1P3KA

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
97
structure length
97
Chain Sequence
HRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVAIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein/dna
molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2003-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3kA00
1HTAA 3MGQD 4H9NA 5B40D 3REJD 4WZSB 3X1VD 1ULYA 2HUEB 1F66D 3AZGB 5BNVB 3AZMD 4ZUXA 3W97B 5B1LB 5B24C 4J8VD 5B24A 4LD9B 3O62B 5GT3B 3UTAD 3WA9C 3WA9A 4ZUXD 4LD9C 5BNXA 5B32B 1P3LB 5B32C 3MNNC 5B32A 3MNNA 4X23D 1P3LC 5AV5C 1P3LA 5AV5A 4DRBA 3AZKD 5GXQB 3UTBD 3REKB 4Z66C 5GXQC 4Z66A 5GXQA 3AZED 5CPIB 3REKC 3REKA 1KX3B 3AV1B 3MNND 4XZQC 3B0BA 4H9PA 4XZQA 5AV5D 1KX3A 1KX3C 4YS3D 1B67A 4H9RB 3X1UB 1P34B 5AY8D 1P34C 1BH8A 4G92C 1P34A 1EQZB 3AZHB 5CPKB 4H9SC 4H9SA 1EQZC 5CPKC 1EQZA 5CPKA 3C1BB 1M19D 4EO5C 5B0ZB 3C1BC 3C1BA 1P3AB 5B0ZC 5B0ZA 1P3AC 3KUYD 1P3AA 3LELB 2CWEA 3AZLB 5AV9B 1U35A 3LELC 3AZJD 3LELA 3AZLC 5AV9C 3B0DC 5AV9A 5B1MD 5B0YB 4KUDD 1AOIB 2FJ7B 3REHB 3RELB 5AV6C 2FJ7C 5AV6A 2FJ7A 4R8PB 5AV8D 3RELC 3RELA 3AZFB 1KX5B 4R8PC 3AZFC 1U35D 4R8PA 3AZFA 3VH6T 5JRGC 5BO0A 5JRGA 3C1CC 1P3BC 3C1CA 1P3BA 4NE3A 3LJAB 2HIOC 3VH6W 3AZIB 2HIOA 3AFAB 3AZIC 5E5AB 3LZ0D 5E5AC 5E5AA 4H9OB 5JRGD 2PYOD 4JJND 1TAFB 4H9OA 1ID3B 5B2JB 5F99B 1ID3C 1TAFA 1ZLAB 1ID3A 4J8UD 5F99C 2RVQC 5F99A 4CAYB 1TZYB 3AYWB 4QLCB 2CV5B 3W96D 2CV5C 4E45A 3X1SB 2CV5A 5GSUB 3X1SC 3X1SA 5GSUC 3AV2B 5GSUA 1P3IB 1N1JA 3AV2C 1Q9CA 3NQUA 4Z2MH 3AV2A 1P3MB 2F8NK 1P3MC 4HGAC 1P3MA 4YM6D 3B0CW 1P3KD 3WKJD 5AVCD 4DRAA 3V9RA 5GT0D 3MGSD 3A6NB 4AWLC 1KX4D 2BYKB 3A6NC 3A6NA 5B2IB 5B2IC 5B2IA 2F8ND 4WNNB 3B6FD 3W99B 1P3OD 3W99C 4WNNA 3WTPD 3W99A 2F8NH 2AROB 5DNMD 2AROC 2AROA 4ZBJB 3X1TB 1P3GB 3AZNB 5B31C 3MVDC 4ZBJC 5B31A 3MVDA 3AN2B 3X1TC 3X1TA 3AZNC 1P3GC 3AZNA 3AN2C 3AN2A 3UT9B 2YFVB 3UT9C 3UT9A 4H9QB 2YFVA 4H9QA 5B31D 2HUEC 3MGQB 5CHLB 3AZGC 4WU9B 3AZGA 4G91B 2NQBB 5BNVA 4WU9C 3MGPB 4WU9A 3W97C 3MGPC 3W97A 3MGPA 1B6WA 4WU8B 5B1LC 5B1LA 4WU8C 4WU8A 3REIB 3O62C 5GT3C 1P3FB 3O62A 5GT3A 4LD9A 3REIC 3REIA 1P3FC 1P3FA 1WWIA 3VH6A 5B24D 5B1LD 1A7WA 3UTAB 3WA9D 3W98B 3O62D 4LD9D 3KXBB 5KDMB 3W98C 3W98A 3KXBC 3KXBA 3WTPE 5CPIC 1JFIB 5B32D 5CPIA 4X23B 3AV1C 1P3LD 1JFIA 3AV1A 3UTBB 4Z66D 5GXQD 4H9RA 2NZDB 3AZEB 3X1UC 3X1UA 3REKD 2NZDC 2NZDA 5CPID 4XZQD 1KX3D 3AZHC 5G49B 3AZHA 4J8XB 4KGCB 4J8XC 3X1UD 4XUJB 3MGRB 4J8XA 1P34D 4XUJC 3MGRC 4XUJA 3MGRA 1EQZD 3AZHD 5CPKD 3AZLA 1M19B 3C1BD 5B0YC 5B0YA 1AOIC 5B0ZD 3REHC 1AOIA 3REHA 3WAAB 1P3AD 3KUYB 3WAAC 1KX5C 3WAAA 1KX5A 3LELD 3AZLD 5AV9D 5B1MB 5AV6D 2FJ7D 4Z5TB 3LJAC 3RELD 3LJAA 3AZIA 4R8PD 3AZFD 3AFAC 1KX5D 3AFAA 1M1AB 3VH5T 3C1CD 5CP6B 1P3BD 1M1AA 1M18B 1M1AC 2HIOD 5CP6C 3LZ1B 5DNNB 5CP6A 1M18C 1M18A 5B33B 3AZID 3VH5W 5DNNC 3LZ1C 3LZ1A 5B2JC 1ZLAC 5B2JA 5B33C 1ZLAA 5B33A 5E5AD 4CAYA 1TZYC 1TZYA 1R4VA 3AYWC 3AYWA 4QLCC 1ID3D 4QLCA 5B2JD 5F99D 1ZLAD 2RVQD 5BS7C 4KHAB 5BS7A 5C3IB 4KHAA 5C3IC 4J8WB 1P3IC 3KWQB 1S32B 3AYWD 1P3IA 4J8WC 2CV5D 4J8WA 3KWQC 4Z2MG 1S32C 3KWQA 1S32A 3X1SD 5GSUD 3AV2D 1P3ID 1P3MD 5CPJB 1P3PB 2BYKA 5AVBB 5CPJC 1P3PC 2IO5B 1P3KB 5FUGB 5AVCB 2IO5C 5GT0B 1KX4B 2BYMB 3A6ND 2BYMA 1HQ3B 5B2ID 3B6GB 1HQ3C 2F8NG 1HQ3A 3B6GC 3B6GA 3TU4B 1P3GA 3TU4C 3W99D 1BFMA 2AROD 1H3OB 3MVDD 3X1TD 1P3GD 3AZND 3AN2D 3MGQC 5B40B 3MGQA 3REJB 5BT1C 4G91C 3REJC 3UT9D 5B40A 5B40C 3X1VB 2NQBA 2NQBC 3X1VC 3X1VA 1F66B 5B31G 4H9NB 3AZGD 1F66C 3AZMB 1F66A 4WU9D 3AZMC 5BT1D 3AZMA 4CSRB 2NQBD 3W97D 3MGPD 4CSRA 4J8VB 4J8VC 4J8VA 4WU8D 5JA4B 4ZUXB 5GT3D 3UTAC 3UTAA 3REID 5JA4A 4ZUXC 1P3FD 5KDMA 5B24B 3VH5A 3WA9B 3W98D 4X23C 3AZKB 4X23A 5BNXB 3KXBD 3AZKC 3AZKA 3UTBC 3UTBA 4NE6A 3AZEC 3AZEA 3MNNB 5B32G 3AV1D 5AV5B 1KU5A 4YS3B 1BH9B 5G49A 4YS3C 4YS3A 1BH9A 4Z66B 3NQJB 5AY8B 4KGCC 2NZDD 4KGCA 5AY8C 3NQJA 5AY8A 4H9PB 4XZQB 1M19C 1M19A 4J8XD 1BH8B 4M6BA 4G92B 4KGCD 4XUJD 3MGRD 3R45B 1WWSA 4E44A 3KUYC 3KUYA 3AZJB 3R45A 3AZJC 4KUDB 3AZJA 4EO5B 5B1MC 5B0YD 5B1MA 1AOID 4KUDC 4KUDA 3REHD 5AV8B 4Z5TC 3WAAD 4Z5TA 5AV8C 1U35B 5AV8A 3B0DB 1U35C 5AV6B 3LJAD 5DNNA 4Z5TD 3AFAD 3LZ0B 2PYOB 5BO0B 5JRGB 1M1AD 3LZ0C 3C1CB 1P3BB 3LZ0A 4JJNB 2PYOC 2PYOA 2HIOB 5CP6D 1M18D 4JJNC 4JJNA 3LZ1D 5DNND 4J8UB 5B33D 4WV4B 4J8UC 4J8UA 2LY8A 3KSYA 1TZYD 4NE5A 3W96B 4QLCD 3W96C 3W96A 4UUZB 4UUZA 4J8WD 3KWQD 1S32D 5CPJA 5AVBC 1P3PA 5AVBA 4YM6B 3WKJB 2YFWB 4YM6C 1P3KC 3WKJC 4YM6A 1P3KA 3MGSB 3WKJA 5AVCC 1N1JB 2YFWA 3NQUB 5FUGA 5GT0C 5AVCA 5GT0A 3MGSC 3MGSA 1KX4C 1KX4A 4HGAB 3B0CT 2L5AA 5CPJD 1P3PD 2JSSA 5AVBD 2F8NB 3V9RB 2F8NA 3B6FB 4AWLB 1P3OB 3TU4A 3B6FC 3B6FA 3WTPB 1P3OC 1P3OA 5DNMB 3WTPC 3WTPA 4NFTA 1HQ3D 5DNMC 5DNMA 3B6GD 1H3OA 3TU4D 3REJA 1F1EA 5B31B 3MVDB
chains in the Genus database with same CATH superfamily
1HTAA 3MGQD 1Z2CB 4H9NA 5B40D 3REJD 4WZSB 3X1VD 1ULYA 2HUEB 1F66D 3AZGB 2Y2GA 5BNVB 3EPHA 3AZMD 4ZUXA 2Y2HA 2Y2NA 2G5IC 3W97B 5B1LB 5B24C 3H0MC 4J8VD 5B24A 4LD9B 3O62B 5GT3B 3UTAD 3WA9C 3WA9A 4ZUXD 4LD9C 5BNXA 5B32B 1P3LB 5B32C 3MNNC 5B32A 3MNNA 4X23D 1P3LC 5AV5C 1P3LA 5AV5A 4DRBA 3AZKD 5GXQB 3UTBD 3REKB 4Z66C 5GXQC 4Z66A 5GXQA 3AZED 5CPIB 3REKC 3REKA 1KX3B 3AV1B 3MNND 4XZQC 3B0BA 4H9PA 4XZQA 5AV5D 1KX3A 1KX3C 4YS3D 1B67A 4H9RB 3X1UB 1P34B 5AY8D 1P34C 1BH8A 4G92C 1P34A 1EQZB 3AZHB 5CPKB 4H9SC 4H9SA 1EQZC 5CPKC 1EQZA 4WJ3C 5CPKA 3C1BB 1M19D 4EO5C 5B0ZB 3C1BC 3C1BA 1P3AB 5B0ZC 5B0ZA 1P3AC 3KUYD 1P3AA 3LELB 2Y2KA 2CWEA 3AZLB 5AV9B 4DQYB 3LELC 3AZJD 1U35A 3LELA 3AZLC 5AV9C 3B0DC 5AV9A 5B1MD 5B0YB 4KUDD 2XD1A 1AOIB 2FJ7B 3H0RC 3REHB 3RELB 5AV6C 2FJ7C 5AV6A 2FJ7A 4R8PB 5AV8D 3RELC 3RELA 3AZFB 1KX5B 4R8PC 3AZFC 1U35D 2ZY4A 2FFFB 4R8PA 3VH6T 3AZFA 2DF4C 5JRGC 5BO0A 3IP4C 5JRGA 3C1CC 3C1CA 1P3BA 4UPKA 1P3BC 4NE3A 3LJAB 2HIOC 3VH6W 3AZIB 2HIOA 1PZRA 3AFAB 3AZIC 5E5AB 3FDDA 5E5AC 3LZ0D 5E5AA 4H9OB 5JRGD 2PYOD 4JJND 1TAFB 4H9OA 1ID3B 5B2JB 5F99B 1ID3C 1TAFA 1ZLAB 1ID3A 4J8UD 1W2EA 5F99C 2RVQC 5F99A 4CAYB 3EPLA 1TZYB 3AYWB 4QLCB 2CV5B 3W96D 2JE5A 2CV5C 4E45A 3X1SB 2CV5A 5GSUB 3X1SC 3X1SA 5GSUC 3AV2B 5GSUA 1P3IB 1N1JA 3AV2C 1Q9CA 3NQUA 4Z2MH 3AV2A 1P3MB 2F8NK 1P3MC 2Y2QA 4HGAC 1P3MA 4YM6D 3B0CW 1P3KD 3WKJD 5AVCD 4DRAA 3V9RA 5GT0D 3MGSD 3A6NB 2F2AC 4AWLC 1KX4D 2BYKB 3A6NC 3A6NA 5B2IB 5B2IC 5B2IA 2F8ND 4WNNB 3B6FD 3W99B 1P3OD 3EG5B 3W99C 4WNNA 3WTPD 3W99A 2F8NH 2AROB 5DNMD 2AROC 2AROA 4ZBJB 3X1TB 1P3GB 3AZNB 5B31C 3MVDC 3P5JB 4ZBJC 5B31A 3MVDA 3AN2B 3X1TC 3AZNC 3X1TA 1P3GC 3AZNA 3AN2C 2RIQA 3AN2A 3UT9B 2YFVB 3UT9C 3UT9A 4H9QB 2YFVA 4H9QA 5B31D 2HUEC 3MGQB 5CHLB 3AZGC 4WU9B 3AZGA 4G91B 2NQBB 5BNVA 4WU9C 3MGPB 4WU9A 3W97C 3MGPC 3W97A 3MGPA 1B6WA 4WU8B 5B1LC 5B1LA 4WU8C 4WU8A 3REIB 3O62C 5GT3C 1P3FB 3O62A 5GT3A 4LD9A 3REIC 3AL0C 3REIA 1P3FC 1P3FA 1WWIA 3VH6A 1T3UA 5B24D 5B1LD 1A7WA 3UTAB 3WA9D 3W98B 3O62D 4LD9D 3KXBB 5KDMB 3W98C 3W98A 3KXBC 3KXBA 3WTPE 5CPIC 1JFIB 5B32D 5CPIA 4X23B 3AV1C 1P3LD 1JFIA 3AV1A 3UTBB 4Z66D 5GXQD 4H9RA 2NZDB 3AZEB 3X1UC 3X1UA 3REKD 2J8PA 2NZDC 2NZDA 5CPID 4XZQD 1KX3D 3AZHC 5G49B 3AZHA 4J8XB 4KGCB 4J8XC 3X1UD 4XUJB 3MGRB 4J8XA 1P34D 4XUJC 3MGRC 4XUJA 3MGRA 1EQZD 3AZHD 5CPKD 3KFUG 3AZLA 1M19B 3C1BD 5B0YC 5B0YA 1AOIC 5B0ZD 3REHC 1AOIA 3REHA 3WAAB 1P3AD 3KUYB 3WAAC 1KX5C 3WAAA 1KX5A 3LELD 3AZLD 5AV9D 5B1MB 5AV6D 2FJ7D 4Z5TB 3LJAC 3RELD 3LJAA 3AZIA 4R8PD 3AZFD 3AFAC 1KX5D 3AFAA 1M1AB 3VH5T 3C1CD 5CP6B 1P3BD 1M1AA 1M18B 1M1AC 2HIOD 5CP6C 3LZ1B 5DNNB 5CP6A 1M18C 1M18A 5B33B 3AZID 2BG1A 3VH5W 5DNNC 3LZ1A 5B2JC 3LZ1C 1ZLAC 2JCHA 5B2JA 5B33C 5B33A 1ZLAA 5E5AD 4CAYA 1TZYC 1TZYA 1R4VA 3AYWC 3AYWA 4QLCC 1ID3D 4QLCA 5B2JD 5F99D 1ZLAD 2RVQD 5BS7C 4KHAB 5BS7A 5C3IB 4KHAA 3EPKA 5C3IC 4J8WB 1P3IC 3KWQB 1S32B 3AYWD 1P3IA 4J8WC 2CV5D 4J8WA 3KWQC 4Z2MG 1S32C 3KWQA 1S32A 3X1SD 5GSUD 2VQRA 3AV2D 1P3ID 1P3MD 5CPJB 1P3PB 2BYKA 5AVBB 5CPJC 1P3PC 2IO5B 1P3KB 5FUGB 5AVCB 2IO5C 5GT0B 1KX4B 2BYMB 3A6ND 2BYMA 1HQ3B 5B2ID 3B6GB 1HQ3C 2F8NG 1HQ3A 3B6GC 3B6GA 2Y2JA 3TU4B 1P3GA 3TU4C 3W99D 1BFMA 2AROD 2XD5A 1H3OB 3MVDD 3X1TD 1P3GD 3AZND 3AN2D 3MGQC 5B40B 3MGQA 3REJB 5BT1C 4G91C 3REJC 3UT9D 5B40A 5B40C 3X1VB 2NQBA 2NQBC 3X1VC 3X1VA 1F66B 5B31G 2ZY2A 3EPJA 4H9NB 3AZGD 1F66C 3AZMB 3A1IA 1F66A 4WU9D 2ZM5A 3AZMC 5BT1D 3AZMA 4CSRB 2NQBD 3W97D 3MGPD 4CSRA 4J8VB 4J8VC 4J8VA 4WU8D 5JA4B 4ZUXB 5GT3D 3UTAC 3UTAA 3REID 5JA4A 4ZUXC 1P3FD 5KDMA 5B24B 3VH5A 3WA9B 2G5HC 3H0LC 3W98D 4X23C 3AZKB 4X23A 5BNXB 3KXBD 3AZKC 3AZKA 3UTBC 3UTBA 4NE6A 3AZEC 3AZEA 3MNNB 5B32G 3AV1D 5AV5B 1KU5A 4YS3B 1BH9B 5G49A 4YS3C 4YS3A 1BH9A 4Z66B 3NQJB 5AY8B 4KGCC 2NZDD 4KGCA 5AY8C 3NQJA 5AY8A 4H9PB 4XZQB 1M19C 1M19A 4J8XD 1BH8B 4M6BA 4G92B 4KGCD 4XUJD 3MGRD 3R45B 1WWSA 4E44A 3KUYC 3KUYA 3AZJB 3R45A 3AZJC 3A1KA 3AZJA 4EO5B 4KUDB 5B1MC 5B0YD 5B1MA 1AOID 4KUDC 4KUDA 3REHD 5AV8B 4Z5TC 3WAAD 4Z5TA 5AV8C 1U35B 5AV8A 3B0DB 1U35C 2DQNC 5AV6B 2Y2MA 3LJAD 5DNNA 4Z5TD 3AFAD 3LZ0B 2PYOB 5BO0B 5JRGB 1M1AD 3LZ0C 3C1CB 1P3BB 3LZ0A 4JJNB 2PYOC 2PYOA 2HIOB 5CP6D 1M18D 4JJNC 4JJNA 3LZ1D 5DNND 4J8UB 5B33D 4WV4B 4J8UC 4J8UA 2LY8A 3KSYA 1TZYD 4NE5A 3W96B 4QLCD 3W96C 3W96A 2ZY3A 4UUZB 4UUZA 4J8WD 3KWQD 3F6TA 1S32D 5CPJA 5AVBC 1P3PA 5AVBA 4YM6B 3WKJB 2YFWB 4YM6C 1P3KC 3WKJC 4YM6A 1P3KA 3MGSB 3WKJA 1N1JB 2YFWA 5AVCC 5AVCA 3NQUB 5GT0C 5FUGA 5GT0A 3MGSC 3MGSA 1KX4C 1KX4A 4HGAB 3B0CT 2L5AA 5CPJD 1P3PD 2JSSA 5AVBD 2F8NB 2ZY5A 3V9RB 2F8NA 3B6FB 4AWLB 1P3OB 3TU4A 3B6FC 2W8SA 3WTPB 1P3OC 2Y2LA 2Y2OA 1P3OA 3B6FA 5DNMB 3WTPC 3WTPA 4NFTA 1HQ3D 5DNMC 5DNMA 3B6GD 1H3OA 3TU4D 2Y2IA 2Y2PA 3REJA 1F1EA 5B31B 3MVDB 2UWXA
chains in the Genus database with same CATH topology
1HTAA 3MGQD 1Z2CB 4H9NA 5B40D 3REJD 4WZSB 3X1VD 1ULYA 2HUEB 1F66D 3AZGB 2Y2GA 5BNVB 3EPHA 3AZMD 4ZUXA 2Y2HA 2Y2NA 2G5IC 3W97B 5B1LB 5B24C 3H0MC 4J8VD 5B24A 4LD9B 3O62B 5GT3B 3UTAD 3WA9C 3WA9A 4ZUXD 4LD9C 5BNXA 5B32B 1P3LB 5B32C 3MNNC 5B32A 3MNNA 4X23D 1P3LC 5AV5C 1P3LA 5AV5A 4DRBA 3AZKD 5GXQB 3UTBD 3REKB 4Z66C 5GXQC 4Z66A 5GXQA 3AZED 5CPIB 3REKC 3REKA 1KX3B 3AV1B 3MNND 4XZQC 3B0BA 4H9PA 4XZQA 5AV5D 1KX3A 1KX3C 4YS3D 1B67A 4H9RB 3X1UB 1P34B 5AY8D 1P34C 1BH8A 4G92C 1P34A 1EQZB 3AZHB 5CPKB 4H9SC 4H9SA 1EQZC 5CPKC 1EQZA 4WJ3C 5CPKA 3C1BB 1M19D 4EO5C 5B0ZB 3C1BC 3C1BA 1P3AB 5B0ZC 5B0ZA 1P3AC 3KUYD 1P3AA 3LELB 2Y2KA 2CWEA 3AZLB 5AV9B 4DQYB 3LELC 3AZJD 1U35A 3LELA 3AZLC 5AV9C 3B0DC 5AV9A 5B1MD 5B0YB 4KUDD 2XD1A 1AOIB 2FJ7B 3H0RC 3REHB 3RELB 5AV6C 2FJ7C 5AV6A 2FJ7A 4R8PB 5AV8D 3RELC 3RELA 3AZFB 1KX5B 4R8PC 3AZFC 1U35D 2ZY4A 2FFFB 4R8PA 3VH6T 3AZFA 2DF4C 5JRGC 5BO0A 3IP4C 5JRGA 3C1CC 3C1CA 1P3BA 4UPKA 1P3BC 4NE3A 3LJAB 2HIOC 3VH6W 3AZIB 2HIOA 1PZRA 3AFAB 3AZIC 5E5AB 3FDDA 5E5AC 3LZ0D 5E5AA 4H9OB 5JRGD 2PYOD 4JJND 1TAFB 4H9OA 1ID3B 5B2JB 5F99B 1ID3C 1TAFA 1ZLAB 1ID3A 4J8UD 1W2EA 5F99C 2RVQC 5F99A 4CAYB 3EPLA 1TZYB 3AYWB 4QLCB 2CV5B 3W96D 2JE5A 2CV5C 4E45A 3X1SB 2CV5A 5GSUB 3X1SC 3X1SA 5GSUC 3AV2B 5GSUA 1P3IB 1N1JA 3AV2C 1Q9CA 3NQUA 4Z2MH 3AV2A 1P3MB 2F8NK 1P3MC 2Y2QA 4HGAC 1P3MA 4YM6D 3B0CW 1P3KD 3WKJD 5AVCD 4DRAA 3V9RA 5GT0D 3MGSD 3A6NB 2F2AC 4AWLC 1KX4D 2BYKB 3A6NC 3A6NA 5B2IB 5B2IC 5B2IA 2F8ND 4WNNB 3B6FD 3W99B 1P3OD 3EG5B 3W99C 4WNNA 3WTPD 3W99A 2F8NH 2AROB 5DNMD 2AROC 2AROA 4ZBJB 3X1TB 1P3GB 3AZNB 5B31C 3MVDC 3P5JB 4ZBJC 5B31A 3MVDA 3AN2B 3X1TC 3AZNC 3X1TA 1P3GC 3AZNA 3AN2C 2RIQA 3AN2A 3UT9B 2YFVB 3UT9C 3UT9A 4H9QB 2YFVA 4H9QA 5B31D 2HUEC 3MGQB 5CHLB 3AZGC 4WU9B 3AZGA 4G91B 2NQBB 5BNVA 4WU9C 3MGPB 4WU9A 3W97C 3MGPC 3W97A 3MGPA 1B6WA 4WU8B 5B1LC 5B1LA 4WU8C 4WU8A 3REIB 3O62C 5GT3C 1P3FB 3O62A 5GT3A 4LD9A 3REIC 3AL0C 3REIA 1P3FC 1P3FA 1WWIA 3VH6A 1T3UA 5B24D 5B1LD 1A7WA 3UTAB 3WA9D 3W98B 3O62D 4LD9D 3KXBB 5KDMB 3W98C 3W98A 3KXBC 3KXBA 3WTPE 5CPIC 1JFIB 5B32D 5CPIA 4X23B 3AV1C 1P3LD 1JFIA 3AV1A 3UTBB 4Z66D 5GXQD 4H9RA 2NZDB 3AZEB 3X1UC 3X1UA 3REKD 2J8PA 2NZDC 2NZDA 5CPID 4XZQD 1KX3D 3AZHC 5G49B 3AZHA 4J8XB 4KGCB 4J8XC 3X1UD 4XUJB 3MGRB 4J8XA 1P34D 4XUJC 3MGRC 4XUJA 3MGRA 1EQZD 3AZHD 5CPKD 3KFUG 3AZLA 1M19B 3C1BD 5B0YC 5B0YA 1AOIC 5B0ZD 3REHC 1AOIA 3REHA 3WAAB 1P3AD 3KUYB 3WAAC 1KX5C 3WAAA 1KX5A 3LELD 3AZLD 5AV9D 5B1MB 5AV6D 2FJ7D 4Z5TB 3LJAC 3RELD 3LJAA 3AZIA 4R8PD 3AZFD 3AFAC 1KX5D 3AFAA 1M1AB 3VH5T 3C1CD 5CP6B 1P3BD 1M1AA 1M18B 1M1AC 2HIOD 5CP6C 3LZ1B 5DNNB 5CP6A 1M18C 1M18A 5B33B 3AZID 2BG1A 3VH5W 5DNNC 3LZ1A 5B2JC 3LZ1C 1ZLAC 2JCHA 5B2JA 5B33C 5B33A 1ZLAA 5E5AD 4CAYA 1TZYC 1TZYA 1R4VA 3AYWC 3AYWA 4QLCC 1ID3D 4QLCA 5B2JD 5F99D 1ZLAD 2RVQD 5BS7C 4KHAB 5BS7A 5C3IB 4KHAA 3EPKA 5C3IC 4J8WB 1P3IC 3KWQB 1S32B 3AYWD 1P3IA 4J8WC 2CV5D 4J8WA 3KWQC 4Z2MG 1S32C 3KWQA 1S32A 3X1SD 5GSUD 2VQRA 3AV2D 1P3ID 1P3MD 5CPJB 1P3PB 2BYKA 5AVBB 5CPJC 1P3PC 2IO5B 1P3KB 5FUGB 5AVCB 2IO5C 5GT0B 1KX4B 2BYMB 3A6ND 2BYMA 1HQ3B 5B2ID 3B6GB 1HQ3C 2F8NG 1HQ3A 3B6GC 3B6GA 2Y2JA 3TU4B 1P3GA 3TU4C 3W99D 1BFMA 2AROD 2XD5A 1H3OB 3MVDD 3X1TD 1P3GD 3AZND 3AN2D 3MGQC 5B40B 3MGQA 3REJB 5BT1C 4G91C 3REJC 3UT9D 5B40A 5B40C 3X1VB 2NQBA 2NQBC 3X1VC 3X1VA 1F66B 5B31G 2ZY2A 3EPJA 4H9NB 3AZGD 1F66C 3AZMB 3A1IA 1F66A 4WU9D 2ZM5A 3AZMC 5BT1D 3AZMA 4CSRB 2NQBD 3W97D 3MGPD 4CSRA 4J8VB 4J8VC 4J8VA 4WU8D 5JA4B 4ZUXB 5GT3D 3UTAC 3UTAA 3REID 5JA4A 4ZUXC 1P3FD 5KDMA 5B24B 3VH5A 3WA9B 2G5HC 3H0LC 3W98D 4X23C 3AZKB 4X23A 5BNXB 3KXBD 3AZKC 3AZKA 3UTBC 3UTBA 4NE6A 3AZEC 3AZEA 3MNNB 5B32G 3AV1D 5AV5B 1KU5A 4YS3B 1BH9B 5G49A 4YS3C 4YS3A 1BH9A 4Z66B 3NQJB 5AY8B 4KGCC 2NZDD 4KGCA 5AY8C 3NQJA 5AY8A 4H9PB 4XZQB 1M19C 1M19A 4J8XD 1BH8B 4M6BA 4G92B 4KGCD 4XUJD 3MGRD 3R45B 1WWSA 4E44A 3KUYC 3KUYA 3AZJB 3R45A 3AZJC 3A1KA 3AZJA 4EO5B 4KUDB 5B1MC 5B0YD 5B1MA 1AOID 4KUDC 4KUDA 3REHD 5AV8B 4Z5TC 3WAAD 4Z5TA 5AV8C 1U35B 5AV8A 3B0DB 1U35C 2DQNC 5AV6B 2Y2MA 3LJAD 5DNNA 4Z5TD 3AFAD 3LZ0B 2PYOB 5BO0B 5JRGB 1M1AD 3LZ0C 3C1CB 1P3BB 3LZ0A 4JJNB 2PYOC 2PYOA 2HIOB 5CP6D 1M18D 4JJNC 4JJNA 3LZ1D 5DNND 4J8UB 5B33D 4WV4B 4J8UC 4J8UA 2LY8A 3KSYA 1TZYD 4NE5A 3W96B 4QLCD 3W96C 3W96A 2ZY3A 4UUZB 4UUZA 4J8WD 3KWQD 3F6TA 1S32D 5CPJA 5AVBC 1P3PA 5AVBA 4YM6B 3WKJB 2YFWB 4YM6C 1P3KC 3WKJC 4YM6A 1P3KA 3MGSB 3WKJA 1N1JB 2YFWA 5AVCC 5AVCA 3NQUB 5GT0C 5FUGA 5GT0A 3MGSC 3MGSA 1KX4C 1KX4A 4HGAB 3B0CT 2L5AA 5CPJD 1P3PD 2JSSA 5AVBD 2F8NB 2ZY5A 3V9RB 2F8NA 3B6FB 4AWLB 1P3OB 3TU4A 3B6FC 2W8SA 3WTPB 1P3OC 2Y2LA 2Y2OA 1P3OA 3B6FA 5DNMB 3WTPC 3WTPA 4NFTA 1HQ3D 5DNMC 5DNMA 3B6GD 1H3OA 3TU4D 2Y2IA 2Y2PA 3REJA 1F1EA 5B31B 3MVDB 2UWXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HTA A;  3MGQ D;  4H9N A;  5B40 D;  3REJ D;  4WZS B;  3X1V D;  1ULY A;  2HUE B;  1F66 D;  3AZG B;  5BNV B;  3AZM D;  4ZUX A;  3W97 B;  5B1L B;  5B24 C;  4J8V D;  5B24 A;  4LD9 B;  3O62 B;  5GT3 B;  3UTA D;  3WA9 C;  3WA9 A;  4ZUX D;  4LD9 C;  5BNX A;  5B32 B;  1P3L B;  5B32 C;  3MNN C;  5B32 A;  3MNN A;  4X23 D;  1P3L C;  5AV5 C;  1P3L A;  5AV5 A;  4DRB A;  3AZK D;  5GXQ B;  3UTB D;  3REK B;  4Z66 C;  5GXQ C;  4Z66 A;  5GXQ A;  3AZE D;  5CPI B;  3REK C;  3REK A;  1KX3 B;  3AV1 B;  3MNN D;  4XZQ C;  3B0B A;  4H9P A;  4XZQ A;  5AV5 D;  1KX3 A;  1KX3 C;  4YS3 D;  1B67 A;  4H9R B;  3X1U B;  1P34 B;  5AY8 D;  1P34 C;  1BH8 A;  4G92 C;  1P34 A;  1EQZ B;  3AZH B;  5CPK B;  4H9S C;  4H9S A;  1EQZ C;  5CPK C;  1EQZ A;  5CPK A;  3C1B B;  1M19 D;  4EO5 C;  5B0Z B;  3C1B C;  3C1B A;  1P3A B;  5B0Z C;  5B0Z A;  1P3A C;  3KUY D;  1P3A A;  3LEL B;  2CWE A;  3AZL B;  5AV9 B;  1U35 A;  3LEL C;  3AZJ D;  3LEL A;  3AZL C;  5AV9 C;  3B0D C;  5AV9 A;  5B1M D;  5B0Y B;  4KUD D;  1AOI B;  2FJ7 B;  3REH B;  3REL B;  5AV6 C;  2FJ7 C;  5AV6 A;  2FJ7 A;  4R8P B;  5AV8 D;  3REL C;  3REL A;  3AZF B;  1KX5 B;  4R8P C;  3AZF C;  1U35 D;  4R8P A;  3AZF A;  3VH6 T;  5JRG C;  5BO0 A;  5JRG A;  3C1C C;  1P3B C;  3C1C A;  1P3B A;  4NE3 A;  3LJA B;  2HIO C;  3VH6 W;  3AZI B;  2HIO A;  3AFA B;  3AZI C;  5E5A B;  3LZ0 D;  5E5A C;  5E5A A;  4H9O B;  5JRG D;  2PYO D;  4JJN D;  1TAF B;  4H9O A;  1ID3 B;  5B2J B;  5F99 B;  1ID3 C;  1TAF A;  1ZLA B;  1ID3 A;  4J8U D;  5F99 C;  2RVQ C;  5F99 A;  4CAY B;  1TZY B;  3AYW B;  4QLC B;  2CV5 B;  3W96 D;  2CV5 C;  4E45 A;  3X1S B;  2CV5 A;  5GSU B;  3X1S C;  3X1S A;  5GSU C;  3AV2 B;  5GSU A;  1P3I B;  1N1J A;  3AV2 C;  1Q9C A;  3NQU A;  4Z2M H;  3AV2 A;  1P3M B;  2F8N K;  1P3M C;  4HGA C;  1P3M A;  4YM6 D;  3B0C W;  1P3K D;  3WKJ D;  5AVC D;  4DRA A;  3V9R A;  5GT0 D;  3MGS D;  3A6N B;  4AWL C;  1KX4 D;  2BYK B;  3A6N C;  3A6N A;  5B2I B;  5B2I C;  5B2I A;  2F8N D;  4WNN B;  3B6F D;  3W99 B;  1P3O D;  3W99 C;  4WNN A;  3WTP D;  3W99 A;  2F8N H;  2ARO B;  5DNM D;  2ARO C;  2ARO A;  4ZBJ B;  3X1T B;  1P3G B;  3AZN B;  5B31 C;  3MVD C;  4ZBJ C;  5B31 A;  3MVD A;  3AN2 B;  3X1T C;  3X1T A;  3AZN C;  1P3G C;  3AZN A;  3AN2 C;  3AN2 A;  3UT9 B;  2YFV B;  3UT9 C;  3UT9 A;  4H9Q B;  2YFV A;  4H9Q A;  5B31 D;  2HUE C;  3MGQ B;  5CHL B;  3AZG C;  4WU9 B;  3AZG A;  4G91 B;  2NQB B;  5BNV A;  4WU9 C;  3MGP B;  4WU9 A;  3W97 C;  3MGP C;  3W97 A;  3MGP A;  1B6W A;  4WU8 B;  5B1L C;  5B1L A;  4WU8 C;  4WU8 A;  3REI B;  3O62 C;  5GT3 C;  1P3F B;  3O62 A;  5GT3 A;  4LD9 A;  3REI C;  3REI A;  1P3F C;  1P3F A;  1WWI A;  3VH6 A;  5B24 D;  5B1L D;  1A7W A;  3UTA B;  3WA9 D;  3W98 B;  3O62 D;  4LD9 D;  3KXB B;  5KDM B;  3W98 C;  3W98 A;  3KXB C;  3KXB A;  3WTP E;  5CPI C;  1JFI B;  5B32 D;  5CPI A;  4X23 B;  3AV1 C;  1P3L D;  1JFI A;  3AV1 A;  3UTB B;  4Z66 D;  5GXQ D;  4H9R A;  2NZD B;  3AZE B;  3X1U C;  3X1U A;  3REK D;  2NZD C;  2NZD A;  5CPI D;  4XZQ D;  1KX3 D;  3AZH C;  5G49 B;  3AZH A;  4J8X B;  4KGC B;  4J8X C;  3X1U D;  4XUJ B;  3MGR B;  4J8X A;  1P34 D;  4XUJ C;  3MGR C;  4XUJ A;  3MGR A;  1EQZ D;  3AZH D;  5CPK D;  3AZL A;  1M19 B;  3C1B D;  5B0Y C;  5B0Y A;  1AOI C;  5B0Z D;  3REH C;  1AOI A;  3REH A;  3WAA B;  1P3A D;  3KUY B;  3WAA C;  1KX5 C;  3WAA A;  1KX5 A;  3LEL D;  3AZL D;  5AV9 D;  5B1M B;  5AV6 D;  2FJ7 D;  4Z5T B;  3LJA C;  3REL D;  3LJA A;  3AZI A;  4R8P D;  3AZF D;  3AFA C;  1KX5 D;  3AFA A;  1M1A B;  3VH5 T;  3C1C D;  5CP6 B;  1P3B D;  1M1A A;  1M18 B;  1M1A C;  2HIO D;  5CP6 C;  3LZ1 B;  5DNN B;  5CP6 A;  1M18 C;  1M18 A;  5B33 B;  3AZI D;  3VH5 W;  5DNN C;  3LZ1 C;  3LZ1 A;  5B2J C;  1ZLA C;  5B2J A;  5B33 C;  1ZLA A;  5B33 A;  5E5A D;  4CAY A;  1TZY C;  1TZY A;  1R4V A;  3AYW C;  3AYW A;  4QLC C;  1ID3 D;  4QLC A;  5B2J D;  5F99 D;  1ZLA D;  2RVQ D;  5BS7 C;  4KHA B;  5BS7 A;  5C3I B;  4KHA A;  5C3I C;  4J8W B;  1P3I C;  3KWQ B;  1S32 B;  3AYW D;  1P3I A;  4J8W C;  2CV5 D;  4J8W A;  3KWQ C;  4Z2M G;  1S32 C;  3KWQ A;  1S32 A;  3X1S D;  5GSU D;  3AV2 D;  1P3I D;  1P3M D;  5CPJ B;  1P3P B;  2BYK A;  5AVB B;  5CPJ C;  1P3P C;  2IO5 B;  1P3K B;  5FUG B;  5AVC B;  2IO5 C;  5GT0 B;  1KX4 B;  2BYM B;  3A6N D;  2BYM A;  1HQ3 B;  5B2I D;  3B6G B;  1HQ3 C;  2F8N G;  1HQ3 A;  3B6G C;  3B6G A;  3TU4 B;  1P3G A;  3TU4 C;  3W99 D;  1BFM A;  2ARO D;  1H3O B;  3MVD D;  3X1T D;  1P3G D;  3AZN D;  3AN2 D;  3MGQ C;  5B40 B;  3MGQ A;  3REJ B;  5BT1 C;  4G91 C;  3REJ C;  3UT9 D;  5B40 A;  5B40 C;  3X1V B;  2NQB A;  2NQB C;  3X1V C;  3X1V A;  1F66 B;  5B31 G;  4H9N B;  3AZG D;  1F66 C;  3AZM B;  1F66 A;  4WU9 D;  3AZM C;  5BT1 D;  3AZM A;  4CSR B;  2NQB D;  3W97 D;  3MGP D;  4CSR A;  4J8V B;  4J8V C;  4J8V A;  4WU8 D;  5JA4 B;  4ZUX B;  5GT3 D;  3UTA C;  3UTA A;  3REI D;  5JA4 A;  4ZUX C;  1P3F D;  5KDM A;  5B24 B;  3VH5 A;  3WA9 B;  3W98 D;  4X23 C;  3AZK B;  4X23 A;  5BNX B;  3KXB D;  3AZK C;  3AZK A;  3UTB C;  3UTB A;  4NE6 A;  3AZE C;  3AZE A;  3MNN B;  5B32 G;  3AV1 D;  5AV5 B;  1KU5 A;  4YS3 B;  1BH9 B;  5G49 A;  4YS3 C;  4YS3 A;  1BH9 A;  4Z66 B;  3NQJ B;  5AY8 B;  4KGC C;  2NZD D;  4KGC A;  5AY8 C;  3NQJ A;  5AY8 A;  4H9P B;  4XZQ B;  1M19 C;  1M19 A;  4J8X D;  1BH8 B;  4M6B A;  4G92 B;  4KGC D;  4XUJ D;  3MGR D;  3R45 B;  1WWS A;  4E44 A;  3KUY C;  3KUY A;  3AZJ B;  3R45 A;  3AZJ C;  4KUD B;  3AZJ A;  4EO5 B;  5B1M C;  5B0Y D;  5B1M A;  1AOI D;  4KUD C;  4KUD A;  3REH D;  5AV8 B;  4Z5T C;  3WAA D;  4Z5T A;  5AV8 C;  1U35 B;  5AV8 A;  3B0D B;  1U35 C;  5AV6 B;  3LJA D;  5DNN A;  4Z5T D;  3AFA D;  3LZ0 B;  2PYO B;  5BO0 B;  5JRG B;  1M1A D;  3LZ0 C;  3C1C B;  1P3B B;  3LZ0 A;  4JJN B;  2PYO C;  2PYO A;  2HIO B;  5CP6 D;  1M18 D;  4JJN C;  4JJN A;  3LZ1 D;  5DNN D;  4J8U B;  5B33 D;  4WV4 B;  4J8U C;  4J8U A;  2LY8 A;  3KSY A;  1TZY D;  4NE5 A;  3W96 B;  4QLC D;  3W96 C;  3W96 A;  4UUZ B;  4UUZ A;  4J8W D;  3KWQ D;  1S32 D;  5CPJ A;  5AVB C;  1P3P A;  5AVB A;  4YM6 B;  3WKJ B;  2YFW B;  4YM6 C;  1P3K C;  3WKJ C;  4YM6 A;  1P3K A;  3MGS B;  3WKJ A;  5AVC C;  1N1J B;  2YFW A;  3NQU B;  5FUG A;  5GT0 C;  5AVC A;  5GT0 A;  3MGS C;  3MGS A;  1KX4 C;  1KX4 A;  4HGA B;  3B0C T;  2L5A A;  5CPJ D;  1P3P D;  2JSS A;  5AVB D;  2F8N B;  3V9R B;  2F8N A;  3B6F B;  4AWL B;  1P3O B;  3TU4 A;  3B6F C;  3B6F A;  3WTP B;  1P3O C;  1P3O A;  5DNM B;  3WTP C;  3WTP A;  4NFT A;  1HQ3 D;  5DNM C;  5DNM A;  3B6G D;  1H3O A;  3TU4 D;  3REJ A;  1F1E A;  5B31 B;  3MVD B; 
#chains in the Genus database with same CATH topology
 1HTA A;  3MGQ D;  1Z2C B;  4H9N A;  5B40 D;  3REJ D;  4WZS B;  3X1V D;  1ULY A;  2HUE B;  1F66 D;  3AZG B;  2Y2G A;  5BNV B;  3EPH A;  3AZM D;  4ZUX A;  2Y2H A;  2Y2N A;  2G5I C;  3W97 B;  5B1L B;  5B24 C;  3H0M C;  4J8V D;  5B24 A;  4LD9 B;  3O62 B;  5GT3 B;  3UTA D;  3WA9 C;  3WA9 A;  4ZUX D;  4LD9 C;  5BNX A;  5B32 B;  1P3L B;  5B32 C;  3MNN C;  5B32 A;  3MNN A;  4X23 D;  1P3L C;  5AV5 C;  1P3L A;  5AV5 A;  4DRB A;  3AZK D;  5GXQ B;  3UTB D;  3REK B;  4Z66 C;  5GXQ C;  4Z66 A;  5GXQ A;  3AZE D;  5CPI B;  3REK C;  3REK A;  1KX3 B;  3AV1 B;  3MNN D;  4XZQ C;  3B0B A;  4H9P A;  4XZQ A;  5AV5 D;  1KX3 A;  1KX3 C;  4YS3 D;  1B67 A;  4H9R B;  3X1U B;  1P34 B;  5AY8 D;  1P34 C;  1BH8 A;  4G92 C;  1P34 A;  1EQZ B;  3AZH B;  5CPK B;  4H9S C;  4H9S A;  1EQZ C;  5CPK C;  1EQZ A;  4WJ3 C;  5CPK A;  3C1B B;  1M19 D;  4EO5 C;  5B0Z B;  3C1B C;  3C1B A;  1P3A B;  5B0Z C;  5B0Z A;  1P3A C;  3KUY D;  1P3A A;  3LEL B;  2Y2K A;  2CWE A;  3AZL B;  5AV9 B;  4DQY B;  3LEL C;  3AZJ D;  1U35 A;  3LEL A;  3AZL C;  5AV9 C;  3B0D C;  5AV9 A;  5B1M D;  5B0Y B;  4KUD D;  2XD1 A;  1AOI B;  2FJ7 B;  3H0R C;  3REH B;  3REL B;  5AV6 C;  2FJ7 C;  5AV6 A;  2FJ7 A;  4R8P B;  5AV8 D;  3REL C;  3REL A;  3AZF B;  1KX5 B;  4R8P C;  3AZF C;  1U35 D;  2ZY4 A;  2FFF B;  4R8P A;  3VH6 T;  3AZF A;  2DF4 C;  5JRG C;  5BO0 A;  3IP4 C;  5JRG A;  3C1C C;  3C1C A;  1P3B A;  4UPK A;  1P3B C;  4NE3 A;  3LJA B;  2HIO C;  3VH6 W;  3AZI B;  2HIO A;  1PZR A;  3AFA B;  3AZI C;  5E5A B;  3FDD A;  5E5A C;  3LZ0 D;  5E5A A;  4H9O B;  5JRG D;  2PYO D;  4JJN D;  1TAF B;  4H9O A;  1ID3 B;  5B2J B;  5F99 B;  1ID3 C;  1TAF A;  1ZLA B;  1ID3 A;  4J8U D;  1W2E A;  5F99 C;  2RVQ C;  5F99 A;  4CAY B;  3EPL A;  1TZY B;  3AYW B;  4QLC B;  2CV5 B;  3W96 D;  2JE5 A;  2CV5 C;  4E45 A;  3X1S B;  2CV5 A;  5GSU B;  3X1S C;  3X1S A;  5GSU C;  3AV2 B;  5GSU A;  1P3I B;  1N1J A;  3AV2 C;  1Q9C A;  3NQU A;  4Z2M H;  3AV2 A;  1P3M B;  2F8N K;  1P3M C;  2Y2Q A;  4HGA C;  1P3M A;  4YM6 D;  3B0C W;  1P3K D;  3WKJ D;  5AVC D;  4DRA A;  3V9R A;  5GT0 D;  3MGS D;  3A6N B;  2F2A C;  4AWL C;  1KX4 D;  2BYK B;  3A6N C;  3A6N A;  5B2I B;  5B2I C;  5B2I A;  2F8N D;  4WNN B;  3B6F D;  3W99 B;  1P3O D;  3EG5 B;  3W99 C;  4WNN A;  3WTP D;  3W99 A;  2F8N H;  2ARO B;  5DNM D;  2ARO C;  2ARO A;  4ZBJ B;  3X1T B;  1P3G B;  3AZN B;  5B31 C;  3MVD C;  3P5J B;  4ZBJ C;  5B31 A;  3MVD A;  3AN2 B;  3X1T C;  3AZN C;  3X1T A;  1P3G C;  3AZN A;  3AN2 C;  2RIQ A;  3AN2 A;  3UT9 B;  2YFV B;  3UT9 C;  3UT9 A;  4H9Q B;  2YFV A;  4H9Q A;  5B31 D;  2HUE C;  3MGQ B;  5CHL B;  3AZG C;  4WU9 B;  3AZG A;  4G91 B;  2NQB B;  5BNV A;  4WU9 C;  3MGP B;  4WU9 A;  3W97 C;  3MGP C;  3W97 A;  3MGP A;  1B6W A;  4WU8 B;  5B1L C;  5B1L A;  4WU8 C;  4WU8 A;  3REI B;  3O62 C;  5GT3 C;  1P3F B;  3O62 A;  5GT3 A;  4LD9 A;  3REI C;  3AL0 C;  3REI A;  1P3F C;  1P3F A;  1WWI A;  3VH6 A;  1T3U A;  5B24 D;  5B1L D;  1A7W A;  3UTA B;  3WA9 D;  3W98 B;  3O62 D;  4LD9 D;  3KXB B;  5KDM B;  3W98 C;  3W98 A;  3KXB C;  3KXB A;  3WTP E;  5CPI C;  1JFI B;  5B32 D;  5CPI A;  4X23 B;  3AV1 C;  1P3L D;  1JFI A;  3AV1 A;  3UTB B;  4Z66 D;  5GXQ D;  4H9R A;  2NZD B;  3AZE B;  3X1U C;  3X1U A;  3REK D;  2J8P A;  2NZD C;  2NZD A;  5CPI D;  4XZQ D;  1KX3 D;  3AZH C;  5G49 B;  3AZH A;  4J8X B;  4KGC B;  4J8X C;  3X1U D;  4XUJ B;  3MGR B;  4J8X A;  1P34 D;  4XUJ C;  3MGR C;  4XUJ A;  3MGR A;  1EQZ D;  3AZH D;  5CPK D;  3KFU G;  3AZL A;  1M19 B;  3C1B D;  5B0Y C;  5B0Y A;  1AOI C;  5B0Z D;  3REH C;  1AOI A;  3REH A;  3WAA B;  1P3A D;  3KUY B;  3WAA C;  1KX5 C;  3WAA A;  1KX5 A;  3LEL D;  3AZL D;  5AV9 D;  5B1M B;  5AV6 D;  2FJ7 D;  4Z5T B;  3LJA C;  3REL D;  3LJA A;  3AZI A;  4R8P D;  3AZF D;  3AFA C;  1KX5 D;  3AFA A;  1M1A B;  3VH5 T;  3C1C D;  5CP6 B;  1P3B D;  1M1A A;  1M18 B;  1M1A C;  2HIO D;  5CP6 C;  3LZ1 B;  5DNN B;  5CP6 A;  1M18 C;  1M18 A;  5B33 B;  3AZI D;  2BG1 A;  3VH5 W;  5DNN C;  3LZ1 A;  5B2J C;  3LZ1 C;  1ZLA C;  2JCH A;  5B2J A;  5B33 C;  5B33 A;  1ZLA A;  5E5A D;  4CAY A;  1TZY C;  1TZY A;  1R4V A;  3AYW C;  3AYW A;  4QLC C;  1ID3 D;  4QLC A;  5B2J D;  5F99 D;  1ZLA D;  2RVQ D;  5BS7 C;  4KHA B;  5BS7 A;  5C3I B;  4KHA A;  3EPK A;  5C3I C;  4J8W B;  1P3I C;  3KWQ B;  1S32 B;  3AYW D;  1P3I A;  4J8W C;  2CV5 D;  4J8W A;  3KWQ C;  4Z2M G;  1S32 C;  3KWQ A;  1S32 A;  3X1S D;  5GSU D;  2VQR A;  3AV2 D;  1P3I D;  1P3M D;  5CPJ B;  1P3P B;  2BYK A;  5AVB B;  5CPJ C;  1P3P C;  2IO5 B;  1P3K B;  5FUG B;  5AVC B;  2IO5 C;  5GT0 B;  1KX4 B;  2BYM B;  3A6N D;  2BYM A;  1HQ3 B;  5B2I D;  3B6G B;  1HQ3 C;  2F8N G;  1HQ3 A;  3B6G C;  3B6G A;  2Y2J A;  3TU4 B;  1P3G A;  3TU4 C;  3W99 D;  1BFM A;  2ARO D;  2XD5 A;  1H3O B;  3MVD D;  3X1T D;  1P3G D;  3AZN D;  3AN2 D;  3MGQ C;  5B40 B;  3MGQ A;  3REJ B;  5BT1 C;  4G91 C;  3REJ C;  3UT9 D;  5B40 A;  5B40 C;  3X1V B;  2NQB A;  2NQB C;  3X1V C;  3X1V A;  1F66 B;  5B31 G;  2ZY2 A;  3EPJ A;  4H9N B;  3AZG D;  1F66 C;  3AZM B;  3A1I A;  1F66 A;  4WU9 D;  2ZM5 A;  3AZM C;  5BT1 D;  3AZM A;  4CSR B;  2NQB D;  3W97 D;  3MGP D;  4CSR A;  4J8V B;  4J8V C;  4J8V A;  4WU8 D;  5JA4 B;  4ZUX B;  5GT3 D;  3UTA C;  3UTA A;  3REI D;  5JA4 A;  4ZUX C;  1P3F D;  5KDM A;  5B24 B;  3VH5 A;  3WA9 B;  2G5H C;  3H0L C;  3W98 D;  4X23 C;  3AZK B;  4X23 A;  5BNX B;  3KXB D;  3AZK C;  3AZK A;  3UTB C;  3UTB A;  4NE6 A;  3AZE C;  3AZE A;  3MNN B;  5B32 G;  3AV1 D;  5AV5 B;  1KU5 A;  4YS3 B;  1BH9 B;  5G49 A;  4YS3 C;  4YS3 A;  1BH9 A;  4Z66 B;  3NQJ B;  5AY8 B;  4KGC C;  2NZD D;  4KGC A;  5AY8 C;  3NQJ A;  5AY8 A;  4H9P B;  4XZQ B;  1M19 C;  1M19 A;  4J8X D;  1BH8 B;  4M6B A;  4G92 B;  4KGC D;  4XUJ D;  3MGR D;  3R45 B;  1WWS A;  4E44 A;  3KUY C;  3KUY A;  3AZJ B;  3R45 A;  3AZJ C;  3A1K A;  3AZJ A;  4EO5 B;  4KUD B;  5B1M C;  5B0Y D;  5B1M A;  1AOI D;  4KUD C;  4KUD A;  3REH D;  5AV8 B;  4Z5T C;  3WAA D;  4Z5T A;  5AV8 C;  1U35 B;  5AV8 A;  3B0D B;  1U35 C;  2DQN C;  5AV6 B;  2Y2M A;  3LJA D;  5DNN A;  4Z5T D;  3AFA D;  3LZ0 B;  2PYO B;  5BO0 B;  5JRG B;  1M1A D;  3LZ0 C;  3C1C B;  1P3B B;  3LZ0 A;  4JJN B;  2PYO C;  2PYO A;  2HIO B;  5CP6 D;  1M18 D;  4JJN C;  4JJN A;  3LZ1 D;  5DNN D;  4J8U B;  5B33 D;  4WV4 B;  4J8U C;  4J8U A;  2LY8 A;  3KSY A;  1TZY D;  4NE5 A;  3W96 B;  4QLC D;  3W96 C;  3W96 A;  2ZY3 A;  4UUZ B;  4UUZ A;  4J8W D;  3KWQ D;  3F6T A;  1S32 D;  5CPJ A;  5AVB C;  1P3P A;  5AVB A;  4YM6 B;  3WKJ B;  2YFW B;  4YM6 C;  1P3K C;  3WKJ C;  4YM6 A;  1P3K A;  3MGS B;  3WKJ A;  1N1J B;  2YFW A;  5AVC C;  5AVC A;  3NQU B;  5GT0 C;  5FUG A;  5GT0 A;  3MGS C;  3MGS A;  1KX4 C;  1KX4 A;  4HGA B;  3B0C T;  2L5A A;  5CPJ D;  1P3P D;  2JSS A;  5AVB D;  2F8N B;  2ZY5 A;  3V9R B;  2F8N A;  3B6F B;  4AWL B;  1P3O B;  3TU4 A;  3B6F C;  2W8S A;  3WTP B;  1P3O C;  2Y2L A;  2Y2O A;  1P3O A;  3B6F A;  5DNM B;  3WTP C;  3WTP A;  4NFT A;  1HQ3 D;  5DNM C;  5DNM A;  3B6G D;  1H3O A;  3TU4 D;  2Y2I A;  2Y2P A;  3REJ A;  1F1E A;  5B31 B;  3MVD B;  2UWX A; 
#chains in the Genus database with same CATH homology
 1HTA A;  3MGQ D;  1Z2C B;  4H9N A;  5B40 D;  3REJ D;  4WZS B;  3X1V D;  1ULY A;  2HUE B;  1F66 D;  3AZG B;  2Y2G A;  5BNV B;  3EPH A;  3AZM D;  4ZUX A;  2Y2H A;  2Y2N A;  2G5I C;  3W97 B;  5B1L B;  5B24 C;  3H0M C;  4J8V D;  5B24 A;  4LD9 B;  3O62 B;  5GT3 B;  3UTA D;  3WA9 C;  3WA9 A;  4ZUX D;  4LD9 C;  5BNX A;  5B32 B;  1P3L B;  5B32 C;  3MNN C;  5B32 A;  3MNN A;  4X23 D;  1P3L C;  5AV5 C;  1P3L A;  5AV5 A;  4DRB A;  3AZK D;  5GXQ B;  3UTB D;  3REK B;  4Z66 C;  5GXQ C;  4Z66 A;  5GXQ A;  3AZE D;  5CPI B;  3REK C;  3REK A;  1KX3 B;  3AV1 B;  3MNN D;  4XZQ C;  3B0B A;  4H9P A;  4XZQ A;  5AV5 D;  1KX3 A;  1KX3 C;  4YS3 D;  1B67 A;  4H9R B;  3X1U B;  1P34 B;  5AY8 D;  1P34 C;  1BH8 A;  4G92 C;  1P34 A;  1EQZ B;  3AZH B;  5CPK B;  4H9S C;  4H9S A;  1EQZ C;  5CPK C;  1EQZ A;  4WJ3 C;  5CPK A;  3C1B B;  1M19 D;  4EO5 C;  5B0Z B;  3C1B C;  3C1B A;  1P3A B;  5B0Z C;  5B0Z A;  1P3A C;  3KUY D;  1P3A A;  3LEL B;  2Y2K A;  2CWE A;  3AZL B;  5AV9 B;  4DQY B;  3LEL C;  3AZJ D;  1U35 A;  3LEL A;  3AZL C;  5AV9 C;  3B0D C;  5AV9 A;  5B1M D;  5B0Y B;  4KUD D;  2XD1 A;  1AOI B;  2FJ7 B;  3H0R C;  3REH B;  3REL B;  5AV6 C;  2FJ7 C;  5AV6 A;  2FJ7 A;  4R8P B;  5AV8 D;  3REL C;  3REL A;  3AZF B;  1KX5 B;  4R8P C;  3AZF C;  1U35 D;  2ZY4 A;  2FFF B;  4R8P A;  3VH6 T;  3AZF A;  2DF4 C;  5JRG C;  5BO0 A;  3IP4 C;  5JRG A;  3C1C C;  3C1C A;  1P3B A;  4UPK A;  1P3B C;  4NE3 A;  3LJA B;  2HIO C;  3VH6 W;  3AZI B;  2HIO A;  1PZR A;  3AFA B;  3AZI C;  5E5A B;  3FDD A;  5E5A C;  3LZ0 D;  5E5A A;  4H9O B;  5JRG D;  2PYO D;  4JJN D;  1TAF B;  4H9O A;  1ID3 B;  5B2J B;  5F99 B;  1ID3 C;  1TAF A;  1ZLA B;  1ID3 A;  4J8U D;  1W2E A;  5F99 C;  2RVQ C;  5F99 A;  4CAY B;  3EPL A;  1TZY B;  3AYW B;  4QLC B;  2CV5 B;  3W96 D;  2JE5 A;  2CV5 C;  4E45 A;  3X1S B;  2CV5 A;  5GSU B;  3X1S C;  3X1S A;  5GSU C;  3AV2 B;  5GSU A;  1P3I B;  1N1J A;  3AV2 C;  1Q9C A;  3NQU A;  4Z2M H;  3AV2 A;  1P3M B;  2F8N K;  1P3M C;  2Y2Q A;  4HGA C;  1P3M A;  4YM6 D;  3B0C W;  1P3K D;  3WKJ D;  5AVC D;  4DRA A;  3V9R A;  5GT0 D;  3MGS D;  3A6N B;  2F2A C;  4AWL C;  1KX4 D;  2BYK B;  3A6N C;  3A6N A;  5B2I B;  5B2I C;  5B2I A;  2F8N D;  4WNN B;  3B6F D;  3W99 B;  1P3O D;  3EG5 B;  3W99 C;  4WNN A;  3WTP D;  3W99 A;  2F8N H;  2ARO B;  5DNM D;  2ARO C;  2ARO A;  4ZBJ B;  3X1T B;  1P3G B;  3AZN B;  5B31 C;  3MVD C;  3P5J B;  4ZBJ C;  5B31 A;  3MVD A;  3AN2 B;  3X1T C;  3AZN C;  3X1T A;  1P3G C;  3AZN A;  3AN2 C;  2RIQ A;  3AN2 A;  3UT9 B;  2YFV B;  3UT9 C;  3UT9 A;  4H9Q B;  2YFV A;  4H9Q A;  5B31 D;  2HUE C;  3MGQ B;  5CHL B;  3AZG C;  4WU9 B;  3AZG A;  4G91 B;  2NQB B;  5BNV A;  4WU9 C;  3MGP B;  4WU9 A;  3W97 C;  3MGP C;  3W97 A;  3MGP A;  1B6W A;  4WU8 B;  5B1L C;  5B1L A;  4WU8 C;  4WU8 A;  3REI B;  3O62 C;  5GT3 C;  1P3F B;  3O62 A;  5GT3 A;  4LD9 A;  3REI C;  3AL0 C;  3REI A;  1P3F C;  1P3F A;  1WWI A;  3VH6 A;  1T3U A;  5B24 D;  5B1L D;  1A7W A;  3UTA B;  3WA9 D;  3W98 B;  3O62 D;  4LD9 D;  3KXB B;  5KDM B;  3W98 C;  3W98 A;  3KXB C;  3KXB A;  3WTP E;  5CPI C;  1JFI B;  5B32 D;  5CPI A;  4X23 B;  3AV1 C;  1P3L D;  1JFI A;  3AV1 A;  3UTB B;  4Z66 D;  5GXQ D;  4H9R A;  2NZD B;  3AZE B;  3X1U C;  3X1U A;  3REK D;  2J8P A;  2NZD C;  2NZD A;  5CPI D;  4XZQ D;  1KX3 D;  3AZH C;  5G49 B;  3AZH A;  4J8X B;  4KGC B;  4J8X C;  3X1U D;  4XUJ B;  3MGR B;  4J8X A;  1P34 D;  4XUJ C;  3MGR C;  4XUJ A;  3MGR A;  1EQZ D;  3AZH D;  5CPK D;  3KFU G;  3AZL A;  1M19 B;  3C1B D;  5B0Y C;  5B0Y A;  1AOI C;  5B0Z D;  3REH C;  1AOI A;  3REH A;  3WAA B;  1P3A D;  3KUY B;  3WAA C;  1KX5 C;  3WAA A;  1KX5 A;  3LEL D;  3AZL D;  5AV9 D;  5B1M B;  5AV6 D;  2FJ7 D;  4Z5T B;  3LJA C;  3REL D;  3LJA A;  3AZI A;  4R8P D;  3AZF D;  3AFA C;  1KX5 D;  3AFA A;  1M1A B;  3VH5 T;  3C1C D;  5CP6 B;  1P3B D;  1M1A A;  1M18 B;  1M1A C;  2HIO D;  5CP6 C;  3LZ1 B;  5DNN B;  5CP6 A;  1M18 C;  1M18 A;  5B33 B;  3AZI D;  2BG1 A;  3VH5 W;  5DNN C;  3LZ1 A;  5B2J C;  3LZ1 C;  1ZLA C;  2JCH A;  5B2J A;  5B33 C;  5B33 A;  1ZLA A;  5E5A D;  4CAY A;  1TZY C;  1TZY A;  1R4V A;  3AYW C;  3AYW A;  4QLC C;  1ID3 D;  4QLC A;  5B2J D;  5F99 D;  1ZLA D;  2RVQ D;  5BS7 C;  4KHA B;  5BS7 A;  5C3I B;  4KHA A;  3EPK A;  5C3I C;  4J8W B;  1P3I C;  3KWQ B;  1S32 B;  3AYW D;  1P3I A;  4J8W C;  2CV5 D;  4J8W A;  3KWQ C;  4Z2M G;  1S32 C;  3KWQ A;  1S32 A;  3X1S D;  5GSU D;  2VQR A;  3AV2 D;  1P3I D;  1P3M D;  5CPJ B;  1P3P B;  2BYK A;  5AVB B;  5CPJ C;  1P3P C;  2IO5 B;  1P3K B;  5FUG B;  5AVC B;  2IO5 C;  5GT0 B;  1KX4 B;  2BYM B;  3A6N D;  2BYM A;  1HQ3 B;  5B2I D;  3B6G B;  1HQ3 C;  2F8N G;  1HQ3 A;  3B6G C;  3B6G A;  2Y2J A;  3TU4 B;  1P3G A;  3TU4 C;  3W99 D;  1BFM A;  2ARO D;  2XD5 A;  1H3O B;  3MVD D;  3X1T D;  1P3G D;  3AZN D;  3AN2 D;  3MGQ C;  5B40 B;  3MGQ A;  3REJ B;  5BT1 C;  4G91 C;  3REJ C;  3UT9 D;  5B40 A;  5B40 C;  3X1V B;  2NQB A;  2NQB C;  3X1V C;  3X1V A;  1F66 B;  5B31 G;  2ZY2 A;  3EPJ A;  4H9N B;  3AZG D;  1F66 C;  3AZM B;  3A1I A;  1F66 A;  4WU9 D;  2ZM5 A;  3AZM C;  5BT1 D;  3AZM A;  4CSR B;  2NQB D;  3W97 D;  3MGP D;  4CSR A;  4J8V B;  4J8V C;  4J8V A;  4WU8 D;  5JA4 B;  4ZUX B;  5GT3 D;  3UTA C;  3UTA A;  3REI D;  5JA4 A;  4ZUX C;  1P3F D;  5KDM A;  5B24 B;  3VH5 A;  3WA9 B;  2G5H C;  3H0L C;  3W98 D;  4X23 C;  3AZK B;  4X23 A;  5BNX B;  3KXB D;  3AZK C;  3AZK A;  3UTB C;  3UTB A;  4NE6 A;  3AZE C;  3AZE A;  3MNN B;  5B32 G;  3AV1 D;  5AV5 B;  1KU5 A;  4YS3 B;  1BH9 B;  5G49 A;  4YS3 C;  4YS3 A;  1BH9 A;  4Z66 B;  3NQJ B;  5AY8 B;  4KGC C;  2NZD D;  4KGC A;  5AY8 C;  3NQJ A;  5AY8 A;  4H9P B;  4XZQ B;  1M19 C;  1M19 A;  4J8X D;  1BH8 B;  4M6B A;  4G92 B;  4KGC D;  4XUJ D;  3MGR D;  3R45 B;  1WWS A;  4E44 A;  3KUY C;  3KUY A;  3AZJ B;  3R45 A;  3AZJ C;  3A1K A;  3AZJ A;  4EO5 B;  4KUD B;  5B1M C;  5B0Y D;  5B1M A;  1AOI D;  4KUD C;  4KUD A;  3REH D;  5AV8 B;  4Z5T C;  3WAA D;  4Z5T A;  5AV8 C;  1U35 B;  5AV8 A;  3B0D B;  1U35 C;  2DQN C;  5AV6 B;  2Y2M A;  3LJA D;  5DNN A;  4Z5T D;  3AFA D;  3LZ0 B;  2PYO B;  5BO0 B;  5JRG B;  1M1A D;  3LZ0 C;  3C1C B;  1P3B B;  3LZ0 A;  4JJN B;  2PYO C;  2PYO A;  2HIO B;  5CP6 D;  1M18 D;  4JJN C;  4JJN A;  3LZ1 D;  5DNN D;  4J8U B;  5B33 D;  4WV4 B;  4J8U C;  4J8U A;  2LY8 A;  3KSY A;  1TZY D;  4NE5 A;  3W96 B;  4QLC D;  3W96 C;  3W96 A;  2ZY3 A;  4UUZ B;  4UUZ A;  4J8W D;  3KWQ D;  3F6T A;  1S32 D;  5CPJ A;  5AVB C;  1P3P A;  5AVB A;  4YM6 B;  3WKJ B;  2YFW B;  4YM6 C;  1P3K C;  3WKJ C;  4YM6 A;  1P3K A;  3MGS B;  3WKJ A;  1N1J B;  2YFW A;  5AVC C;  5AVC A;  3NQU B;  5GT0 C;  5FUG A;  5GT0 A;  3MGS C;  3MGS A;  1KX4 C;  1KX4 A;  4HGA B;  3B0C T;  2L5A A;  5CPJ D;  1P3P D;  2JSS A;  5AVB D;  2F8N B;  2ZY5 A;  3V9R B;  2F8N A;  3B6F B;  4AWL B;  1P3O B;  3TU4 A;  3B6F C;  2W8S A;  3WTP B;  1P3O C;  2Y2L A;  2Y2O A;  1P3O A;  3B6F A;  5DNM B;  3WTP C;  3WTP A;  4NFT A;  1HQ3 D;  5DNM C;  5DNM A;  3B6G D;  1H3O A;  3TU4 D;  2Y2I A;  2Y2P A;  3REJ A;  1F1E A;  5B31 B;  3MVD B;  2UWX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...