 C;  4H9R B;  5B2J A;  4H9N B;  2F8N K;  4KUD D;  5AV6 B;  5B0Y D;  5CPK D;  1F66 D;  3KXB A;  3MGP A;  3AYW B;  2HUE C;  1A7W A;  1P3B B;  3AZJ C;  3AZI B;  4G91 C;  1ID3 B;  1P3B A;  3X1U B;  2FJ7 B;  2CV5 C;  2ARO D;  4KHA B;  5AY8 C;  1P34 C;  5GSU C;  4WNN A;  1KX3 C;  3X1S A;  4ZUX A;  2LY8 A;  5B1M A;  5B31 A;  3AZG C;  1HQ3 C;  5AV6 D;  1P3I C;  5GT3 A;  1ZLA B;  3AYW D;  4J8W A;  5DNM B;  3AZN C;  1BH9 B;  3LEL A;  1AOI B;  1P3B D;  3WKJ C;  3AZI D;  2F8N A;  5B40 C;  2NZD A;  1ID3 D;  3X1U D;  2FJ7 D;  3UT9 C;  5E5A B;  5B1L C;  3KUY A;  5B33 C;  3B6G C;  4KUD C;  5B0Y C;  4XZQ A;  1M19 A;  5FUG B;  1P3L A;  2NQB B;  4Z5T B;  4YM6 C;  2NQB A;  1ZLA D;  5B0Z B;  2CWE A;  5DNM D;  1TZY B;  3AZH B;  4J8X B;  2ARO C;  3B0B A;  1AOI D;  4WZS B;  2BYM B;  3LJA B;  3REJ A;  4WU8 A;  5BO0 A;  5E5A D;  3MGR B;  3KWQ B;  5B2I A;  4R8P B;  3C1C A;  5DNN A;  3WA9 A;  5AV6 C;  5GXQ B;  3W98 A;  3AYW C;  4DRA A;  5B32 B;  4Z5T D;  1P3B C;  5B32 A;  3AZI C;  3TU4 B;  1R4V A;  4XUJ A;  5B0Z D;  3AZK B;  1P3F B;  3X1U C;  1TZY D;  3AZH D;  1BFM A;  1ULY A;  4J8X D;  3O62 B;  3REH A;  4CSR A;  3LJA D;  3AV2 B;  1H3O A;  1KX5 B;  3O62 A;  5AV5 B;  4ZUX C;  1S32 B;  5B31 C;  3MGR D;  3KWQ D;  4R8P D;  4J8V B;  5GT3 C;  1B6W A;  3VH5 T;  3AZJ A;  5GXQ D;  4H9O B;  2PYO A;  5B32 D;  3B6F B;  3TU4 D;  3W99 B;  5AY8 A;  3AZK D;  1P3F D;  1P34 A;  1F1E A;  3KUY C;  1M18 B;  5GSU A;  1KX4 A;  4LD9 B;  1KX3 A;  4NE3 A;  3O62 D;  5CPI B;  5JA4 A;  5B24 B;  3AV2 D;  3AZG A;  1M19 C;  1KX5 D;  1HQ3 A;  5AV5 D;  1S32 D;  3VH5 W;  3A6N B;  5AV9 B;  4J8V D;  3AZN A;  2NQB C;  5AVC B;  4ZBJ C;  1P3O B;  5GT0 B;  5AV8 B;  5AVC A;  1TZY C;  3B6F D;  2YFV A;  4J8X C;  2RVQ D;  3LJA C;  3W99 D;  4WU8 C;  3AZE B;  4KUD A;  1M18 D;  5CPK A;  4LD9 D;  1F66 A;  3MGR C;  5CPI D;  5B24 D;  4R8P C;  5AVB B;  3NQJ B;  5B32 C;  3A6N D;  5AV9 D;  2ARO A;  3R45 A;  5AVC D;  1P3O D;  5GT0 D;  5AV8 D;  3AZK C;  1P3F C;  3REH C;  3AZL B;  3NQU B;  3O62 C;  3AV2 C;  4H9R A;  1P3K B;  3B0D B;  3AZE D;  1KX5 C;  4H9N A;  5AV6 A;  3VH5 A;  1S32 C;  5KDM B;  3AYW A;  4AWL C;  3MNN B;  3X1V B;  5AVB D;  2PYO C;  1P3P B;  4E44 A;  3AZI A;  1ID3 A;  5BNX B;  3X1U A;  2FJ7 A;  3B6F C;  2RVQ C;  3AZF B;  3W99 C;  4KHA A;  1KX4 C;  4WU9 B;  1EQZ B;  3AZF A;  3WTP B;  3LZ0 B;  3AZL D;  5CP6 B;  4LD9 C;  5CPI C;  2JSS A;  3LZ0 A;  1P3K D;  3AFA B;  1ZLA A;  4J8U B;  5DNM A;  3MNN D;  3A6N C;  3REK B;  3X1V D;  1BH9 A;  1TAF B;  3REI B;  1AOI A;  5AVC C;  1P3P D;  5GT0 C;  5E5A A;  3AZF D;  4KGC B;  5CPK C;  1F66 C;  4WU9 D;  1EQZ D;  1M1A B;  3WTP D;  3LZ0 D;  1P3A B;  5CP6 D;  4KGC A;  4G92 C;  5FUG A;  3AFA D;  3UTB B;  5AVB C;  4Z5T A;  4H9S A;  5C3I C;  3UTB A;  2F8N H;  4H9Q B;  5B0Z A;  4J8U D;  1TZY A;  4Z2M H;  3REL B;  3REK D;  3AZH A;  4J8X A;  3REI D;  4H9Q A;  2BYM A;  3LJA A;  1P3M B;  4DRB A;  1P3M A;  3AV1 B;  3MGR A;  3KWQ A;  2L5A A;  4KGC D;  4R8P A;  3B0D C;  1WWI A;  4YS3 B;  1M1A D;  1P3A D;  3UTA B;  5BNV B;  5GXQ A;  5F99 B;  3MVD B;  4X23 B;  3UTB D;  5JRG B;  1ID3 C;  2FJ7 C;  1P3P C;  3TU4 A;  3AZK A;  1P3F A;  3REL D;  1JFI B;  3AZF C;  1P3M D;  3AN2 B;  4JJN B;  3AV2 A;  1KX5 A;  5G49 B;  2HIO B;  5AV5 A;  3LZ0 C;  3AV1 D;  5CP6 C;  1S32 A;  4NFT A;  5B31 G;  3AFA C;  4J8V A;  1ZLA C;  4YS3 D;  5DNM C;  3UTA D;  5CPJ B;  1P3G B;  5F99 D;  3MVD D;  4H9O A;  1AOI C;  4J8U C;  3B6F A;  4X23 D;  2F8N G;  3REK C;  3REI C;  5JRG D;  4Z2M G;  3W99 A;  5E5A C;  3LZ1 B;  1M18 A;  4LD9 A;  5CPI A;  4Z66 B;  4JJN D;  5B24 A;  3AN2 D;  3C1B B;  4KGC C;  4QLC B;  2HIO D;  4G91 B;  4Z5T C;  4H9S C;  1N1J B;  3UTB C;  3A6N A;  4CAY B;  5AV9 A;  2CV5 B;  5BS7 C;  3WAA B;  5B0Z C;  5CPJ D;  3AZH C;  1P3O A;  3VH6 T;  5GT0 A;  1P3G D;  5AV8 A;  3REL C;  1P3M C;  3AZE A;  3KWQ C;  3LZ1 D;  1P3I B;  4H9P B;  4Z66 D;  3C1B D;  5GXQ C;  5AVB A;  4QLC D;  4YS3 C;  3AZM B;  1B67 A;  3UTA C;  3WKJ B;  5B40 B;  3W97 B;  3MVD C;  3NQJ A;  3VH6 W;  3TU4 C;  2CV5 D;  3UT9 B;  2BYK B;  3WAA D;  5B1L B;  5JRG C;  4UUZ B;  5B33 B;  3B6G B;  3AZL A;  2YFW B;  1BH8 B;  3MGQ B;  3NQU A;  5AV5 C;  3AN2 C;  1P3K A;  4YM6 B;  4E45 A;  1P3I D;  4J8V C;  5KDM A;  3MNN A;  3X1V A;  3MGS B;  3AZM D;  1Q9C A;  1P3P A;  5CPJ C;  3WKJ D;  5B40 D;  3W97 D;  5BNX A;  3UT9 D;  5B1L D;  5B2J B;  1M18 C;  4EO5 B;  5B33 D;  3KXB B;  3MGP B;  4WU9 A;  1EQZ A;  3B6G D;  3LZ1 C;  3WTP A;  4M6B A;  5B24 C;  5CP6 A;  3MGQ D;  1U35 B;  4Z66 C;  1U35 A;  3AFA A;  3C1B C;  4QLC C;  4YM6 D;  5AV9 C;  3VH6 A;  4J8U A;  1P3O C;  3REK A;  3WAA C;  1TAF A;  3MGS D;  5AV8 C;  3REI A;  4WNN B;  5BT1 D;  3X1S B;  4ZUX B;  5B1M B;  5B31 B;  5B2J D;  3AZE C;  4HGA B;  5GT3 B;  3KXB D;  3MGP D;  5CHL B;  4J8W B;  1M1A A;  1P3A A;  1U35 D;  3X1T B;  3LEL B;  2F8N B;  3X1T A;  5BS7 A;  1HTA A;  2NZD B;  3AZM C;  3W97 C;  3KUY B;  3REL A;  3B0C T;  3AZL C;  4XZQ B;  1M19 B;  3X1S D;  4ZUX D;  3AV1 A;  1P3L B;  5B1M D;  5B31 D;  3MGQ C;  1P3K C;  3W96 B;  5GT3 D;  4YS3 A;  4J8W D;  3W96 A;  3UTA A;  4ZBJ B;  3MNN C;  5BNV A;  3X1T D;  5F99 A;  3X1V C;  3MVD A;  3LEL D;  4X23 A;  2F8N D;  3REJ B;  3MGS C;  5JRG A;  2NZD D;  4WU8 B;  5BO0 B;  5BT1 C;  5B2I B;  3B0C W;  3KUY D;  1JFI A;  5B2J C;  3C1C B;  5DNN B;  4WU9 C;  1EQZ C;  3WA9 B;  3WTP C;  3AN2 A;  4JJN A;  4EO5 C;  4XZQ D;  3KXB C;  3MGP C;  5G49 A;  1M19 D;  2HIO A;  3W98 B;  1P3L D;  1U35 C;  3V9R B;  3W96 D;  2NQB D;  4NE5 A;  4XUJ B;  3V9R A;  3KSY A;  5CPJ A;  1P3G A;  2IO5 B;  3REH B;  4CSR B;  1H3O B;  3REJ D;  4WU8 D;  2HUE B;  5B2I D;  3LZ1 A;  3X1S C;  5B1M C;  3C1C D;  5DNN D;  4AWL B;  1M1A C;  1KU5 A;  3WA9 D;  4Z66 A;  3AZJ B;  1P3A C;  4HGA C;  3C1B A;  3W98 D;  4QLC A;  4J8W C;  2PYO B;  3WTP E;  3X1T C;  3LEL C;  1N1J A;  4CAY A;  2CV5 A;  5AY8 B;  3WAA A;  4XUJ D;  2NZD C;  1P34 B;  5GSU B;  1KX4 B;  1KX3 B;  3REH D;  5JA4 B;  3AZG B;  1HQ3 B; 
#chains in the Genus database with same CATH topology
 3AV1 C;  4XZQ C;  1P3L C;  2Y2G A;  3AZN B;  4NE6 A;  1P3I A;  2ZY2 A;  3H0M C;  4H9P A;  3W96 C;  3AZJ D;  5F99 C;  3AZM A;  2PYO D;  1WWS A;  5B32 G;  4X23 C;  3WKJ A;  5B40 A;  2YFV B;  3W97 A;  3P5J B;  5AY8 D;  2BYK A;  3REJ C;  5B1L A;  3UT9 A;  4UUZ A;  1P34 D;  4WJ3 C;  4KUD B;  4WV4 B;  5GSU D;  5B0Y B;  5CPK B;  1KX4 D;  1KX3 D;  5B33 A;  1F66 B;  3B6G A;  5B2I C;  5B0Y A;  2YFW A;  1BH8 A;  3MGQ A;  4JJN C;  3AZG D;  3C1C C;  5DNN C;  2HIO C;  3WA9 C;  1HQ3 D;  4G92 B;  3W98 C;  5C3I B;  4YM6 A;  2XD1 A;  3AZN D;  2ARO B;  3R45 B;  1P3G C;  4XUJ C;  3MGS A;  1Z2C B;  2IO5 C;  4H9R B;  5B2J A;  4H9N B;  2F8N K;  4KUD D;  5AV6 B;  5B0Y D;  5CPK D;  1F66 D;  3KXB A;  3MGP A;  3AYW B;  2HUE C;  1A7W A;  1P3B B;  3AZJ C;  3AZI B;  4G91 C;  1ID3 B;  1P3B A;  3X1U B;  2FJ7 B;  2CV5 C;  2ARO D;  3EG5 B;  4KHA B;  5AY8 C;  1P34 C;  4DQY B;  5GSU C;  4WNN A;  1KX3 C;  3X1S A;  4ZUX A;  2LY8 A;  5B1M A;  5B31 A;  3AZG C;  1HQ3 C;  5AV6 D;  1P3I C;  5GT3 A;  1ZLA B;  3AYW D;  4J8W A;  5DNM B;  3AZN C;  1BH9 B;  3LEL A;  1AOI B;  1P3B D;  3WKJ C;  3AZI D;  2F8N A;  5B40 C;  2NZD A;  1ID3 D;  3X1U D;  2FJ7 D;  3UT9 C;  5E5A B;  5B1L C;  3KUY A;  5B33 C;  3B6G C;  4KUD C;  5B0Y C;  4XZQ A;  1M19 A;  4UPK A;  5FUG B;  1P3L A;  2NQB B;  4Z5T B;  4YM6 C;  2NQB A;  1ZLA D;  5B0Z B;  2CWE A;  5DNM D;  1TZY B;  1PZR A;  3AZH B;  4J8X B;  2ARO C;  3B0B A;  1AOI D;  2RIQ A;  4WZS B;  2BYM B;  3LJA B;  3H0L C;  3REJ A;  2ZY5 A;  4WU8 A;  5BO0 A;  5E5A D;  3MGR B;  3KWQ B;  5B2I A;  4R8P B;  3C1C A;  5DNN A;  3WA9 A;  5AV6 C;  5GXQ B;  3W98 A;  3AYW C;  4DRA A;  5B32 B;  2Y2N A;  4Z5T D;  1P3B C;  3EPH A;  5B32 A;  3AZI C;  3TU4 B;  1R4V A;  4XUJ A;  5B0Z D;  3AZK B;  1P3F B;  3X1U C;  1TZY D;  3AZH D;  1BFM A;  1ULY A;  4J8X D;  3O62 B;  3REH A;  4CSR A;  3LJA D;  3AV2 B;  1H3O A;  1KX5 B;  3O62 A;  5AV5 B;  4ZUX C;  1S32 B;  5B31 C;  3MGR D;  3KWQ D;  3FDD A;  4R8P D;  2ZM5 A;  5GT3 C;  4J8V B;  1B6W A;  3VH5 T;  3AZJ A;  5GXQ D;  4H9O B;  2PYO A;  5B32 D;  3B6F B;  3KFU G;  3TU4 D;  3W99 B;  5AY8 A;  3AZK D;  1P3F D;  1P34 A;  1F1E A;  3KUY C;  1M18 B;  5GSU A;  1KX4 A;  4LD9 B;  1KX3 A;  4NE3 A;  3O62 D;  5CPI B;  5JA4 A;  5B24 B;  3AV2 D;  3AZG A;  1M19 C;  1KX5 D;  1HQ3 A;  5AV5 D;  1S32 D;  3VH5 W;  3A6N B;  5AV9 B;  4J8V D;  3AZN A;  2NQB C;  5AVC B;  4ZBJ C;  1P3O B;  5GT0 B;  5AV8 B;  5AVC A;  1TZY C;  3B6F D;  2YFV A;  4J8X C;  2RVQ D;  3LJA C;  3W99 D;  4WU8 C;  3AZE B;  2UWX A;  4KUD A;  1M18 D;  5CPK A;  4LD9 D;  1F66 A;  3MGR C;  5CPI D;  5B24 D;  4R8P C;  2VQR A;  5AVB B;  3F6T A;  1T3U A;  3NQJ B;  2DF4 C;  5B32 C;  3A6N D;  5AV9 D;  2ARO A;  3R45 A;  5AVC D;  1P3O D;  5GT0 D;  5AV8 D;  3AZK C;  1P3F C;  3REH C;  3AZL B;  2Y2M A;  3NQU B;  3O62 C;  2Y2P A;  3AV2 C;  4H9R A;  1P3K B;  3B0D B;  3AZE D;  1KX5 C;  4H9N A;  5AV6 A;  3VH5 A;  1S32 C;  2Y2K A;  5KDM B;  3AYW A;  4AWL C;  3MNN B;  3X1V B;  5AVB D;  2PYO C;  1P3P B;  4E44 A;  3AZI A;  1ID3 A;  5BNX B;  3X1U A;  2FJ7 A;  3B6F C;  2RVQ C;  3AZF B;  3W99 C;  4KHA A;  1KX4 C;  4WU9 B;  1EQZ B;  3AZF A;  2BG1 A;  3WTP B;  3LZ0 B;  3AZL D;  5CP6 B;  4LD9 C;  5CPI C;  2JSS A;  3LZ0 A;  1P3K D;  3AFA B;  1ZLA A;  4J8U B;  2FFF B;  5DNM A;  3MNN D;  3A6N C;  3REK B;  3X1V D;  1BH9 A;  1TAF B;  3REI B;  1AOI A;  5AVC C;  1P3P D;  2Y2I A;  5GT0 C;  5E5A A;  3AZF D;  4KGC B;  5CPK C;  1F66 C;  4WU9 D;  1EQZ D;  1M1A B;  3WTP D;  3LZ0 D;  1P3A B;  5CP6 D;  4KGC A;  4G92 C;  5FUG A;  3AFA D;  3UTB B;  5AVB C;  4Z5T A;  4H9S A;  5C3I C;  3UTB A;  2F8N H;  4H9Q B;  5B0Z A;  4J8U D;  1TZY A;  4Z2M H;  3REL B;  3EPL A;  3REK D;  4J8X A;  3REI D;  3AZH A;  4H9Q A;  2BYM A;  3LJA A;  1P3M B;  4DRB A;  1P3M A;  3AV1 B;  3MGR A;  3KWQ A;  2L5A A;  4KGC D;  4R8P A;  3B0D C;  1WWI A;  4YS3 B;  1M1A D;  1P3A D;  3UTA B;  5BNV B;  5GXQ A;  5F99 B;  3MVD B;  4X23 B;  3UTB D;  5JRG B;  1ID3 C;  2FJ7 C;  1P3P C;  3TU4 A;  3AZK A;  1P3F A;  3REL D;  1JFI B;  3AZF C;  1P3M D;  3AN2 B;  4JJN B;  2XD5 A;  3AV2 A;  1KX5 A;  5G49 B;  2HIO B;  5AV5 A;  3LZ0 C;  3AV1 D;  5CP6 C;  1S32 A;  4NFT A;  5B31 G;  2Y2Q A;  3AFA C;  4J8V A;  1ZLA C;  4YS3 D;  5DNM C;  3UTA D;  5CPJ B;  1P3G B;  5F99 D;  3MVD D;  4H9O A;  1AOI C;  4J8U C;  3B6F A;  4X23 D;  2F8N G;  3REK C;  3REI C;  5JRG D;  4Z2M G;  3W99 A;  5E5A C;  3LZ1 B;  1M18 A;  3H0R C;  4LD9 A;  5CPI A;  4Z66 B;  4JJN D;  5B24 A;  3AN2 D;  3C1B B;  4KGC C;  4QLC B;  2HIO D;  4G91 B;  4Z5T C;  4H9S C;  1N1J B;  3UTB C;  3A6N A;  4CAY B;  5AV9 A;  2CV5 B;  5BS7 C;  3WAA B;  5B0Z C;  5CPJ D;  3AZH C;  1P3O A;  3VH6 T;  5GT0 A;  1P3G D;  5AV8 A;  3REL C;  2JCH A;  1P3M C;  3A1K A;  3AZE A;  3KWQ C;  3LZ1 D;  1P3I B;  4H9P B;  4Z66 D;  3C1B D;  5GXQ C;  5AVB A;  4QLC D;  4YS3 C;  3AZM B;  1B67 A;  3UTA C;  3EPK A;  3WKJ B;  5B40 B;  3W97 B;  3MVD C;  3NQJ A;  2G5H C;  3VH6 W;  3TU4 C;  2CV5 D;  3UT9 B;  2BYK B;  3WAA D;  5B1L B;  5JRG C;  4UUZ B;  5B33 B;  3B6G B;  3AZL A;  2YFW B;  1BH8 B;  3MGQ B;  3NQU A;  5AV5 C;  2G5I C;  3AN2 C;  1P3K A;  3A1I A;  4YM6 B;  4E45 A;  1P3I D;  4J8V C;  5KDM A;  3MNN A;  3X1V A;  2JE5 A;  3MGS B;  3AZM D;  2J8P A;  1Q9C A;  1P3P A;  5CPJ C;  3WKJ D;  5B40 D;  3W97 D;  5BNX A;  3UT9 D;  5B1L D;  5B2J B;  1M18 C;  4EO5 B;  5B33 D;  3KXB B;  3MGP B;  4WU9 A;  1EQZ A;  3B6G D;  3LZ1 C;  3WTP A;  4M6B A;  5B24 C;  5CP6 A;  3MGQ D;  1U35 B;  4Z66 C;  1U35 A;  3AFA A;  3C1B C;  4QLC C;  4YM6 D;  5AV9 C;  3VH6 A;  4J8U A;  1P3O C;  3REK A;  3WAA C;  1TAF A;  3MGS D;  5AV8 C;  3REI A;  4WNN B;  5BT1 D;  3IP4 C;  3X1S B;  2ZY3 A;  4ZUX B;  5B1M B;  5B31 B;  5B2J D;  3AZE C;  2Y2L A;  4HGA B;  5GT3 B;  3KXB D;  3MGP D;  5CHL B;  4J8W B;  1M1A A;  1P3A A;  1U35 D;  3X1T B;  3LEL B;  3AL0 C;  2F8N B;  3X1T A;  5BS7 A;  1HTA A;  2NZD B;  3AZM C;  2Y2J A;  2F2A C;  3W97 C;  3KUY B;  3REL A;  2Y2H A;  3B0C T;  3AZL C;  4XZQ B;  1M19 B;  3X1S D;  4ZUX D;  3AV1 A;  1P3L B;  5B1M D;  5B31 D;  3MGQ C;  1P3K C;  3W96 B;  5GT3 D;  4YS3 A;  4J8W D;  3W96 A;  3UTA A;  4ZBJ B;  3MNN C;  5BNV A;  3X1T D;  5F99 A;  3X1V C;  3MVD A;  3LEL D;  3EPJ A;  4X23 A;  2F8N D;  3REJ B;  3MGS C;  5JRG A;  2NZD D;  4WU8 B;  5BO0 B;  5BT1 C;  5B2I B;  3B0C W;  3KUY D;  1JFI A;  5B2J C;  3C1C B;  2Y2O A;  5DNN B;  4WU9 C;  1EQZ C;  3WA9 B;  3WTP C;  3AN2 A;  4JJN A;  4EO5 C;  4XZQ D;  3KXB C;  3MGP C;  5G49 A;  1M19 D;  2HIO A;  3W98 B;  1P3L D;  1U35 C;  1W2E A;  3V9R B;  2W8S A;  3W96 D;  2NQB D;  2DQN C;  4NE5 A;  4XUJ B;  3V9R A;  3KSY A;  5CPJ A;  1P3G A;  2IO5 B;  3REH B;  4CSR B;  1H3O B;  3REJ D;  4WU8 D;  2HUE B;  5B2I D;  3LZ1 A;  3X1S C;  5B1M C;  3C1C D;  5DNN D;  4AWL B;  1M1A C;  1KU5 A;  3WA9 D;  4Z66 A;  3AZJ B;  1P3A C;  4HGA C;  3C1B A;  3W98 D;  4QLC A;  4J8W C;  2PYO B;  3WTP E;  3X1T C;  3LEL C;  1N1J A;  4CAY A;  2CV5 A;  5AY8 B;  3WAA A;  4XUJ D;  2NZD C;  1P34 B;  5GSU B;  1KX4 B;  1KX3 B;  3REH D;  5JA4 B;  2ZY4 A;  3AZG B;  1HQ3 B; 
#chains in the Genus database with same CATH homology
 3AV1 C;  4XZQ C;  1P3L C;  2Y2G A;  3AZN B;  4NE6 A;  1P3I A;  2ZY2 A;  3H0M C;  4H9P A;  3W96 C;  3AZJ D;  5F99 C;  3AZM A;  2PYO D;  1WWS A;  5B32 G;  4X23 C;  3WKJ A;  5B40 A;  2YFV B;  3W97 A;  3P5J B;  5AY8 D;  2BYK A;  3REJ C;  5B1L A;  3UT9 A;  4UUZ A;  1P34 D;  4WJ3 C;  4KUD B;  4WV4 B;  5GSU D;  5B0Y B;  5CPK B;  1KX4 D;  1KX3 D;  5B33 A;  1F66 B;  3B6G A;  5B2I C;  5B0Y A;  2YFW A;  1BH8 A;  3MGQ A;  4JJN C;  3AZG D;  3C1C C;  5DNN C;  2HIO C;  3WA9 C;  1HQ3 D;  4G92 B;  3W98 C;  5C3I B;  4YM6 A;  2XD1 A;  3AZN D;  2ARO B;  3R45 B;  1P3G C;  4XUJ C;  3MGS A;  1Z2C B;  2IO5 C;  4H9R B;  5B2J A;  4H9N B;  2F8N K;  4KUD D;  5AV6 B;  5B0Y D;  5CPK D;  1F66 D;  3KXB A;  3MGP A;  3AYW B;  2HUE C;  1A7W A;  1P3B B;  3AZJ C;  3AZI B;  4G91 C;  1ID3 B;  1P3B A;  3X1U B;  2FJ7 B;  2CV5 C;  2ARO D;  3EG5 B;  4KHA B;  5AY8 C;  1P34 C;  4DQY B;  5GSU C;  4WNN A;  1KX3 C;  3X1S A;  4ZUX A;  2LY8 A;  5B1M A;  5B31 A;  3AZG C;  1HQ3 C;  5AV6 D;  1P3I C;  5GT3 A;  1ZLA B;  3AYW D;  4J8W A;  5DNM B;  3AZN C;  1BH9 B;  3LEL A;  1AOI B;  1P3B D;  3WKJ C;  3AZI D;  2F8N A;  5B40 C;  2NZD A;  1ID3 D;  3X1U D;  2FJ7 D;  3UT9 C;  5E5A B;  5B1L C;  3KUY A;  5B33 C;  3B6G C;  4KUD C;  5B0Y C;  4XZQ A;  1M19 A;  4UPK A;  5FUG B;  1P3L A;  2NQB B;  4Z5T B;  4YM6 C;  2NQB A;  1ZLA D;  5B0Z B;  2CWE A;  5DNM D;  1TZY B;  1PZR A;  3AZH B;  4J8X B;  2ARO C;  3B0B A;  1AOI D;  2RIQ A;  4WZS B;  2BYM B;  3LJA B;  3H0L C;  3REJ A;  2ZY5 A;  4WU8 A;  5BO0 A;  5E5A D;  3MGR B;  3KWQ B;  5B2I A;  4R8P B;  3C1C A;  5DNN A;  3WA9 A;  5AV6 C;  5GXQ B;  3W98 A;  3AYW C;  4DRA A;  5B32 B;  2Y2N A;  4Z5T D;  1P3B C;  3EPH A;  5B32 A;  3AZI C;  3TU4 B;  1R4V A;  4XUJ A;  5B0Z D;  3AZK B;  1P3F B;  3X1U C;  1TZY D;  3AZH D;  1BFM A;  1ULY A;  4J8X D;  3O62 B;  3REH A;  4CSR A;  3LJA D;  3AV2 B;  1H3O A;  1KX5 B;  3O62 A;  5AV5 B;  4ZUX C;  1S32 B;  5B31 C;  3MGR D;  3KWQ D;  3FDD A;  4R8P D;  2ZM5 A;  5GT3 C;  4J8V B;  1B6W A;  3VH5 T;  3AZJ A;  5GXQ D;  4H9O B;  2PYO A;  5B32 D;  3B6F B;  3KFU G;  3TU4 D;  3W99 B;  5AY8 A;  3AZK D;  1P3F D;  1P34 A;  1F1E A;  3KUY C;  1M18 B;  5GSU A;  1KX4 A;  4LD9 B;  1KX3 A;  4NE3 A;  3O62 D;  5CPI B;  5JA4 A;  5B24 B;  3AV2 D;  3AZG A;  1M19 C;  1KX5 D;  1HQ3 A;  5AV5 D;  1S32 D;  3VH5 W;  3A6N B;  5AV9 B;  4J8V D;  3AZN A;  2NQB C;  5AVC B;  4ZBJ C;  1P3O B;  5GT0 B;  5AV8 B;  5AVC A;  1TZY C;  3B6F D;  2YFV A;  4J8X C;  2RVQ D;  3LJA C;  3W99 D;  4WU8 C;  3AZE B;  2UWX A;  4KUD A;  1M18 D;  5CPK A;  4LD9 D;  1F66 A;  3MGR C;  5CPI D;  5B24 D;  4R8P C;  2VQR A;  5AVB B;  3F6T A;  1T3U A;  3NQJ B;  2DF4 C;  5B32 C;  3A6N D;  5AV9 D;  2ARO A;  3R45 A;  5AVC D;  1P3O D;  5GT0 D;  5AV8 D;  3AZK C;  1P3F C;  3REH C;  3AZL B;  2Y2M A;  3NQU B;  3O62 C;  2Y2P A;  3AV2 C;  4H9R A;  1P3K B;  3B0D B;  3AZE D;  1KX5 C;  4H9N A;  5AV6 A;  3VH5 A;  1S32 C;  2Y2K A;  5KDM B;  3AYW A;  4AWL C;  3MNN B;  3X1V B;  5AVB D;  2PYO C;  1P3P B;  4E44 A;  3AZI A;  1ID3 A;  5BNX B;  3X1U A;  2FJ7 A;  3B6F C;  2RVQ C;  3AZF B;  3W99 C;  4KHA A;  1KX4 C;  4WU9 B;  1EQZ B;  3AZF A;  2BG1 A;  3WTP B;  3LZ0 B;  3AZL D;  5CP6 B;  4LD9 C;  5CPI C;  2JSS A;  3LZ0 A;  1P3K D;  3AFA B;  1ZLA A;  4J8U B;  2FFF B;  5DNM A;  3MNN D;  3A6N C;  3REK B;  3X1V D;  1BH9 A;  1TAF B;  3REI B;  1AOI A;  5AVC C;  1P3P D;  2Y2I A;  5GT0 C;  5E5A A;  3AZF D;  4KGC B;  5CPK C;  1F66 C;  4WU9 D;  1EQZ D;  1M1A B;  3WTP D;  3LZ0 D;  1P3A B;  5CP6 D;  4KGC A;  4G92 C;  5FUG A;  3AFA D;  3UTB B;  5AVB C;  4Z5T A;  4H9S A;  5C3I C;  3UTB A;  2F8N H;  4H9Q B;  5B0Z A;  4J8U D;  1TZY A;  4Z2M H;  3REL B;  3EPL A;  3REK D;  4J8X A;  3REI D;  3AZH A;  4H9Q A;  2BYM A;  3LJA A;  1P3M B;  4DRB A;  1P3M A;  3AV1 B;  3MGR A;  3KWQ A;  2L5A A;  4KGC D;  4R8P A;  3B0D C;  1WWI A;  4YS3 B;  1M1A D;  1P3A D;  3UTA B;  5BNV B;  5GXQ A;  5F99 B;  3MVD B;  4X23 B;  3UTB D;  5JRG B;  1ID3 C;  2FJ7 C;  1P3P C;  3TU4 A;  3AZK A;  1P3F A;  3REL D;  1JFI B;  3AZF C;  1P3M D;  3AN2 B;  4JJN B;  2XD5 A;  3AV2 A;  1KX5 A;  5G49 B;  2HIO B;  5AV5 A;  3LZ0 C;  3AV1 D;  5CP6 C;  1S32 A;  4NFT A;  5B31 G;  2Y2Q A;  3AFA C;  4J8V A;  1ZLA C;  4YS3 D;  5DNM C;  3UTA D;  5CPJ B;  1P3G B;  5F99 D;  3MVD D;  4H9O A;  1AOI C;  4J8U C;  3B6F A;  4X23 D;  2F8N G;  3REK C;  3REI C;  5JRG D;  4Z2M G;  3W99 A;  5E5A C;  3LZ1 B;  1M18 A;  3H0R C;  4LD9 A;  5CPI A;  4Z66 B;  4JJN D;  5B24 A;  3AN2 D;  3C1B B;  4KGC C;  4QLC B;  2HIO D;  4G91 B;  4Z5T C;  4H9S C;  1N1J B;  3UTB C;  3A6N A;  4CAY B;  5AV9 A;  2CV5 B;  5BS7 C;  3WAA B;  5B0Z C;  5CPJ D;  3AZH C;  1P3O A;  3VH6 T;  5GT0 A;  1P3G D;  5AV8 A;  3REL C;  2JCH A;  1P3M C;  3A1K A;  3AZE A;  3KWQ C;  3LZ1 D;  1P3I B;  4H9P B;  4Z66 D;  3C1B D;  5GXQ C;  5AVB A;  4QLC D;  4YS3 C;  3AZM B;  1B67 A;  3UTA C;  3EPK A;  3WKJ B;  5B40 B;  3W97 B;  3MVD C;  3NQJ A;  2G5H C;  3VH6 W;  3TU4 C;  2CV5 D;  3UT9 B;  2BYK B;  3WAA D;  5B1L B;  5JRG C;  4UUZ B;  5B33 B;  3B6G B;  3AZL A;  2YFW B;  1BH8 B;  3MGQ B;  3NQU A;  5AV5 C;  2G5I C;  3AN2 C;  1P3K A;  3A1I A;  4YM6 B;  4E45 A;  1P3I D;  4J8V C;  5KDM A;  3MNN A;  3X1V A;  2JE5 A;  3MGS B;  3AZM D;  2J8P A;  1Q9C A;  1P3P A;  5CPJ C;  3WKJ D;  5B40 D;  3W97 D;  5BNX A;  3UT9 D;  5B1L D;  5B2J B;  1M18 C;  4EO5 B;  5B33 D;  3KXB B;  3MGP B;  4WU9 A;  1EQZ A;  3B6G D;  3LZ1 C;  3WTP A;  4M6B A;  5B24 C;  5CP6 A;  3MGQ D;  1U35 B;  4Z66 C;  1U35 A;  3AFA A;  3C1B C;  4QLC C;  4YM6 D;  5AV9 C;  3VH6 A;  4J8U A;  1P3O C;  3REK A;  3WAA C;  1TAF A;  3MGS D;  5AV8 C;  3REI A;  4WNN B;  5BT1 D;  3IP4 C;  3X1S B;  2ZY3 A;  4ZUX B;  5B1M B;  5B31 B;  5B2J D;  3AZE C;  2Y2L A;  4HGA B;  5GT3 B;  3KXB D;  3MGP D;  5CHL B;  4J8W B;  1M1A A;  1P3A A;  1U35 D;  3X1T B;  3LEL B;  3AL0 C;  2F8N B;  3X1T A;  5BS7 A;  1HTA A;  2NZD B;  3AZM C;  2Y2J A;  2F2A C;  3W97 C;  3KUY B;  3REL A;  2Y2H A;  3B0C T;  3AZL C;  4XZQ B;  1M19 B;  3X1S D;  4ZUX D;  3AV1 A;  1P3L B;  5B1M D;  5B31 D;  3MGQ C;  1P3K C;  3W96 B;  5GT3 D;  4YS3 A;  4J8W D;  3W96 A;  3UTA A;  4ZBJ B;  3MNN C;  5BNV A;  3X1T D;  5F99 A;  3X1V C;  3MVD A;  3LEL D;  3EPJ A;  4X23 A;  2F8N D;  3REJ B;  3MGS C;  5JRG A;  2NZD D;  4WU8 B;  5BO0 B;  5BT1 C;  5B2I B;  3B0C W;  3KUY D;  1JFI A;  5B2J C;  3C1C B;  2Y2O A;  5DNN B;  4WU9 C;  1EQZ C;  3WA9 B;  3WTP C;  3AN2 A;  4JJN A;  4EO5 C;  4XZQ D;  3KXB C;  3MGP C;  5G49 A;  1M19 D;  2HIO A;  3W98 B;  1P3L D;  1U35 C;  1W2E A;  3V9R B;  2W8S A;  3W96 D;  2NQB D;  2DQN C;  4NE5 A;  4XUJ B;  3V9R A;  3KSY A;  5CPJ A;  1P3G A;  2IO5 B;  3REH B;  4CSR B;  1H3O B;  3REJ D;  4WU8 D;  2HUE B;  5B2I D;  3LZ1 A;  3X1S C;  5B1M C;  3C1C D;  5DNN D;  4AWL B;  1M1A C;  1KU5 A;  3WA9 D;  4Z66 A;  3AZJ B;  1P3A C;  4HGA C;  3C1B A;  3W98 D;  4QLC A;  4J8W C;  2PYO B;  3WTP E;  3X1T C;  3LEL C;  1N1J A;  4CAY A;  2CV5 A;  5AY8 B;  3WAA A;  4XUJ D;  2NZD C;  1P34 B;  5GSU B;  1KX4 B;  1KX3 B;  3REH D;  5JA4 B;  2ZY4 A;  3AZG B;  1HQ3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...