1P3KA

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
97
structure length
97
Chain Sequence
HRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVAIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 33
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2003-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3kA00
5AVBB 4R8PA 4LD9B 5KDMA 4Z66C 3MGQC 5GXQC 1S32D 2NZDD 4ZUXB 3AZHC 3W97D 3UT9A 1TZYD 4H9RB 5B1LA 3C1BA 4WNNA 2PYOD 3KWQC 4CSRA 1P3MD 1P34A 3X1VD 1P3KA 1TAFA 5CPKD 1R4VA 1HQ3C 3O62D 3UTAC 1P3GB 2FJ7D 4H9OA 1P3LD 5B24A 4WU8B 5AV9C 3A6NB 1KX3C 3AZGB 3LZ0A 5B1MB 4DRAA 3AZKC 2CV5D 1P3FD 1AOIC 1BH8A 1F1EA 4ZUXC 2HIOD 1KX5B 4YM6B 4ZBJC 3AZLA 4H9PA 5AV6D 5E5AC 5B0ZC 4EO5B 4H9QA 5DNNB 3X1SB 3WTPD 3AZED 3KXBB 5B33B 4KGCB 5B31A 5F99C 3WAAA 3REJA 4CAYA 1U35D 5BNVA 3MGRC 4YS3A 3LELD 3A6NC 4X23B 3AZFD 3AFAA 5DNMC 1M1AD 3RELD 1P3IA 1S32B 2NZDB 3WTPE 5B32A 5B2JA 4YM6C 3REKA 1ID3D 3W97B 1TZYB 3X1UC 3MGSD 2PYOB 1BH9A 5B40D 5GT3A 4XUJA 1P3MB 4Z5TD 1M19A 1F66D 3W99A 3X1VB 5BT1C 3KXBC 1P3PD 1M18C 5CPKB 3WA9D 5AY8C 4QLCC 3O62B 3AZMA 5GSUA 3C1CC 2FJ7B 5BS7C 3REID 1P3LB 4X23C 5JRGC 3WKJA 2CV5B 1P3FB 1JFIA 2NZDC 5GT0D 1B6WA 3UTBA 4J8XC 4HGAC 3AZNA 5AV6B 1P3BD 1P3AC 3AYWA 3WTPB 5B2IC 3LZ1D 3AZEB 4E44A 5CPJD 2AROC 3AN2C 4E45A 3TU4D 1KX4D 2RVQC 1U35B 1P3OA 2FJ7C 3LELB 4JJNC 4XZQD 3AZFB 1M1AB 3RELB 3KUYC 2F8NH 2HIOC 5JA4B 2BYKB 1ID3B 1ZLAC 4J8WB 3B6FA 3MGSB 5B40B 5AV8A 3MNND 1P3GD 4Z5TB 1F66B 3MVDD 3REHC 3B6GD 4KUDD 3LJAD 5B0YC 1P3PB 3MGQA 4Z66A 5GXQA 3AV2D 5CPID 3WA9B 3AZHA 3AZID 1U35C 1EQZC 4KHAB 4WZSB 2BYMA 3REIB 3AZFC 3KWQA 5GT0B 1N1JB 2CWEA 5B1LD 1HQ3A 5FUGA 1P3BB 3MGSC 5CP6C 5AV9A 4J8UA 1KX3A 1P3KD 4Z5TC 1B67A 3AZKA 3LZ1B 1AOIA 3W96C 5CPJB 4H9NB 5BO0B 3WA9C 3NQUB 4ZUXA 3TU4B 5B24D 1KX4B 2NQBC 5AV5A 3LZ0D 3REIC 3VH6W 5E5AA 4WV4B 4XZQB 5B0ZA 1WWSA 3AZLD 4G91B 5F99A 1P3BC 3VH5W 3MGRA 3A6NA 3MNNB 2IO5C 5DNMA 2YFWA 3MVDB 3AV1B 3B6GB 4KUDB 3LJAB 3WAAD 2YFVB 3AV2B 5CPIB 2HUEC 4YS3D 1H3OB 3MGPD 3AZIB 5AVBC 4LD9C 1KU5A 1BFMA 4XZQC 3X1UA 1P3ID 4R8PB 5KDMB 5B32D 5B2JD 4H9SC 3UT9B 1WWIA 3C1BB 5B1LB 1M18A 5AY8A 4QLCA 4WNNB 3W98A 3C1CA 5GT3D 1P34B 4XUJD 5BS7A 3R45A 4X23A 1P3GC 1P3KB 5JRGA 1TAFB 5AVCA 4DRBA 4WU8C 5CPIC 3VH6T 5GSUD 3AZGC 3AV2C 4H9OB 4NE3A 5B1MC 4J8XA 5B24B 3LZ0B 4Z2MH 3WKJD 1P3AA 1KX5C 1BH8B 3AZJD 3UTBD 5BNXA 4J8WD 4EO5C 5B2IA 3AZLB 4H9PB 3VH5T 1HTAA 5DNNC 3AZND 2AROA 3AN2A 3X1SC 3AYWD 4H9QB 2FJ7A 5B33C 4KGCC 3VH5A 4JJNA 4M6BA 4WU9D 3WAAB 3KUYA 2JSSA 4CAYB 1P3OD 2HIOA 5BNVB 4YS3B 3MGPB 4J8VA 1S32C 3AFAB 2L5AA 1ZLAA 1P3IB 2F8NA 3W97C 5G49A 1TZYC 5B32B 5B2JB 3REHA 5B0YA 2PYOC 1P3MC 3B6FD 3X1VC 1EQZA 1BH9B 5GT3B 4XUJB 5CPKC 3O62C 3MGQD 5GXQD 3AZHD 3AZMB 1P3LC 5GSUB 2CV5C 3MGPC 1P3FC 3NQJB 3KWQD 3WKJB 1JFIB 5CP6A 3AZJB 3UTBB 4Z5TA 5AV6C 4G92B 3X1TD 1HQ3D 3W96A 3AZNB 3WTPC 3AV1D 3AYWB 3AZEC 2NQBA 4J8UD 1KX3D 3AZKD 1AOID 4WU9B 3LELC 5C3IB 1ULYA 5GSUC 1P3OB 4R8PD 1M1AC 3RELC 5AV5D 5E5AD 5B0ZD 3UT9D 3C1BD 1ID3C 3AZJC 3V9RB 4G92C 3UTAA 4J8WC 5B31G 1P34D 5F99D 3AZNC 4H9NA 5B40C 3NQUA 1F66C 3B6FB 3MGRD 3AYWC 5AVBA 1P3PC 4LD9A 5DNMD 4NFTA 4WU9C 3MGQB 4Z66B 5GXQB 4H9RA 5B32G 3AZHB 5C3IC 3B0BA 5CHLB 2BYMB 4AWLB 3X1UD 5GT0C 3KWQB 5BT1D 1P3GA 1M18D 3X1TB 5AY8D 4QLCD 1HQ3B 4WU8A 2YFVA 4UUZB 5FUGB 3AZGA 3AV2A 3C1CD 3W98D 5B1MA 5B31D 3LZ1C 5AV9B 4J8UB 5CPJC 1KX3B 3REJD 3TU4C 5AVCD 3AZKB 1AOIB 1KX4C 4YM6A 1KX5A 3AFAD 2F8NG 4J8XD 4ZBJB 5DNNA 3X1SA 5AV5B 4AWLC 5E5AB 1P3AD 5B0ZB 4G91C 3REKD 3KSYA 3KXBA 5B33A 4KGCA 5B2ID 2AROD 4CSRB 3AN2D 3X1TC 5F99B 1M19D 3W99D 3MNNC 2RVQD 3MVDC 3MGRB 3AV1C 3B6GC 3LJAC 4KUDC 4J8UC 4JJND 3AZMD 1S32A 2NZDA 5DNMB 2YFWB 3AZIC 3W97A 3KUYD 1TZYA 2LY8A 4J8VD 3VH6A 4R8PC 2PYOA 5AV5C 1P3MA 1ZLAD 3B0DB 3X1UB 2F8ND 3X1VA 3UT9C 3C1BC 5B1LC 5CPKA 3REHD 3O62A 5B0YD 1M18B 1P34C 5AY8B 4QLCB 1P3LA 3W98B 1P3KC 1EQZD 3C1CB 2CV5A 3MGPA 5B31B 1Q9CA 1P3FA 3R45B 3REJB 5JRGB 5AVCB 5B24C 4NE6A 3LZ0C 5AV6A 4J8XB 4HGAB 3B0DC 3WTPA 1P3AB 3AZLC 3AZEA 3REKB 5CP6D 5BNXB 5B2IB 1U35A 3W96D 2AROB 3AN2B 5AV8D 3LELA 1M19B 3W99B 3W98C 3AZFA 2NQBD 1M1AA 3RELA 4Z66D 5B31C 3WAAC 4JJNB 3REJC 3NQJA 5AVCC 4YS3C 5JA4A 2BYKA 4NE5A 1ID3A 3KUYB 3AFAC 3AZJA 2HIOB 4J8WA 3B0CW 1P3IC 3MGSA 4J8VB 5B40A 1ZLAB 5B32C 5B2JC 1F66A 2F8NB 3REKC 1P3PA 5G49B 3UTAD 3WA9A 3REHB 5B0YB 4WU9A 5AV9D 4KHAA 5GT3C 4XUJC 1M19C 3W99C 3REIA 5AVBD 1EQZB 4LD9D 4ZUXD 3AZMC 4Z2MG 5GT0A 1N1JA 3V9RA 3WKJC 1P3BA 4J8VC 2F8NK 3UTBC 3LZ1A 5CP6B 5CPJA 5BO0A 3TU4A 4WU8D 1KX4A 3A6ND 3W96B 3AZGD 5AV8B 5B1MD 4XZQA 2NQBB 1KX5D 4YM6D 3B0CT 1P3OC 4H9SA 5DNND 3X1SD 3X1TA 4UUZA 3MNNA 3KXBD 5B33D 3MVDA 3AV1A 3B6GA 4KUDA 3LJAA 4KGCD 3UTAB 2IO5B 5CPIA 3B6FC 1H3OA 3AZIA 4X23D 1A7WA 5AV8C 5JRGD 2HUEB
chains in the Genus database with same CATH superfamily
5AVBB 4R8PA 4LD9B 5KDMA 4Z66C 3MGQC 5GXQC 1S32D 2NZDD 4ZUXB 3AZHC 3W97D 3UT9A 1TZYD 4H9RB 5B1LA 3C1BA 4WNNA 2PYOD 3KWQC 4CSRA 1P3MD 1P34A 3X1VD 1P3KA 1TAFA 5CPKD 1R4VA 1HQ3C 3O62D 3UTAC 1P3GB 2FJ7D 4H9OA 1P3LD 5B24A 4WU8B 5AV9C 3A6NB 1KX3C 3AZGB 3LZ0A 5B1MB 4DRAA 3AZKC 2CV5D 1P3FD 1AOIC 1BH8A 1F1EA 4ZUXC 2HIOD 1KX5B 4YM6B 4ZBJC 3AZLA 4H9PA 4WJ3C 5AV6D 5E5AC 5B0ZC 4EO5B 4H9QA 5DNNB 3X1SB 3WTPD 3AZED 3KXBB 5B33B 4KGCB 5B31A 5F99C 3WAAA 3AL0C 3REJA 4CAYA 1U35D 5BNVA 3MGRC 4YS3A 3EPKA 3LELD 3A6NC 4X23B 3AZFD 3AFAA 5DNMC 1M1AD 3RELD 2RIQA 1P3IA 1S32B 2NZDB 3WTPE 5B32A 5B2JA 4YM6C 3REKA 1ID3D 3W97B 1TZYB 3X1UC 3MGSD 2PYOB 1BH9A 5B40D 5GT3A 4XUJA 1P3MB 4Z5TD 1M19A 1F66D 3W99A 2XD1A 3X1VB 5BT1C 3KXBC 2Y2HA 1P3PD 1M18C 5CPKB 3WA9D 5AY8C 4QLCC 3O62B 3AZMA 5GSUA 3C1CC 2FJ7B 5BS7C 3REID 1P3LB 4X23C 3F6TA 5JRGC 3WKJA 2CV5B 1P3FB 1JFIA 2NZDC 5GT0D 1B6WA 2Y2NA 1PZRA 3UTBA 4J8XC 2ZY4A 4HGAC 3AZNA 5AV6B 1P3BD 1P3AC 3AYWA 3WTPB 5B2IC 3LZ1D 3AZEB 4E44A 5CPJD 2AROC 3AN2C 4E45A 3TU4D 1KX4D 2RVQC 1U35B 1P3OA 2FJ7C 3LELB 4JJNC 4XZQD 3AZFB 2Y2QA 1M1AB 3RELB 3KUYC 2F8NH 2HIOC 5JA4B 2BYKB 1ID3B 1ZLAC 4J8WB 3B6FA 3MGSB 5B40B 5AV8A 3MNND 1P3GD 4Z5TB 1F66B 3MVDD 3REHC 2F2AC 3B6GD 3LJAD 4KUDD 5B0YC 1P3PB 3MGQA 4Z66A 5GXQA 3AV2D 5CPID 3WA9B 3AZHA 4UPKA 3AZID 1U35C 1EQZC 4KHAB 4WZSB 2BYMA 3REIB 2J8PA 3AZFC 3KWQA 5GT0B 1N1JB 2CWEA 5B1LD 1HQ3A 5FUGA 1T3UA 1P3BB 3MGSC 3KFUG 5CP6C 5AV9A 4J8UA 1KX3A 1P3KD 4Z5TC 1B67A 3AZKA 3LZ1B 1AOIA 3W96C 5CPJB 4H9NB 5BO0B 3WA9C 2Y2GA 3NQUB 4ZUXA 3TU4B 5B24D 1KX4B 2NQBC 5AV5A 3LZ0D 3REIC 3VH6W 5E5AA 4WV4B 4XZQB 5B0ZA 3H0RC 1WWSA 3AZLD 4G91B 5F99A 1P3BC 1W2EA 3VH5W 3MGRA 3A6NA 3MNNB 2IO5C 5DNMA 2YFWA 3MVDB 3AV1B 3B6GB 4KUDB 3LJAB 3WAAD 2YFVB 3AV2B 5CPIB 2HUEC 4YS3D 1H3OB 3MGPD 3AZIB 5AVBC 4LD9C 1KU5A 1BFMA 4XZQC 3X1UA 1P3ID 3A1IA 4R8PB 5KDMB 5B32D 5B2JD 2G5HC 4H9SC 3UT9B 1WWIA 3C1BB 5B1LB 1M18A 5AY8A 4QLCA 4WNNB 3W98A 3C1CA 5GT3D 1P34B 4XUJD 5BS7A 3R45A 4X23A 1P3GC 1P3KB 5JRGA 1TAFB 5AVCA 4DRBA 4WU8C 5CPIC 3VH6T 5GSUD 3AZGC 3AV2C 4H9OB 4NE3A 5B1MC 4J8XA 5B24B 3LZ0B 4Z2MH 3WKJD 1P3AA 1KX5C 1BH8B 3AZJD 3UTBD 5BNXA 4J8WD 4EO5C 5B2IA 3AZLB 4H9PB 3VH5T 1HTAA 5DNNC 3AZND 2AROA 3AN2A 3X1SC 3AYWD 4H9QB 3A1KA 2FJ7A 3P5JB 5B33C 4KGCC 3VH5A 2DQNC 4JJNA 4M6BA 4WU9D 3WAAB 3KUYA 2JSSA 4CAYB 1P3OD 2HIOA 5BNVB 4YS3B 3MGPB 4J8VA 3H0LC 1S32C 3AFAB 2L5AA 1ZLAA 2G5IC 1P3IB 2F8NA 3W97C 5G49A 1TZYC 5B32B 5B2JB 3REHA 5B0YA 2PYOC 1P3MC 3B6FD 2ZY2A 3X1VC 1EQZA 1BH9B 5GT3B 4XUJB 5CPKC 3O62C 2ZY3A 2W8SA 3MGQD 5GXQD 3AZHD 3AZMB 1P3LC 5GSUB 2CV5C 3MGPC 1P3FC 3NQJB 3KWQD 3WKJB 2FFFB 1JFIB 5CP6A 3AZJB 3UTBB 4Z5TA 5AV6C 4G92B 3X1TD 2ZM5A 1HQ3D 3W96A 3AZNB 3WTPC 3AV1D 3AYWB 3AZEC 2NQBA 4J8UD 2VQRA 1KX3D 3EPLA 3AZKD 1AOID 4WU9B 4DQYB 3LELC 5C3IB 1ULYA 2DF4C 5GSUC 2Y2OA 4R8PD 1P3OB 3RELC 5AV5D 1M1AC 5E5AD 5B0ZD 3UT9D 3C1BD 2Y2JA 1ID3C 3AZJC 3V9RB 4G92C 3UTAA 4J8WC 5B31G 2BG1A 1P34D 5F99D 3AZNC 2Y2LA 4H9NA 5B40C 3NQUA 1F66C 3B6FB 3MGRD 3AYWC 5AVBA 1P3PC 4LD9A 5DNMD 4NFTA 4WU9C 2ZY5A 3MGQB 4Z66B 5GXQB 4H9RA 5B32G 3AZHB 5C3IC 3B0BA 5CHLB 2BYMB 4AWLB 3X1UD 5GT0C 3KWQB 5BT1D 1P3GA 1M18D 3X1TB 5AY8D 4QLCD 1HQ3B 2JE5A 4WU8A 2YFVA 4UUZB 5FUGB 2XD5A 3AZGA 3C1CD 3AV2A 3IP4C 3W98D 5B1MA 5B31D 3LZ1C 5AV9B 4J8UB 5CPJC 1KX3B 1Z2CB 3REJD 3TU4C 5AVCD 3AZKB 1AOIB 1KX4C 4YM6A 1KX5A 3AFAD 2F8NG 4J8XD 4ZBJB 5DNNA 3X1SA 5AV5B 4AWLC 5E5AB 1P3AD 5B0ZB 4G91C 3REKD 3KSYA 3KXBA 5B33A 4KGCA 5B2ID 2AROD 4CSRB 3AN2D 3X1TC 5F99B 1M19D 3W99D 3MNNC 2RVQD 3MVDC 3MGRB 2Y2IA 3AV1C 3LJAC 3B6GC 4KUDC 4J8UC 4JJND 3AZMD 1S32A 2NZDA 5DNMB 2YFWB 3EPHA 3AZIC 3W97A 3KUYD 1TZYA 2LY8A 4J8VD 3VH6A 4R8PC 2PYOA 5AV5C 1P3MA 1ZLAD 3B0DB 3X1UB 2F8ND 3X1VA 3UT9C 3C1BC 5B1LC 5CPKA 3REHD 3O62A 5B0YD 1M18B 1P34C 2Y2PA 5AY8B 4QLCB 1P3LA 3W98B 1P3KC 1EQZD 3C1CB 2CV5A 3MGPA 5B31B 1Q9CA 1P3FA 3R45B 3REJB 5JRGB 5AVCB 5B24C 4NE6A 3LZ0C 5AV6A 4J8XB 4HGAB 3B0DC 3WTPA 3EG5B 1P3AB 3AZLC 3AZEA 3REKB 5CP6D 5BNXB 5B2IB 1U35A 3W96D 2AROB 3AN2B 5AV8D 3LELA 1M19B 3W99B 3W98C 2Y2KA 3AZFA 2NQBD 1M1AA 3RELA 4Z66D 5B31C 3WAAC 4JJNB 3REJC 3NQJA 5AVCC 4YS3C 5JA4A 2BYKA 4NE5A 1ID3A 3KUYB 3AFAC 3EPJA 3AZJA 2HIOB 4J8WA 3B0CW 1P3IC 3MGSA 4J8VB 5B40A 1ZLAB 5B32C 5B2JC 1F66A 2F8NB 3REKC 1P3PA 5G49B 3UTAD 3WA9A 3REHB 5B0YB 4WU9A 5GT3C 4KHAA 5AV9D 4XUJC 1M19C 3W99C 3REIA 5AVBD 1EQZB 4LD9D 4ZUXD 3AZMC 4Z2MG 5GT0A 1N1JA 3V9RA 3WKJC 1P3BA 4J8VC 2F8NK 3UTBC 3LZ1A 5CP6B 5CPJA 5BO0A 3TU4A 3FDDA 4WU8D 1KX4A 3A6ND 3W96B 3AZGD 2UWXA 5AV8B 5B1MD 4XZQA 2NQBB 2JCHA 1KX5D 4YM6D 3B0CT 1P3OC 4H9SA 5DNND 3X1SD 3X1TA 4UUZA 3MNNA 3KXBD 2Y2MA 5B33D 3MVDA 3AV1A 3B6GA 4KUDA 3LJAA 4KGCD 3UTAB 2IO5B 5CPIA 3B6FC 1H3OA 3H0MC 3AZIA 4X23D 1A7WA 5AV8C 5JRGD 2HUEB
chains in the Genus database with same CATH topology
5AVBB 4R8PA 4LD9B 5KDMA 4Z66C 3MGQC 5GXQC 1S32D 2NZDD 4ZUXB 3AZHC 3W97D 3UT9A 1TZYD 4H9RB 5B1LA 3C1BA 4WNNA 2PYOD 3KWQC 4CSRA 1P3MD 1P34A 3X1VD 1P3KA 1TAFA 5CPKD 1R4VA 1HQ3C 3O62D 3UTAC 1P3GB 2FJ7D 4H9OA 1P3LD 5B24A 4WU8B 5AV9C 3A6NB 1KX3C 3AZGB 3LZ0A 5B1MB 4DRAA 3AZKC 2CV5D 1P3FD 1AOIC 1BH8A 1F1EA 4ZUXC 2HIOD 1KX5B 4YM6B 4ZBJC 3AZLA 4H9PA 4WJ3C 5AV6D 5E5AC 5B0ZC 4EO5B 4H9QA 5DNNB 3X1SB 3WTPD 3AZED 3KXBB 5B33B 4KGCB 5B31A 5F99C 3WAAA 3AL0C 3REJA 4CAYA 1U35D 5BNVA 3MGRC 4YS3A 3EPKA 3LELD 3A6NC 4X23B 3AZFD 3AFAA 5DNMC 1M1AD 3RELD 2RIQA 1P3IA 1S32B 2NZDB 3WTPE 5B32A 5B2JA 4YM6C 3REKA 1ID3D 3W97B 1TZYB 3X1UC 3MGSD 2PYOB 1BH9A 5B40D 5GT3A 4XUJA 1P3MB 4Z5TD 1M19A 1F66D 3W99A 2XD1A 3X1VB 5BT1C 3KXBC 2Y2HA 1P3PD 1M18C 5CPKB 3WA9D 5AY8C 4QLCC 3O62B 3AZMA 5GSUA 3C1CC 2FJ7B 5BS7C 3REID 1P3LB 4X23C 3F6TA 5JRGC 3WKJA 2CV5B 1P3FB 1JFIA 2NZDC 5GT0D 1B6WA 2Y2NA 1PZRA 3UTBA 4J8XC 2ZY4A 4HGAC 3AZNA 5AV6B 1P3BD 1P3AC 3AYWA 3WTPB 5B2IC 3LZ1D 3AZEB 4E44A 5CPJD 2AROC 3AN2C 4E45A 3TU4D 1KX4D 2RVQC 1U35B 1P3OA 2FJ7C 3LELB 4JJNC 4XZQD 3AZFB 2Y2QA 1M1AB 3RELB 3KUYC 2F8NH 2HIOC 5JA4B 2BYKB 1ID3B 1ZLAC 4J8WB 3B6FA 3MGSB 5B40B 5AV8A 3MNND 1P3GD 4Z5TB 1F66B 3MVDD 3REHC 2F2AC 3B6GD 3LJAD 4KUDD 5B0YC 1P3PB 3MGQA 4Z66A 5GXQA 3AV2D 5CPID 3WA9B 3AZHA 4UPKA 3AZID 1U35C 1EQZC 4KHAB 4WZSB 2BYMA 3REIB 2J8PA 3AZFC 3KWQA 5GT0B 1N1JB 2CWEA 5B1LD 1HQ3A 5FUGA 1T3UA 1P3BB 3MGSC 3KFUG 5CP6C 5AV9A 4J8UA 1KX3A 1P3KD 4Z5TC 1B67A 3AZKA 3LZ1B 1AOIA 3W96C 5CPJB 4H9NB 5BO0B 3WA9C 2Y2GA 3NQUB 4ZUXA 3TU4B 5B24D 1KX4B 2NQBC 5AV5A 3LZ0D 3REIC 3VH6W 5E5AA 4WV4B 4XZQB 5B0ZA 3H0RC 1WWSA 3AZLD 4G91B 5F99A 1P3BC 1W2EA 3VH5W 3MGRA 3A6NA 3MNNB 2IO5C 5DNMA 2YFWA 3MVDB 3AV1B 3B6GB 4KUDB 3LJAB 3WAAD 2YFVB 3AV2B 5CPIB 2HUEC 4YS3D 1H3OB 3MGPD 3AZIB 5AVBC 4LD9C 1KU5A 1BFMA 4XZQC 3X1UA 1P3ID 3A1IA 4R8PB 5KDMB 5B32D 5B2JD 2G5HC 4H9SC 3UT9B 1WWIA 3C1BB 5B1LB 1M18A 5AY8A 4QLCA 4WNNB 3W98A 3C1CA 5GT3D 1P34B 4XUJD 5BS7A 3R45A 4X23A 1P3GC 1P3KB 5JRGA 1TAFB 5AVCA 4DRBA 4WU8C 5CPIC 3VH6T 5GSUD 3AZGC 3AV2C 4H9OB 4NE3A 5B1MC 4J8XA 5B24B 3LZ0B 4Z2MH 3WKJD 1P3AA 1KX5C 1BH8B 3AZJD 3UTBD 5BNXA 4J8WD 4EO5C 5B2IA 3AZLB 4H9PB 3VH5T 1HTAA 5DNNC 3AZND 2AROA 3AN2A 3X1SC 3AYWD 4H9QB 3A1KA 2FJ7A 3P5JB 5B33C 4KGCC 3VH5A 2DQNC 4JJNA 4M6BA 4WU9D 3WAAB 3KUYA 2JSSA 4CAYB 1P3OD 2HIOA 5BNVB 4YS3B 3MGPB 4J8VA 3H0LC 1S32C 3AFAB 2L5AA 1ZLAA 2G5IC 1P3IB 2F8NA 3W97C 5G49A 1TZYC 5B32B 5B2JB 3REHA 5B0YA 2PYOC 1P3MC 3B6FD 2ZY2A 3X1VC 1EQZA 1BH9B 5GT3B 4XUJB 5CPKC 3O62C 2ZY3A 2W8SA 3MGQD 5GXQD 3AZHD 3AZMB 1P3LC 5GSUB 2CV5C 3MGPC 1P3FC 3NQJB 3KWQD 3WKJB 2FFFB 1JFIB 5CP6A 3AZJB 3UTBB 4Z5TA 5AV6C 4G92B 3X1TD 2ZM5A 1HQ3D 3W96A 3AZNB 3WTPC 3AV1D 3AYWB 3AZEC 2NQBA 4J8UD 2VQRA 1KX3D 3EPLA 3AZKD 1AOID 4WU9B 4DQYB 3LELC 5C3IB 1ULYA 2DF4C 5GSUC 2Y2OA 4R8PD 1P3OB 3RELC 5AV5D 1M1AC 5E5AD 5B0ZD 3UT9D 3C1BD 2Y2JA 1ID3C 3AZJC 3V9RB 4G92C 3UTAA 4J8WC 5B31G 2BG1A 1P34D 5F99D 3AZNC 2Y2LA 4H9NA 5B40C 3NQUA 1F66C 3B6FB 3MGRD 3AYWC 5AVBA 1P3PC 4LD9A 5DNMD 4NFTA 4WU9C 2ZY5A 3MGQB 4Z66B 5GXQB 4H9RA 5B32G 3AZHB 5C3IC 3B0BA 5CHLB 2BYMB 4AWLB 3X1UD 5GT0C 3KWQB 5BT1D 1P3GA 1M18D 3X1TB 5AY8D 4QLCD 1HQ3B 2JE5A 4WU8A 2YFVA 4UUZB 5FUGB 2XD5A 3AZGA 3C1CD 3AV2A 3IP4C 3W98D 5B1MA 5B31D 3LZ1C 5AV9B 4J8UB 5CPJC 1KX3B 1Z2CB 3REJD 3TU4C 5AVCD 3AZKB 1AOIB 1KX4C 4YM6A 1KX5A 3AFAD 2F8NG 4J8XD 4ZBJB 5DNNA 3X1SA 5AV5B 4AWLC 5E5AB 1P3AD 5B0ZB 4G91C 3REKD 3KSYA 3KXBA 5B33A 4KGCA 5B2ID 2AROD 4CSRB 3AN2D 3X1TC 5F99B 1M19D 3W99D 3MNNC 2RVQD 3MVDC 3MGRB 2Y2IA 3AV1C 3LJAC 3B6GC 4KUDC 4J8UC 4JJND 3AZMD 1S32A 2NZDA 5DNMB 2YFWB 3EPHA 3AZIC 3W97A 3KUYD 1TZYA 2LY8A 4J8VD 3VH6A 4R8PC 2PYOA 5AV5C 1P3MA 1ZLAD 3B0DB 3X1UB 2F8ND 3X1VA 3UT9C 3C1BC 5B1LC 5CPKA 3REHD 3O62A 5B0YD 1M18B 1P34C 2Y2PA 5AY8B 4QLCB 1P3LA 3W98B 1P3KC 1EQZD 3C1CB 2CV5A 3MGPA 5B31B 1Q9CA 1P3FA 3R45B 3REJB 5JRGB 5AVCB 5B24C 4NE6A 3LZ0C 5AV6A 4J8XB 4HGAB 3B0DC 3WTPA 3EG5B 1P3AB 3AZLC 3AZEA 3REKB 5CP6D 5BNXB 5B2IB 1U35A 3W96D 2AROB 3AN2B 5AV8D 3LELA 1M19B 3W99B 3W98C 2Y2KA 3AZFA 2NQBD 1M1AA 3RELA 4Z66D 5B31C 3WAAC 4JJNB 3REJC 3NQJA 5AVCC 4YS3C 5JA4A 2BYKA 4NE5A 1ID3A 3KUYB 3AFAC 3EPJA 3AZJA 2HIOB 4J8WA 3B0CW 1P3IC 3MGSA 4J8VB 5B40A 1ZLAB 5B32C 5B2JC 1F66A 2F8NB 3REKC 1P3PA 5G49B 3UTAD 3WA9A 3REHB 5B0YB 4WU9A 5GT3C 4KHAA 5AV9D 4XUJC 1M19C 3W99C 3REIA 5AVBD 1EQZB 4LD9D 4ZUXD 3AZMC 4Z2MG 5GT0A 1N1JA 3V9RA 3WKJC 1P3BA 4J8VC 2F8NK 3UTBC 3LZ1A 5CP6B 5CPJA 5BO0A 3TU4A 3FDDA 4WU8D 1KX4A 3A6ND 3W96B 3AZGD 2UWXA 5AV8B 5B1MD 4XZQA 2NQBB 2JCHA 1KX5D 4YM6D 3B0CT 1P3OC 4H9SA 5DNND 3X1SD 3X1TA 4UUZA 3MNNA 3KXBD 2Y2MA 5B33D 3MVDA 3AV1A 3B6GA 4KUDA 3LJAA 4KGCD 3UTAB 2IO5B 5CPIA 3B6FC 1H3OA 3H0MC 3AZIA 4X23D 1A7WA 5AV8C 5JRGD 2HUEB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AVB B;  4R8P A;  4LD9 B;  5KDM A;  4Z66 C;  3MGQ C;  5GXQ C;  1S32 D;  2NZD D;  4ZUX B;  3AZH C;  3W97 D;  3UT9 A;  1TZY D;  4H9R B;  5B1L A;  3C1B A;  4WNN A;  2PYO D;  3KWQ C;  4CSR A;  1P3M D;  1P34 A;  3X1V D;  1P3K A;  1TAF A;  5CPK D;  1R4V A;  1HQ3 C;  3O62 D;  3UTA C;  1P3G B;  2FJ7 D;  4H9O A;  1P3L D;  5B24 A;  4WU8 B;  5AV9 C;  3A6N B;  1KX3 C;  3AZG B;  3LZ0 A;  5B1M B;  4DRA A;  3AZK C;  2CV5 D;  1P3F D;  1AOI C;  1BH8 A;  1F1E A;  4ZUX C;  2HIO D;  1KX5 B;  4YM6 B;  4ZBJ C;  3AZL A;  4H9P A;  5AV6 D;  5E5A C;  5B0Z C;  4EO5 B;  4H9Q A;  5DNN B;  3X1S B;  3WTP D;  3AZE D;  3KXB B;  5B33 B;  4KGC B;  5B31 A;  5F99 C;  3WAA A;  3REJ A;  4CAY A;  1U35 D;  5BNV A;  3MGR C;  4YS3 A;  3LEL D;  3A6N C;  4X23 B;  3AZF D;  3AFA A;  5DNM C;  1M1A D;  3REL D;  1P3I A;  1S32 B;  2NZD B;  3WTP E;  5B32 A;  5B2J A;  4YM6 C;  3REK A;  1ID3 D;  3W97 B;  1TZY B;  3X1U C;  3MGS D;  2PYO B;  1BH9 A;  5B40 D;  5GT3 A;  4XUJ A;  1P3M B;  4Z5T D;  1M19 A;  1F66 D;  3W99 A;  3X1V B;  5BT1 C;  3KXB C;  1P3P D;  1M18 C;  5CPK B;  3WA9 D;  5AY8 C;  4QLC C;  3O62 B;  3AZM A;  5GSU A;  3C1C C;  2FJ7 B;  5BS7 C;  3REI D;  1P3L B;  4X23 C;  5JRG C;  3WKJ A;  2CV5 B;  1P3F B;  1JFI A;  2NZD C;  5GT0 D;  1B6W A;  3UTB A;  4J8X C;  4HGA C;  3AZN A;  5AV6 B;  1P3B D;  1P3A C;  3AYW A;  3WTP B;  5B2I C;  3LZ1 D;  3AZE B;  4E44 A;  5CPJ D;  2ARO C;  3AN2 C;  4E45 A;  3TU4 D;  1KX4 D;  2RVQ C;  1U35 B;  1P3O A;  2FJ7 C;  3LEL B;  4JJN C;  4XZQ D;  3AZF B;  1M1A B;  3REL B;  3KUY C;  2F8N H;  2HIO C;  5JA4 B;  2BYK B;  1ID3 B;  1ZLA C;  4J8W B;  3B6F A;  3MGS B;  5B40 B;  5AV8 A;  3MNN D;  1P3G D;  4Z5T B;  1F66 B;  3MVD D;  3REH C;  3B6G D;  4KUD D;  3LJA D;  5B0Y C;  1P3P B;  3MGQ A;  4Z66 A;  5GXQ A;  3AV2 D;  5CPI D;  3WA9 B;  3AZH A;  3AZI D;  1U35 C;  1EQZ C;  4KHA B;  4WZS B;  2BYM A;  3REI B;  3AZF C;  3KWQ A;  5GT0 B;  1N1J B;  2CWE A;  5B1L D;  1HQ3 A;  5FUG A;  1P3B B;  3MGS C;  5CP6 C;  5AV9 A;  4J8U A;  1KX3 A;  1P3K D;  4Z5T C;  1B67 A;  3AZK A;  3LZ1 B;  1AOI A;  3W96 C;  5CPJ B;  4H9N B;  5BO0 B;  3WA9 C;  3NQU B;  4ZUX A;  3TU4 B;  5B24 D;  1KX4 B;  2NQB C;  5AV5 A;  3LZ0 D;  3REI C;  3VH6 W;  5E5A A;  4WV4 B;  4XZQ B;  5B0Z A;  1WWS A;  3AZL D;  4G91 B;  5F99 A;  1P3B C;  3VH5 W;  3MGR A;  3A6N A;  3MNN B;  2IO5 C;  5DNM A;  2YFW A;  3MVD B;  3AV1 B;  3B6G B;  4KUD B;  3LJA B;  3WAA D;  2YFV B;  3AV2 B;  5CPI B;  2HUE C;  4YS3 D;  1H3O B;  3MGP D;  3AZI B;  5AVB C;  4LD9 C;  1KU5 A;  1BFM A;  4XZQ C;  3X1U A;  1P3I D;  4R8P B;  5KDM B;  5B32 D;  5B2J D;  4H9S C;  3UT9 B;  1WWI A;  3C1B B;  5B1L B;  1M18 A;  5AY8 A;  4QLC A;  4WNN B;  3W98 A;  3C1C A;  5GT3 D;  1P34 B;  4XUJ D;  5BS7 A;  3R45 A;  4X23 A;  1P3G C;  1P3K B;  5JRG A;  1TAF B;  5AVC A;  4DRB A;  4WU8 C;  5CPI C;  3VH6 T;  5GSU D;  3AZG C;  3AV2 C;  4H9O B;  4NE3 A;  5B1M C;  4J8X A;  5B24 B;  3LZ0 B;  4Z2M H;  3WKJ D;  1P3A A;  1KX5 C;  1BH8 B;  3AZJ D;  3UTB D;  5BNX A;  4J8W D;  4EO5 C;  5B2I A;  3AZL B;  4H9P B;  3VH5 T;  1HTA A;  5DNN C;  3AZN D;  2ARO A;  3AN2 A;  3X1S C;  3AYW D;  4H9Q B;  2FJ7 A;  5B33 C;  4KGC C;  3VH5 A;  4JJN A;  4M6B A;  4WU9 D;  3WAA B;  3KUY A;  2JSS A;  4CAY B;  1P3O D;  2HIO A;  5BNV B;  4YS3 B;  3MGP B;  4J8V A;  1S32 C;  3AFA B;  2L5A A;  1ZLA A;  1P3I B;  2F8N A;  3W97 C;  5G49 A;  1TZY C;  5B32 B;  5B2J B;  3REH A;  5B0Y A;  2PYO C;  1P3M C;  3B6F D;  3X1V C;  1EQZ A;  1BH9 B;  5GT3 B;  4XUJ B;  5CPK C;  3O62 C;  3MGQ D;  5GXQ D;  3AZH D;  3AZM B;  1P3L C;  5GSU B;  2CV5 C;  3MGP C;  1P3F C;  3NQJ B;  3KWQ D;  3WKJ B;  1JFI B;  5CP6 A;  3AZJ B;  3UTB B;  4Z5T A;  5AV6 C;  4G92 B;  3X1T D;  1HQ3 D;  3W96 A;  3AZN B;  3WTP C;  3AV1 D;  3AYW B;  3AZE C;  2NQB A;  4J8U D;  1KX3 D;  3AZK D;  1AOI D;  4WU9 B;  3LEL C;  5C3I B;  1ULY A;  5GSU C;  1P3O B;  4R8P D;  1M1A C;  3REL C;  5AV5 D;  5E5A D;  5B0Z D;  3UT9 D;  3C1B D;  1ID3 C;  3AZJ C;  3V9R B;  4G92 C;  3UTA A;  4J8W C;  5B31 G;  1P34 D;  5F99 D;  3AZN C;  4H9N A;  5B40 C;  3NQU A;  1F66 C;  3B6F B;  3MGR D;  3AYW C;  5AVB A;  1P3P C;  4LD9 A;  5DNM D;  4NFT A;  4WU9 C;  3MGQ B;  4Z66 B;  5GXQ B;  4H9R A;  5B32 G;  3AZH B;  5C3I C;  3B0B A;  5CHL B;  2BYM B;  4AWL B;  3X1U D;  5GT0 C;  3KWQ B;  5BT1 D;  1P3G A;  1M18 D;  3X1T B;  5AY8 D;  4QLC D;  1HQ3 B;  4WU8 A;  2YFV A;  4UUZ B;  5FUG B;  3AZG A;  3AV2 A;  3C1C D;  3W98 D;  5B1M A;  5B31 D;  3LZ1 C;  5AV9 B;  4J8U B;  5CPJ C;  1KX3 B;  3REJ D;  3TU4 C;  5AVC D;  3AZK B;  1AOI B;  1KX4 C;  4YM6 A;  1KX5 A;  3AFA D;  2F8N G;  4J8X D;  4ZBJ B;  5DNN A;  3X1S A;  5AV5 B;  4AWL C;  5E5A B;  1P3A D;  5B0Z B;  4G91 C;  3REK D;  3KSY A;  3KXB A;  5B33 A;  4KGC A;  5B2I D;  2ARO D;  4CSR B;  3AN2 D;  3X1T C;  5F99 B;  1M19 D;  3W99 D;  3MNN C;  2RVQ D;  3MVD C;  3MGR B;  3AV1 C;  3B6G C;  3LJA C;  4KUD C;  4J8U C;  4JJN D;  3AZM D;  1S32 A;  2NZD A;  5DNM B;  2YFW B;  3AZI C;  3W97 A;  3KUY D;  1TZY A;  2LY8 A;  4J8V D;  3VH6 A;  4R8P C;  2PYO A;  5AV5 C;  1P3M A;  1ZLA D;  3B0D B;  3X1U B;  2F8N D;  3X1V A;  3UT9 C;  3C1B C;  5B1L C;  5CPK A;  3REH D;  3O62 A;  5B0Y D;  1M18 B;  1P34 C;  5AY8 B;  4QLC B;  1P3L A;  3W98 B;  1P3K C;  1EQZ D;  3C1C B;  2CV5 A;  3MGP A;  5B31 B;  1Q9C A;  1P3F A;  3R45 B;  3REJ B;  5JRG B;  5AVC B;  5B24 C;  4NE6 A;  3LZ0 C;  5AV6 A;  4J8X B;  4HGA B;  3B0D C;  3WTP A;  1P3A B;  3AZL C;  3AZE A;  3REK B;  5CP6 D;  5BNX B;  5B2I B;  1U35 A;  3W96 D;  2ARO B;  3AN2 B;  5AV8 D;  3LEL A;  1M19 B;  3W99 B;  3W98 C;  3AZF A;  2NQB D;  1M1A A;  3REL A;  4Z66 D;  5B31 C;  3WAA C;  4JJN B;  3REJ C;  3NQJ A;  5AVC C;  4YS3 C;  5JA4 A;  2BYK A;  4NE5 A;  1ID3 A;  3KUY B;  3AFA C;  3AZJ A;  2HIO B;  4J8W A;  3B0C W;  1P3I C;  3MGS A;  4J8V B;  5B40 A;  1ZLA B;  5B32 C;  5B2J C;  1F66 A;  2F8N B;  3REK C;  1P3P A;  5G49 B;  3UTA D;  3WA9 A;  3REH B;  5B0Y B;  4WU9 A;  5AV9 D;  4KHA A;  5GT3 C;  4XUJ C;  1M19 C;  3W99 C;  3REI A;  5AVB D;  1EQZ B;  4LD9 D;  4ZUX D;  3AZM C;  4Z2M G;  5GT0 A;  1N1J A;  3V9R A;  3WKJ C;  1P3B A;  4J8V C;  2F8N K;  3UTB C;  3LZ1 A;  5CP6 B;  5CPJ A;  5BO0 A;  3TU4 A;  4WU8 D;  1KX4 A;  3A6N D;  3W96 B;  3AZG D;  5AV8 B;  5B1M D;  4XZQ A;  2NQB B;  1KX5 D;  4YM6 D;  3B0C T;  1P3O C;  4H9S A;  5DNN D;  3X1S D;  3X1T A;  4UUZ A;  3MNN A;  3KXB D;  5B33 D;  3MVD A;  3AV1 A;  3B6G A;  4KUD A;  3LJA A;  4KGC D;  3UTA B;  2IO5 B;  5CPI A;  3B6F C;  1H3O A;  3AZI A;  4X23 D;  1A7W A;  5AV8 C;  5JRG D;  2HUE B; 
#chains in the Genus database with same CATH topology
 5AVB B;  4R8P A;  4LD9 B;  5KDM A;  4Z66 C;  3MGQ C;  5GXQ C;  1S32 D;  2NZD D;  4ZUX B;  3AZH C;  3W97 D;  3UT9 A;  1TZY D;  4H9R B;  5B1L A;  3C1B A;  4WNN A;  2PYO D;  3KWQ C;  4CSR A;  1P3M D;  1P34 A;  3X1V D;  1P3K A;  1TAF A;  5CPK D;  1R4V A;  1HQ3 C;  3O62 D;  3UTA C;  1P3G B;  2FJ7 D;  4H9O A;  1P3L D;  5B24 A;  4WU8 B;  5AV9 C;  3A6N B;  1KX3 C;  3AZG B;  3LZ0 A;  5B1M B;  4DRA A;  3AZK C;  2CV5 D;  1P3F D;  1AOI C;  1BH8 A;  1F1E A;  4ZUX C;  2HIO D;  1KX5 B;  4YM6 B;  4ZBJ C;  3AZL A;  4H9P A;  4WJ3 C;  5AV6 D;  5E5A C;  5B0Z C;  4EO5 B;  4H9Q A;  5DNN B;  3X1S B;  3WTP D;  3AZE D;  3KXB B;  5B33 B;  4KGC B;  5B31 A;  5F99 C;  3WAA A;  3AL0 C;  3REJ A;  4CAY A;  1U35 D;  5BNV A;  3MGR C;  4YS3 A;  3EPK A;  3LEL D;  3A6N C;  4X23 B;  3AZF D;  3AFA A;  5DNM C;  1M1A D;  3REL D;  2RIQ A;  1P3I A;  1S32 B;  2NZD B;  3WTP E;  5B32 A;  5B2J A;  4YM6 C;  3REK A;  1ID3 D;  3W97 B;  1TZY B;  3X1U C;  3MGS D;  2PYO B;  1BH9 A;  5B40 D;  5GT3 A;  4XUJ A;  1P3M B;  4Z5T D;  1M19 A;  1F66 D;  3W99 A;  2XD1 A;  3X1V B;  5BT1 C;  3KXB C;  2Y2H A;  1P3P D;  1M18 C;  5CPK B;  3WA9 D;  5AY8 C;  4QLC C;  3O62 B;  3AZM A;  5GSU A;  3C1C C;  2FJ7 B;  5BS7 C;  3REI D;  1P3L B;  4X23 C;  3F6T A;  5JRG C;  3WKJ A;  2CV5 B;  1P3F B;  1JFI A;  2NZD C;  5GT0 D;  1B6W A;  2Y2N A;  1PZR A;  3UTB A;  4J8X C;  2ZY4 A;  4HGA C;  3AZN A;  5AV6 B;  1P3B D;  1P3A C;  3AYW A;  3WTP B;  5B2I C;  3LZ1 D;  3AZE B;  4E44 A;  5CPJ D;  2ARO C;  3AN2 C;  4E45 A;  3TU4 D;  1KX4 D;  2RVQ C;  1U35 B;  1P3O A;  2FJ7 C;  3LEL B;  4JJN C;  4XZQ D;  3AZF B;  2Y2Q A;  1M1A B;  3REL B;  3KUY C;  2F8N H;  2HIO C;  5JA4 B;  2BYK B;  1ID3 B;  1ZLA C;  4J8W B;  3B6F A;  3MGS B;  5B40 B;  5AV8 A;  3MNN D;  1P3G D;  4Z5T B;  1F66 B;  3MVD D;  3REH C;  2F2A C;  3B6G D;  3LJA D;  4KUD D;  5B0Y C;  1P3P B;  3MGQ A;  4Z66 A;  5GXQ A;  3AV2 D;  5CPI D;  3WA9 B;  3AZH A;  4UPK A;  3AZI D;  1U35 C;  1EQZ C;  4KHA B;  4WZS B;  2BYM A;  3REI B;  2J8P A;  3AZF C;  3KWQ A;  5GT0 B;  1N1J B;  2CWE A;  5B1L D;  1HQ3 A;  5FUG A;  1T3U A;  1P3B B;  3MGS C;  3KFU G;  5CP6 C;  5AV9 A;  4J8U A;  1KX3 A;  1P3K D;  4Z5T C;  1B67 A;  3AZK A;  3LZ1 B;  1AOI A;  3W96 C;  5CPJ B;  4H9N B;  5BO0 B;  3WA9 C;  2Y2G A;  3NQU B;  4ZUX A;  3TU4 B;  5B24 D;  1KX4 B;  2NQB C;  5AV5 A;  3LZ0 D;  3REI C;  3VH6 W;  5E5A A;  4WV4 B;  4XZQ B;  5B0Z A;  3H0R C;  1WWS A;  3AZL D;  4G91 B;  5F99 A;  1P3B C;  1W2E A;  3VH5 W;  3MGR A;  3A6N A;  3MNN B;  2IO5 C;  5DNM A;  2YFW A;  3MVD B;  3AV1 B;  3B6G B;  4KUD B;  3LJA B;  3WAA D;  2YFV B;  3AV2 B;  5CPI B;  2HUE C;  4YS3 D;  1H3O B;  3MGP D;  3AZI B;  5AVB C;  4LD9 C;  1KU5 A;  1BFM A;  4XZQ C;  3X1U A;  1P3I D;  3A1I A;  4R8P B;  5KDM B;  5B32 D;  5B2J D;  2G5H C;  4H9S C;  3UT9 B;  1WWI A;  3C1B B;  5B1L B;  1M18 A;  5AY8 A;  4QLC A;  4WNN B;  3W98 A;  3C1C A;  5GT3 D;  1P34 B;  4XUJ D;  5BS7 A;  3R45 A;  4X23 A;  1P3G C;  1P3K B;  5JRG A;  1TAF B;  5AVC A;  4DRB A;  4WU8 C;  5CPI C;  3VH6 T;  5GSU D;  3AZG C;  3AV2 C;  4H9O B;  4NE3 A;  5B1M C;  4J8X A;  5B24 B;  3LZ0 B;  4Z2M H;  3WKJ D;  1P3A A;  1KX5 C;  1BH8 B;  3AZJ D;  3UTB D;  5BNX A;  4J8W D;  4EO5 C;  5B2I A;  3AZL B;  4H9P B;  3VH5 T;  1HTA A;  5DNN C;  3AZN D;  2ARO A;  3AN2 A;  3X1S C;  3AYW D;  4H9Q B;  3A1K A;  2FJ7 A;  3P5J B;  5B33 C;  4KGC C;  3VH5 A;  2DQN C;  4JJN A;  4M6B A;  4WU9 D;  3WAA B;  3KUY A;  2JSS A;  4CAY B;  1P3O D;  2HIO A;  5BNV B;  4YS3 B;  3MGP B;  4J8V A;  3H0L C;  1S32 C;  3AFA B;  2L5A A;  1ZLA A;  2G5I C;  1P3I B;  2F8N A;  3W97 C;  5G49 A;  1TZY C;  5B32 B;  5B2J B;  3REH A;  5B0Y A;  2PYO C;  1P3M C;  3B6F D;  2ZY2 A;  3X1V C;  1EQZ A;  1BH9 B;  5GT3 B;  4XUJ B;  5CPK C;  3O62 C;  2ZY3 A;  2W8S A;  3MGQ D;  5GXQ D;  3AZH D;  3AZM B;  1P3L C;  5GSU B;  2CV5 C;  3MGP C;  1P3F C;  3NQJ B;  3KWQ D;  3WKJ B;  2FFF B;  1JFI B;  5CP6 A;  3AZJ B;  3UTB B;  4Z5T A;  5AV6 C;  4G92 B;  3X1T D;  2ZM5 A;  1HQ3 D;  3W96 A;  3AZN B;  3WTP C;  3AV1 D;  3AYW B;  3AZE C;  2NQB A;  4J8U D;  2VQR A;  1KX3 D;  3EPL A;  3AZK D;  1AOI D;  4WU9 B;  4DQY B;  3LEL C;  5C3I B;  1ULY A;  2DF4 C;  5GSU C;  2Y2O A;  4R8P D;  1P3O B;  3REL C;  5AV5 D;  1M1A C;  5E5A D;  5B0Z D;  3UT9 D;  3C1B D;  2Y2J A;  1ID3 C;  3AZJ C;  3V9R B;  4G92 C;  3UTA A;  4J8W C;  5B31 G;  2BG1 A;  1P34 D;  5F99 D;  3AZN C;  2Y2L A;  4H9N A;  5B40 C;  3NQU A;  1F66 C;  3B6F B;  3MGR D;  3AYW C;  5AVB A;  1P3P C;  4LD9 A;  5DNM D;  4NFT A;  4WU9 C;  2ZY5 A;  3MGQ B;  4Z66 B;  5GXQ B;  4H9R A;  5B32 G;  3AZH B;  5C3I C;  3B0B A;  5CHL B;  2BYM B;  4AWL B;  3X1U D;  5GT0 C;  3KWQ B;  5BT1 D;  1P3G A;  1M18 D;  3X1T B;  5AY8 D;  4QLC D;  1HQ3 B;  2JE5 A;  4WU8 A;  2YFV A;  4UUZ B;  5FUG B;  2XD5 A;  3AZG A;  3C1C D;  3AV2 A;  3IP4 C;  3W98 D;  5B1M A;  5B31 D;  3LZ1 C;  5AV9 B;  4J8U B;  5CPJ C;  1KX3 B;  1Z2C B;  3REJ D;  3TU4 C;  5AVC D;  3AZK B;  1AOI B;  1KX4 C;  4YM6 A;  1KX5 A;  3AFA D;  2F8N G;  4J8X D;  4ZBJ B;  5DNN A;  3X1S A;  5AV5 B;  4AWL C;  5E5A B;  1P3A D;  5B0Z B;  4G91 C;  3REK D;  3KSY A;  3KXB A;  5B33 A;  4KGC A;  5B2I D;  2ARO D;  4CSR B;  3AN2 D;  3X1T C;  5F99 B;  1M19 D;  3W99 D;  3MNN C;  2RVQ D;  3MVD C;  3MGR B;  2Y2I A;  3AV1 C;  3LJA C;  3B6G C;  4KUD C;  4J8U C;  4JJN D;  3AZM D;  1S32 A;  2NZD A;  5DNM B;  2YFW B;  3EPH A;  3AZI C;  3W97 A;  3KUY D;  1TZY A;  2LY8 A;  4J8V D;  3VH6 A;  4R8P C;  2PYO A;  5AV5 C;  1P3M A;  1ZLA D;  3B0D B;  3X1U B;  2F8N D;  3X1V A;  3UT9 C;  3C1B C;  5B1L C;  5CPK A;  3REH D;  3O62 A;  5B0Y D;  1M18 B;  1P34 C;  2Y2P A;  5AY8 B;  4QLC B;  1P3L A;  3W98 B;  1P3K C;  1EQZ D;  3C1C B;  2CV5 A;  3MGP A;  5B31 B;  1Q9C A;  1P3F A;  3R45 B;  3REJ B;  5JRG B;  5AVC B;  5B24 C;  4NE6 A;  3LZ0 C;  5AV6 A;  4J8X B;  4HGA B;  3B0D C;  3WTP A;  3EG5 B;  1P3A B;  3AZL C;  3AZE A;  3REK B;  5CP6 D;  5BNX B;  5B2I B;  1U35 A;  3W96 D;  2ARO B;  3AN2 B;  5AV8 D;  3LEL A;  1M19 B;  3W99 B;  3W98 C;  2Y2K A;  3AZF A;  2NQB D;  1M1A A;  3REL A;  4Z66 D;  5B31 C;  3WAA C;  4JJN B;  3REJ C;  3NQJ A;  5AVC C;  4YS3 C;  5JA4 A;  2BYK A;  4NE5 A;  1ID3 A;  3KUY B;  3AFA C;  3EPJ A;  3AZJ A;  2HIO B;  4J8W A;  3B0C W;  1P3I C;  3MGS A;  4J8V B;  5B40 A;  1ZLA B;  5B32 C;  5B2J C;  1F66 A;  2F8N B;  3REK C;  1P3P A;  5G49 B;  3UTA D;  3WA9 A;  3REH B;  5B0Y B;  4WU9 A;  5GT3 C;  4KHA A;  5AV9 D;  4XUJ C;  1M19 C;  3W99 C;  3REI A;  5AVB D;  1EQZ B;  4LD9 D;  4ZUX D;  3AZM C;  4Z2M G;  5GT0 A;  1N1J A;  3V9R A;  3WKJ C;  1P3B A;  4J8V C;  2F8N K;  3UTB C;  3LZ1 A;  5CP6 B;  5CPJ A;  5BO0 A;  3TU4 A;  3FDD A;  4WU8 D;  1KX4 A;  3A6N D;  3W96 B;  3AZG D;  2UWX A;  5AV8 B;  5B1M D;  4XZQ A;  2NQB B;  2JCH A;  1KX5 D;  4YM6 D;  3B0C T;  1P3O C;  4H9S A;  5DNN D;  3X1S D;  3X1T A;  4UUZ A;  3MNN A;  3KXB D;  2Y2M A;  5B33 D;  3MVD A;  3AV1 A;  3B6G A;  4KUD A;  3LJA A;  4KGC D;  3UTA B;  2IO5 B;  5CPI A;  3B6F C;  1H3O A;  3H0M C;  3AZI A;  4X23 D;  1A7W A;  5AV8 C;  5JRG D;  2HUE B; 
#chains in the Genus database with same CATH homology
 5AVB B;  4R8P A;  4LD9 B;  5KDM A;  4Z66 C;  3MGQ C;  5GXQ C;  1S32 D;  2NZD D;  4ZUX B;  3AZH C;  3W97 D;  3UT9 A;  1TZY D;  4H9R B;  5B1L A;  3C1B A;  4WNN A;  2PYO D;  3KWQ C;  4CSR A;  1P3M D;  1P34 A;  3X1V D;  1P3K A;  1TAF A;  5CPK D;  1R4V A;  1HQ3 C;  3O62 D;  3UTA C;  1P3G B;  2FJ7 D;  4H9O A;  1P3L D;  5B24 A;  4WU8 B;  5AV9 C;  3A6N B;  1KX3 C;  3AZG B;  3LZ0 A;  5B1M B;  4DRA A;  3AZK C;  2CV5 D;  1P3F D;  1AOI C;  1BH8 A;  1F1E A;  4ZUX C;  2HIO D;  1KX5 B;  4YM6 B;  4ZBJ C;  3AZL A;  4H9P A;  4WJ3 C;  5AV6 D;  5E5A C;  5B0Z C;  4EO5 B;  4H9Q A;  5DNN B;  3X1S B;  3WTP D;  3AZE D;  3KXB B;  5B33 B;  4KGC B;  5B31 A;  5F99 C;  3WAA A;  3AL0 C;  3REJ A;  4CAY A;  1U35 D;  5BNV A;  3MGR C;  4YS3 A;  3EPK A;  3LEL D;  3A6N C;  4X23 B;  3AZF D;  3AFA A;  5DNM C;  1M1A D;  3REL D;  2RIQ A;  1P3I A;  1S32 B;  2NZD B;  3WTP E;  5B32 A;  5B2J A;  4YM6 C;  3REK A;  1ID3 D;  3W97 B;  1TZY B;  3X1U C;  3MGS D;  2PYO B;  1BH9 A;  5B40 D;  5GT3 A;  4XUJ A;  1P3M B;  4Z5T D;  1M19 A;  1F66 D;  3W99 A;  2XD1 A;  3X1V B;  5BT1 C;  3KXB C;  2Y2H A;  1P3P D;  1M18 C;  5CPK B;  3WA9 D;  5AY8 C;  4QLC C;  3O62 B;  3AZM A;  5GSU A;  3C1C C;  2FJ7 B;  5BS7 C;  3REI D;  1P3L B;  4X23 C;  3F6T A;  5JRG C;  3WKJ A;  2CV5 B;  1P3F B;  1JFI A;  2NZD C;  5GT0 D;  1B6W A;  2Y2N A;  1PZR A;  3UTB A;  4J8X C;  2ZY4 A;  4HGA C;  3AZN A;  5AV6 B;  1P3B D;  1P3A C;  3AYW A;  3WTP B;  5B2I C;  3LZ1 D;  3AZE B;  4E44 A;  5CPJ D;  2ARO C;  3AN2 C;  4E45 A;  3TU4 D;  1KX4 D;  2RVQ C;  1U35 B;  1P3O A;  2FJ7 C;  3LEL B;  4JJN C;  4XZQ D;  3AZF B;  2Y2Q A;  1M1A B;  3REL B;  3KUY C;  2F8N H;  2HIO C;  5JA4 B;  2BYK B;  1ID3 B;  1ZLA C;  4J8W B;  3B6F A;  3MGS B;  5B40 B;  5AV8 A;  3MNN D;  1P3G D;  4Z5T B;  1F66 B;  3MVD D;  3REH C;  2F2A C;  3B6G D;  3LJA D;  4KUD D;  5B0Y C;  1P3P B;  3MGQ A;  4Z66 A;  5GXQ A;  3AV2 D;  5CPI D;  3WA9 B;  3AZH A;  4UPK A;  3AZI D;  1U35 C;  1EQZ C;  4KHA B;  4WZS B;  2BYM A;  3REI B;  2J8P A;  3AZF C;  3KWQ A;  5GT0 B;  1N1J B;  2CWE A;  5B1L D;  1HQ3 A;  5FUG A;  1T3U A;  1P3B B;  3MGS C;  3KFU G;  5CP6 C;  5AV9 A;  4J8U A;  1KX3 A;  1P3K D;  4Z5T C;  1B67 A;  3AZK A;  3LZ1 B;  1AOI A;  3W96 C;  5CPJ B;  4H9N B;  5BO0 B;  3WA9 C;  2Y2G A;  3NQU B;  4ZUX A;  3TU4 B;  5B24 D;  1KX4 B;  2NQB C;  5AV5 A;  3LZ0 D;  3REI C;  3VH6 W;  5E5A A;  4WV4 B;  4XZQ B;  5B0Z A;  3H0R C;  1WWS A;  3AZL D;  4G91 B;  5F99 A;  1P3B C;  1W2E A;  3VH5 W;  3MGR A;  3A6N A;  3MNN B;  2IO5 C;  5DNM A;  2YFW A;  3MVD B;  3AV1 B;  3B6G B;  4KUD B;  3LJA B;  3WAA D;  2YFV B;  3AV2 B;  5CPI B;  2HUE C;  4YS3 D;  1H3O B;  3MGP D;  3AZI B;  5AVB C;  4LD9 C;  1KU5 A;  1BFM A;  4XZQ C;  3X1U A;  1P3I D;  3A1I A;  4R8P B;  5KDM B;  5B32 D;  5B2J D;  2G5H C;  4H9S C;  3UT9 B;  1WWI A;  3C1B B;  5B1L B;  1M18 A;  5AY8 A;  4QLC A;  4WNN B;  3W98 A;  3C1C A;  5GT3 D;  1P34 B;  4XUJ D;  5BS7 A;  3R45 A;  4X23 A;  1P3G C;  1P3K B;  5JRG A;  1TAF B;  5AVC A;  4DRB A;  4WU8 C;  5CPI C;  3VH6 T;  5GSU D;  3AZG C;  3AV2 C;  4H9O B;  4NE3 A;  5B1M C;  4J8X A;  5B24 B;  3LZ0 B;  4Z2M H;  3WKJ D;  1P3A A;  1KX5 C;  1BH8 B;  3AZJ D;  3UTB D;  5BNX A;  4J8W D;  4EO5 C;  5B2I A;  3AZL B;  4H9P B;  3VH5 T;  1HTA A;  5DNN C;  3AZN D;  2ARO A;  3AN2 A;  3X1S C;  3AYW D;  4H9Q B;  3A1K A;  2FJ7 A;  3P5J B;  5B33 C;  4KGC C;  3VH5 A;  2DQN C;  4JJN A;  4M6B A;  4WU9 D;  3WAA B;  3KUY A;  2JSS A;  4CAY B;  1P3O D;  2HIO A;  5BNV B;  4YS3 B;  3MGP B;  4J8V A;  3H0L C;  1S32 C;  3AFA B;  2L5A A;  1ZLA A;  2G5I C;  1P3I B;  2F8N A;  3W97 C;  5G49 A;  1TZY C;  5B32 B;  5B2J B;  3REH A;  5B0Y A;  2PYO C;  1P3M C;  3B6F D;  2ZY2 A;  3X1V C;  1EQZ A;  1BH9 B;  5GT3 B;  4XUJ B;  5CPK C;  3O62 C;  2ZY3 A;  2W8S A;  3MGQ D;  5GXQ D;  3AZH D;  3AZM B;  1P3L C;  5GSU B;  2CV5 C;  3MGP C;  1P3F C;  3NQJ B;  3KWQ D;  3WKJ B;  2FFF B;  1JFI B;  5CP6 A;  3AZJ B;  3UTB B;  4Z5T A;  5AV6 C;  4G92 B;  3X1T D;  2ZM5 A;  1HQ3 D;  3W96 A;  3AZN B;  3WTP C;  3AV1 D;  3AYW B;  3AZE C;  2NQB A;  4J8U D;  2VQR A;  1KX3 D;  3EPL A;  3AZK D;  1AOI D;  4WU9 B;  4DQY B;  3LEL C;  5C3I B;  1ULY A;  2DF4 C;  5GSU C;  2Y2O A;  4R8P D;  1P3O B;  3REL C;  5AV5 D;  1M1A C;  5E5A D;  5B0Z D;  3UT9 D;  3C1B D;  2Y2J A;  1ID3 C;  3AZJ C;  3V9R B;  4G92 C;  3UTA A;  4J8W C;  5B31 G;  2BG1 A;  1P34 D;  5F99 D;  3AZN C;  2Y2L A;  4H9N A;  5B40 C;  3NQU A;  1F66 C;  3B6F B;  3MGR D;  3AYW C;  5AVB A;  1P3P C;  4LD9 A;  5DNM D;  4NFT A;  4WU9 C;  2ZY5 A;  3MGQ B;  4Z66 B;  5GXQ B;  4H9R A;  5B32 G;  3AZH B;  5C3I C;  3B0B A;  5CHL B;  2BYM B;  4AWL B;  3X1U D;  5GT0 C;  3KWQ B;  5BT1 D;  1P3G A;  1M18 D;  3X1T B;  5AY8 D;  4QLC D;  1HQ3 B;  2JE5 A;  4WU8 A;  2YFV A;  4UUZ B;  5FUG B;  2XD5 A;  3AZG A;  3C1C D;  3AV2 A;  3IP4 C;  3W98 D;  5B1M A;  5B31 D;  3LZ1 C;  5AV9 B;  4J8U B;  5CPJ C;  1KX3 B;  1Z2C B;  3REJ D;  3TU4 C;  5AVC D;  3AZK B;  1AOI B;  1KX4 C;  4YM6 A;  1KX5 A;  3AFA D;  2F8N G;  4J8X D;  4ZBJ B;  5DNN A;  3X1S A;  5AV5 B;  4AWL C;  5E5A B;  1P3A D;  5B0Z B;  4G91 C;  3REK D;  3KSY A;  3KXB A;  5B33 A;  4KGC A;  5B2I D;  2ARO D;  4CSR B;  3AN2 D;  3X1T C;  5F99 B;  1M19 D;  3W99 D;  3MNN C;  2RVQ D;  3MVD C;  3MGR B;  2Y2I A;  3AV1 C;  3LJA C;  3B6G C;  4KUD C;  4J8U C;  4JJN D;  3AZM D;  1S32 A;  2NZD A;  5DNM B;  2YFW B;  3EPH A;  3AZI C;  3W97 A;  3KUY D;  1TZY A;  2LY8 A;  4J8V D;  3VH6 A;  4R8P C;  2PYO A;  5AV5 C;  1P3M A;  1ZLA D;  3B0D B;  3X1U B;  2F8N D;  3X1V A;  3UT9 C;  3C1B C;  5B1L C;  5CPK A;  3REH D;  3O62 A;  5B0Y D;  1M18 B;  1P34 C;  2Y2P A;  5AY8 B;  4QLC B;  1P3L A;  3W98 B;  1P3K C;  1EQZ D;  3C1C B;  2CV5 A;  3MGP A;  5B31 B;  1Q9C A;  1P3F A;  3R45 B;  3REJ B;  5JRG B;  5AVC B;  5B24 C;  4NE6 A;  3LZ0 C;  5AV6 A;  4J8X B;  4HGA B;  3B0D C;  3WTP A;  3EG5 B;  1P3A B;  3AZL C;  3AZE A;  3REK B;  5CP6 D;  5BNX B;  5B2I B;  1U35 A;  3W96 D;  2ARO B;  3AN2 B;  5AV8 D;  3LEL A;  1M19 B;  3W99 B;  3W98 C;  2Y2K A;  3AZF A;  2NQB D;  1M1A A;  3REL A;  4Z66 D;  5B31 C;  3WAA C;  4JJN B;  3REJ C;  3NQJ A;  5AVC C;  4YS3 C;  5JA4 A;  2BYK A;  4NE5 A;  1ID3 A;  3KUY B;  3AFA C;  3EPJ A;  3AZJ A;  2HIO B;  4J8W A;  3B0C W;  1P3I C;  3MGS A;  4J8V B;  5B40 A;  1ZLA B;  5B32 C;  5B2J C;  1F66 A;  2F8N B;  3REK C;  1P3P A;  5G49 B;  3UTA D;  3WA9 A;  3REH B;  5B0Y B;  4WU9 A;  5GT3 C;  4KHA A;  5AV9 D;  4XUJ C;  1M19 C;  3W99 C;  3REI A;  5AVB D;  1EQZ B;  4LD9 D;  4ZUX D;  3AZM C;  4Z2M G;  5GT0 A;  1N1J A;  3V9R A;  3WKJ C;  1P3B A;  4J8V C;  2F8N K;  3UTB C;  3LZ1 A;  5CP6 B;  5CPJ A;  5BO0 A;  3TU4 A;  3FDD A;  4WU8 D;  1KX4 A;  3A6N D;  3W96 B;  3AZG D;  2UWX A;  5AV8 B;  5B1M D;  4XZQ A;  2NQB B;  2JCH A;  1KX5 D;  4YM6 D;  3B0C T;  1P3O C;  4H9S A;  5DNN D;  3X1S D;  3X1T A;  4UUZ A;  3MNN A;  3KXB D;  2Y2M A;  5B33 D;  3MVD A;  3AV1 A;  3B6G A;  4KUD A;  3LJA A;  4KGC D;  3UTA B;  2IO5 B;  5CPI A;  3B6F C;  1H3O A;  3H0M C;  3AZI A;  4X23 D;  1A7W A;  5AV8 C;  5JRG D;  2HUE B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...