4ZBJB

Ubn1 peptide bound to h3.3/h4/asf1
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
74
structure length
74
Chain Sequence
b'ALIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone chaperone ASF1
publication title Ubinuclein-1 confers histone H3.3-specific-binding by the HIRA histone chaperone complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Structural protein
total genus 26
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2015-04-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4zbjB00
3LZ1D 4J8VC 3VH6A 3MNNC 2YFVA 3X1UA 4DRBA 2L5AA 2IO5C 1KX5D 4XUJA 4X23D 5AV5D 3AZLB 3C1BB 3AZIC 1M1AC 1M19C 5BNVB 1U35D 1P3KA 3B6GD 4LD9C 3AZKD 3AFAA 5CP6C 4WU9A 3W97D 4XZQB 3UTBC 1P3GD 4J8VA 1ID3D 3MNNA 3X1SB 3AV1B 3REKC 3TU4D 4CAYB 3B0DB 3REJD 3AZIA 3KUYA 5CPKC 1P3MD 1M1AA 1M19A 5AV9C 1M18B 3A6NC 4J8XC 4LD9A 3UT9C 3W97A 3C1CC 4HGAC 4QLCC 1EQZD 3MGPC 5B2JD 5CP6A 3AZMB 4WU8D 3NQJA 3MVDD 3AN2D 5B40B 3WAAC 3UTBA 3LZ1B 4KGCD 4E45A 3UTAC 3AZEC 2JSSA 1KX5B 3REKA 3AYWD 4X23B 5AV5B 5BO0A 2NZDC 1JFIA 3W98C 5CPKA 1U35B 4YM6D 5BT1C 3B6GB 3REHC 4J8UD 3AZKB 3KUYB 5AV9A 3REIC 3B6FD 4J8XA 2PYOC 3MGRD 4KHAB 3C1CA 4QLCA 3LJAC 3MGPA 4WZSB 2RVQC 5AY8D 3AZNC 3V9RB 3W97B 1HTAA 4H9NA 5CPJD 5E5AC 3WAAA 5BS7C 5GT0D 2CV5D 1KX4D 1ID3B 3UTAA 2FJ7C 3TU4B 3AZEA 5B0ZC 5B33D 3REJB 3KXBC 2HIOC 1P3MB 4H9OB 1P3LC 2NZDA 3W98A 5AV6C 4ZBJC 5B32D 4CSRB 4Z66D 3REHA 3AZJD 3WTPC 3REIA 2F8ND 2PYOA 5G49B 1EQZB 3X1VC 5B2JB 4WU8B 1TZYD 3LJAA 3MVDB 4J8XB 3AZNA 5F99C 1S32D 5GT3D 4WNNB 5E5AA 3AZLC 1R4VA 5BS7A 3C1BC 2FJ7A 5B0ZA 3AYWB 4J8WD 3KXBA 2HIOA 1P3LA 3AZHD 5B1LD 5AV6A 4YM6B 4AWLB 4J8UB 3AZGC 3B6FB 1HQ3D 4XZQC 3MGRB 3X1VA 4ZUXD 5AY8B 3VH5W 3X1SC 3AV1C 5F99A 3AZFD 3B0DC 5CPJB 5GT0B 1KX4B 2CV5B 1AOID 3AZLA 5AVCD 3C1BA 5B31C 3WTPE 3W99D 5B33B 1M18C 2LY8A 2BYKB 3LELD 5B32B 4R8PA 4Z66B 3AZMC 4H9QB 3AZJB 3AZGA 1P3BD 5B40C 2F8NB 4KUDD 4XZQA 1B67A 3LZ1C 3VH6T 3X1SA 1S32B 1KX5C 5GT3B 2BYMB 4X23C 4CAYA 3MGSD 1P34D 5AV5C 1BH9B 1P3OD 5F99B 5B31A 1U35C 3B6GC 4J8WB 3AZKC 3KUYC 3LZ0D 1M18A 3RELD 3AZHB 5B1LB 3W96D 5DNND 3AZMA 5B0YD 3KWQD 3W97C 2YFWB 5B40A 4R8PB 1P3GC 5JA4B 3LZ1A 4ZUXB 3AZGB 1ID3C 4H9RB 1F66D 3TU4C 1TAFB 3AZFB 1KX5A 1P3AD 3REJC 4X23A 1AOIB 5AV5A 5AVCB 1P3MC 3W99B 1U35A 3B6GA 1A7WA 3WKJD 4M6BA 3AZKA 3LELB 5B31B 1EQZC 4KHAA 3NQUB 5B2JC 4WU8C 4Z5TD 3MVDC 1P3BB 3V9RA 4KUDB 4NE6A 1P3GA 4KGCC 4EO5B 1ID3A 3TU4A 3AYWC 3MGSB 3REJA 1KU5A 1P34B 1P3OB 5JRGD 1P3MA 4H9OA 4YM6C 4AWLC 4J8UC 4CSRA 5DNMD 3LZ0B 3B6FC 3MGRC 3RELB 3W96B 5G49A 1EQZA 5DNNB 5B2JA 5AY8C 5B24D 3R45B 5B0YB 4WU8A 5C3IB 3MVDA 3KWQB 3AN2A 5CPJC 5GT0C 1KX4C 2CV5C 4KGCA 4WNNA 1F66B 1KX3D 5B33C 4YS3D 3O62D 1P3AB 1P3GB 1ZLAD 3AYWA 4UUZA 5B2ID 1N1JB 1P3PD 5B32C 4YM6A 4Z66C 4Z2MG 4J8UA 3AZJC 5CPID 3WKJB 3B6FA 3MGRA 1TZYC 4Z5TB 3MGQD 5AY8A 1S32C 5GT3C 5CPJA 5GT0A 1KX4A 2CV5A 3AN2B 5AVBD 4NFTA 5B33A 4KGCB 1P3ID 4J8WC 1P3FD 5JRGB 1BFMA 5B1MD 2BYKA 2AROD 3AZHC 5B1LC 3WA9D 5B32A 4UUZB 4WV4B 4Z66A 5DNMB 4H9QA 3AZJA 1BH8B 1HQ3C 4R8PC 2F8NA 4G92B 4ZUXC 1TZYA 5B24B 3X1TD 5GXQD 3AZFC 1S32A 5GT3A 5KDMB 2BYMA 5GSUD 1AOIC 1BH9A 5AVCC 3WTPD 4JJND 1KX3B 1WWSA 3KSYA 3W99C 3O62B 1ZLAB 1H3OB 5B2IB 4J8WA 3VH5A 3LELC 1P3PB 3AZHA 5B1LA 2NQBD 5CPIB 1P3BC 1HQ3A 4KUDC 2HUEB 2YFWA 5JA4A 4EO5C 3MGQB 4G91B 4ZUXA 4H9RA 3AV2D 1TAFA 3MGSC 3AZFA 3B0CT 1P34C 1TZYB 1P3OC 1AOIA 5AVCA 5AVBB 5AV8D 3W99A 1P3IB 4NE5A 1P3FB 3LZ0C 5B1MB 3AV1D 3LELA 2AROB 3RELC 5CHLB 3W96C 3WA9B 5DNNC 3NQUA 5FUGB 3X1UD 5B0YC 3KWQC 5C3IC 1P3BA 4XUJD 2CWEA 4KUDA 3X1TB 1F66C 1HQ3B 1WWIA 5GXQB 1P3KD 1P3AC 5GSUB 3VH6W 3MGSA 3AFAD 1P34A 1P3OA 1B6WA 4JJNB 4H9SC 4WU9D 4DRAA 3WKJC 3LZ0A 3RELA 3W96A 2NQBB 5DNNA 4J8VD 3MNND 4Z5TC 4Z2MH 3R45A 5B0YA 3KWQA 4H9PB 3AZID 3KUYD 1M1AD 1M19D 3AN2C 1F66A 3AV2B 5B32G 1P3AA 5JRGC 4LD9D 1N1JA 2F8NG 5AV8B 5CP6D 4H9SA 5DNMC 3WKJA 4G92C 3UTBD 2YFVB 3X1UB 5B24C 4Z5TA 3REKD 4XUJB 5CPKD 1KX3C 4YS3C 3O62C 1P3KB 1ZLAC 5AV9D 5B2IC 3AFAB 5JRGA 3A6ND 4J8XD 3UT9D 3C1CD 4QLCD 1P3PC 3MGPD 4WU9B 5CPIC 5DNMA 1BH8A 2HUEC 3WAAD 4J8VB 3MNNB 3MGQC 3UTAD 4G91C 5B24A 3AZED 2IO5B 5KDMA 3AZIB 1M1AB 2NZDD 1M19B 3W98D 3A6NA 5B31G 5AVBC 3UT9A 1KX3A 3O62A 5BT1D 4YS3A 3REHD 1P3IC 1H3OA 1P3FC 1ZLAA 4LD9B 5B1MC 5B2IA 3REID 2PYOD 2AROC 1P3PA 5CP6B 3WA9C 3LJAD 2RVQD 3NQJB 3AZND 5CPIA 2F8NK 3UTBB 5E5AD 3X1TC 3MGQA 2FJ7D 3REKB 5GXQC 5B0ZD 5GSUC 5BO0B 3KXBD 2HIOD 1JFIB 4JJNC 5CPKB 1P3LD 5AV6D 1F1EA 5AVBA 5AV9B 1P3IA 3VH5T 1P3FA 3A6NB 5B1MA 3UT9B 3C1CB 4QLCB 4HGAB 2AROA 4YS3B 3MGPB 3X1VD 2NQBC 3WA9A 5FUGA 4NE3A 4H9NB 5F99D 3WAAB 3AZLD 3C1BD 3UTAB 3X1TA 3AZEB 1Q9CA 3AV2C 5GXQA 5GSUA 2NZDB 3W98B 3WTPA 4JJNA 4R8PD 5AV8C 3B0BA 5BNXA 3REHB 3AZGD 3REIB 2PYOB 4XZQD 2F8NH 3LJAB 2NQBA 3X1UC 3AZNB 3X1SD 5BNVA 4XUJC 5E5AB 4H9PA 2FJ7B 5B31D 5B0ZB 1P3KC 3AV2A 3KXBB 3AFAC 2HIOB 1M18D 1P3LB 5AV6B 4ZBJB 5AV8A 4WU9C 3B0CW 3AZMD 3WTPB 1ULYA 4E44A 5B40D 3AV1A 5BNXB 3X1VB
chains in the Genus database with same CATH superfamily
3LZ1D 4J8VC 3VH6A 3AL0C 3MNNC 2YFVA 3X1UA 4DRBA 2L5AA 2IO5C 1KX5D 4XUJA 1W2EA 4X23D 5AV5D 3AZLB 3C1BB 3AZIC 1M1AC 1M19C 5BNVB 1U35D 1P3KA 3B6GD 3A1IA 4LD9C 3AZKD 3AFAA 2Y2QA 5CP6C 4WU9A 3W97D 4XZQB 3UTBC 1P3GD 4J8VA 1ID3D 3MNNA 3X1SB 3AV1B 3REKC 3TU4D 4CAYB 3B0DB 3REJD 3AZIA 3KUYA 5CPKC 1P3MD 1M1AA 1M19A 5AV9C 1M18B 3A6NC 4J8XC 4LD9A 3UT9C 3W97A 3C1CC 4HGAC 4QLCC 1EQZD 3MGPC 5B2JD 5CP6A 3EPKA 3AZMB 4WU8D 3NQJA 3MVDD 3AN2D 5B40B 3WAAC 3UTBA 3LZ1B 4KGCD 4E45A 3UTAC 3AZEC 3EPJA 2JSSA 1KX5B 3REKA 3AYWD 4X23B 5AV5B 5BO0A 2NZDC 1JFIA 3W98C 5CPKA 3F6TA 1U35B 4YM6D 5BT1C 3B6GB 3REHC 4J8UD 3AZKB 3KUYB 5AV9A 3REIC 3B6FD 4J8XA 2PYOC 3MGRD 4KHAB 3C1CA 4QLCA 3LJAC 3MGPA 2JCHA 4WZSB 2RVQC 5AY8D 3AZNC 3V9RB 3W97B 1HTAA 2Y2MA 4H9NA 3EPLA 5CPJD 5E5AC 3WAAA 5BS7C 5GT0D 2CV5D 1KX4D 1ID3B 3UTAA 2FJ7C 3TU4B 3AZEA 5B0ZC 5B33D 3REJB 3KXBC 2HIOC 1P3MB 4H9OB 1P3LC 2NZDA 3W98A 5AV6C 2ZM5A 4ZBJC 5B32D 3EPHA 4CSRB 4Z66D 3REHA 3AZJD 3WTPC 3REIA 2F8ND 2PYOA 5G49B 1EQZB 3X1VC 5B2JB 4WU8B 1TZYD 3LJAA 3MVDB 4J8XB 3AZNA 5F99C 1S32D 5GT3D 4DQYB 4WNNB 5E5AA 3AZLC 1R4VA 5BS7A 3C1BC 2FJ7A 5B0ZA 3AYWB 4J8WD 3KXBA 2HIOA 1P3LA 3AZHD 5B1LD 5AV6A 4YM6B 4AWLB 4J8UB 3AZGC 3B6FB 1HQ3D 4XZQC 3MGRB 1PZRA 3X1VA 4ZUXD 5AY8B 3VH5W 3X1SC 2G5HC 3AV1C 2Y2LA 3A1KA 5F99A 3AZFD 3B0DC 5CPJB 5GT0B 2XD1A 2CV5B 1KX4B 1AOID 3AZLA 5AVCD 3C1BA 5B31C 3WTPE 2DF4C 3W99D 5B33B 1M18C 2LY8A 2BYKB 3LELD 5B32B 4R8PA 4Z66B 3AZMC 4H9QB 3AZJB 3AZGA 1P3BD 5B40C 2F8NB 4KUDD 4XZQA 1B67A 3LZ1C 3VH6T 3X1SA 1S32B 1KX5C 5GT3B 2BYMB 4X23C 4CAYA 3MGSD 1P34D 5AV5C 1BH9B 1P3OD 5F99B 5B31A 1U35C 3B6GC 4J8WB 3AZKC 3KUYC 3IP4C 3LZ0D 1M18A 3RELD 3AZHB 5B1LB 2ZY2A 3W96D 1T3UA 5DNND 3AZMA 5B0YD 3KWQD 3W97C 2YFWB 5B40A 4R8PB 1P3GC 5JA4B 3LZ1A 4ZUXB 3AZGB 1ID3C 4H9RB 1F66D 1Z2CB 3TU4C 1TAFB 3AZFB 1KX5A 1P3AD 3REJC 4X23A 1AOIB 5AV5A 5AVCB 1P3MC 2ZY4A 2VQRA 3W99B 1U35A 3B6GA 1A7WA 3WKJD 4M6BA 3AZKA 3LELB 5B31B 1EQZC 4KHAA 3NQUB 5B2JC 4WU8C 4Z5TD 3MVDC 1P3BB 3V9RA 4KUDB 4NE6A 1P3GA 4KGCC 4EO5B 1ID3A 3TU4A 3AYWC 3MGSB 3REJA 1KU5A 1P34B 1P3OB 2Y2GA 5JRGD 1P3MA 4H9OA 4YM6C 4AWLC 4J8UC 4CSRA 5DNMD 3LZ0B 3B6FC 3MGRC 3RELB 3W96B 5G49A 1EQZA 5DNNB 2Y2PA 5B2JA 5AY8C 5B24D 3R45B 5B0YB 4WU8A 2Y2HA 5C3IB 3MVDA 3KWQB 3AN2A 2JE5A 5CPJC 5GT0C 1KX4C 2CV5C 4KGCA 4WNNA 1F66B 1KX3D 5B33C 4YS3D 3O62D 1P3AB 1P3GB 1ZLAD 3AYWA 4UUZA 5B2ID 1N1JB 1P3PD 5B32C 4YM6A 4Z66C 2RIQA 4Z2MG 4J8UA 3AZJC 5CPID 3WKJB 3B6FA 2FFFB 3MGRA 1TZYC 4Z5TB 3MGQD 5AY8A 1S32C 5GT3C 5CPJA 5GT0A 1KX4A 2CV5A 3AN2B 5AVBD 4NFTA 5B33A 4KGCB 1P3ID 4J8WC 1P3FD 5JRGB 1BFMA 5B1MD 2BYKA 2AROD 3AZHC 5B1LC 3WA9D 5B32A 4UUZB 4WV4B 4Z66A 5DNMB 4H9QA 3AZJA 1BH8B 1HQ3C 4R8PC 2F8NA 4G92B 4ZUXC 1TZYA 5B24B 3X1TD 3H0MC 5GXQD 3AZFC 1S32A 5GT3A 5KDMB 2BYMA 5GSUD 1AOIC 1BH9A 5AVCC 3WTPD 4JJND 1KX3B 1WWSA 3KSYA 3W99C 3O62B 1ZLAB 1H3OB 5B2IB 4J8WA 3VH5A 3LELC 1P3PB 3AZHA 5B1LA 2NQBD 5CPIB 1P3BC 1HQ3A 4KUDC 2HUEB 2YFWA 5JA4A 4UPKA 2XD5A 4EO5C 4G91B 4ZUXA 3MGQB 4H9RA 3FDDA 3AV2D 1TAFA 3MGSC 3AZFA 3B0CT 1P34C 1TZYB 1P3OC 1AOIA 5AVCA 5AVBB 5AV8D 3W99A 1P3IB 4NE5A 1P3FB 3LZ0C 5B1MB 3AV1D 3LELA 2AROB 3RELC 5CHLB 3W96C 3WA9B 5DNNC 3NQUA 5FUGB 3X1UD 5B0YC 3KWQC 5C3IC 1P3BA 2BG1A 4XUJD 2CWEA 4KUDA 3X1TB 1F66C 1HQ3B 1WWIA 5GXQB 1P3KD 1P3AC 5GSUB 3VH6W 3MGSA 3AFAD 1P34A 1P3OA 1B6WA 4JJNB 3H0LC 4H9SC 4WU9D 4DRAA 3WKJC 3LZ0A 2ZY3A 3RELA 3W96A 2NQBB 5DNNA 4J8VD 3MNND 4Z5TC 4Z2MH 3R45A 5B0YA 3KWQA 4H9PB 3AZID 3KUYD 1M1AD 1M19D 3AN2C 1F66A 2Y2NA 3H0RC 3AV2B 5B32G 1P3AA 5JRGC 4LD9D 1N1JA 2F8NG 5AV8B 5CP6D 4H9SA 5DNMC 3WKJA 4G92C 3UTBD 2YFVB 3X1UB 2UWXA 5B24C 4Z5TA 3REKD 4XUJB 2Y2JA 5CPKD 1KX3C 4YS3C 3O62C 1P3KB 1ZLAC 2J8PA 5AV9D 5B2IC 3AFAB 5JRGA 3A6ND 4J8XD 3UT9D 3C1CD 4QLCD 1P3PC 3MGPD 4WU9B 5CPIC 5DNMA 1BH8A 2HUEC 3WAAD 4J8VB 3MNNB 3MGQC 3UTAD 4G91C 5B24A 3AZED 2IO5B 5KDMA 3AZIB 1M1AB 2NZDD 1M19B 3W98D 3A6NA 5B31G 5AVBC 3UT9A 1KX3A 3O62A 5BT1D 4YS3A 3REHD 1P3IC 1H3OA 2G5IC 1P3FC 1ZLAA 4LD9B 5B1MC 5B2IA 3REID 2PYOD 2AROC 1P3PA 5CP6B 3WA9C 3LJAD 2RVQD 3NQJB 3AZND 5CPIA 2F8NK 3UTBB 5E5AD 3X1TC 4WJ3C 3MGQA 3EG5B 2FJ7D 3REKB 5GXQC 5B0ZD 2F2AC 5GSUC 5BO0B 3KXBD 2HIOD 1JFIB 4JJNC 5CPKB 1P3LD 5AV6D 1F1EA 5AVBA 3P5JB 5AV9B 1P3IA 3VH5T 1P3FA 3A6NB 5B1MA 3UT9B 3C1CB 4HGAB 4QLCB 2AROA 4YS3B 3MGPB 3X1VD 2ZY5A 2NQBC 3WA9A 5FUGA 4NE3A 4H9NB 5F99D 3WAAB 3KFUG 3AZLD 3C1BD 3UTAB 3X1TA 3AZEB 1Q9CA 3AV2C 5GXQA 2DQNC 5GSUA 2NZDB 3W98B 3WTPA 4JJNA 4R8PD 5AV8C 3B0BA 5BNXA 3REHB 3AZGD 3REIB 2PYOB 4XZQD 2Y2OA 2F8NH 3LJAB 2NQBA 3X1UC 3AZNB 2Y2KA 3X1SD 5BNVA 4XUJC 5E5AB 4H9PA 2FJ7B 2W8SA 5B31D 5B0ZB 1P3KC 2Y2IA 3AV2A 3KXBB 3AFAC 2HIOB 1M18D 1P3LB 5AV6B 4ZBJB 5AV8A 4WU9C 3B0CW 3AZMD 3WTPB 1ULYA 4E44A 5B40D 3AV1A 5BNXB 3X1VB
chains in the Genus database with same CATH topology
3LZ1D 4J8VC 3VH6A 3AL0C 3MNNC 2YFVA 3X1UA 4DRBA 2L5AA 2IO5C 1KX5D 4XUJA 1W2EA 4X23D 5AV5D 3AZLB 3C1BB 3AZIC 1M1AC 1M19C 5BNVB 1U35D 1P3KA 3B6GD 3A1IA 4LD9C 3AZKD 3AFAA 2Y2QA 5CP6C 4WU9A 3W97D 4XZQB 3UTBC 1P3GD 4J8VA 1ID3D 3MNNA 3X1SB 3AV1B 3REKC 3TU4D 4CAYB 3B0DB 3REJD 3AZIA 3KUYA 5CPKC 1P3MD 1M1AA 1M19A 5AV9C 1M18B 3A6NC 4J8XC 4LD9A 3UT9C 3W97A 3C1CC 4HGAC 4QLCC 1EQZD 3MGPC 5B2JD 5CP6A 3EPKA 3AZMB 4WU8D 3NQJA 3MVDD 3AN2D 5B40B 3WAAC 3UTBA 3LZ1B 4KGCD 4E45A 3UTAC 3AZEC 3EPJA 2JSSA 1KX5B 3REKA 3AYWD 4X23B 5AV5B 5BO0A 2NZDC 1JFIA 3W98C 5CPKA 3F6TA 1U35B 4YM6D 5BT1C 3B6GB 3REHC 4J8UD 3AZKB 3KUYB 5AV9A 3REIC 3B6FD 4J8XA 2PYOC 3MGRD 4KHAB 3C1CA 4QLCA 3LJAC 3MGPA 2JCHA 4WZSB 2RVQC 5AY8D 3AZNC 3V9RB 3W97B 1HTAA 2Y2MA 4H9NA 3EPLA 5CPJD 5E5AC 3WAAA 5BS7C 5GT0D 2CV5D 1KX4D 1ID3B 3UTAA 2FJ7C 3TU4B 3AZEA 5B0ZC 5B33D 3REJB 3KXBC 2HIOC 1P3MB 4H9OB 1P3LC 2NZDA 3W98A 5AV6C 2ZM5A 4ZBJC 5B32D 3EPHA 4CSRB 4Z66D 3REHA 3AZJD 3WTPC 3REIA 2F8ND 2PYOA 5G49B 1EQZB 3X1VC 5B2JB 4WU8B 1TZYD 3LJAA 3MVDB 4J8XB 3AZNA 5F99C 1S32D 5GT3D 4DQYB 4WNNB 5E5AA 3AZLC 1R4VA 5BS7A 3C1BC 2FJ7A 5B0ZA 3AYWB 4J8WD 3KXBA 2HIOA 1P3LA 3AZHD 5B1LD 5AV6A 4YM6B 4AWLB 4J8UB 3AZGC 3B6FB 1HQ3D 4XZQC 3MGRB 1PZRA 3X1VA 4ZUXD 5AY8B 3VH5W 3X1SC 2G5HC 3AV1C 2Y2LA 3A1KA 5F99A 3AZFD 3B0DC 5CPJB 5GT0B 2XD1A 2CV5B 1KX4B 1AOID 3AZLA 5AVCD 3C1BA 5B31C 3WTPE 2DF4C 3W99D 5B33B 1M18C 2LY8A 2BYKB 3LELD 5B32B 4R8PA 4Z66B 3AZMC 4H9QB 3AZJB 3AZGA 1P3BD 5B40C 2F8NB 4KUDD 4XZQA 1B67A 3LZ1C 3VH6T 3X1SA 1S32B 1KX5C 5GT3B 2BYMB 4X23C 4CAYA 3MGSD 1P34D 5AV5C 1BH9B 1P3OD 5F99B 5B31A 1U35C 3B6GC 4J8WB 3AZKC 3KUYC 3IP4C 3LZ0D 1M18A 3RELD 3AZHB 5B1LB 2ZY2A 3W96D 1T3UA 5DNND 3AZMA 5B0YD 3KWQD 3W97C 2YFWB 5B40A 4R8PB 1P3GC 5JA4B 3LZ1A 4ZUXB 3AZGB 1ID3C 4H9RB 1F66D 1Z2CB 3TU4C 1TAFB 3AZFB 1KX5A 1P3AD 3REJC 4X23A 1AOIB 5AV5A 5AVCB 1P3MC 2ZY4A 2VQRA 3W99B 1U35A 3B6GA 1A7WA 3WKJD 4M6BA 3AZKA 3LELB 5B31B 1EQZC 4KHAA 3NQUB 5B2JC 4WU8C 4Z5TD 3MVDC 1P3BB 3V9RA 4KUDB 4NE6A 1P3GA 4KGCC 4EO5B 1ID3A 3TU4A 3AYWC 3MGSB 3REJA 1KU5A 1P34B 1P3OB 2Y2GA 5JRGD 1P3MA 4H9OA 4YM6C 4AWLC 4J8UC 4CSRA 5DNMD 3LZ0B 3B6FC 3MGRC 3RELB 3W96B 5G49A 1EQZA 5DNNB 2Y2PA 5B2JA 5AY8C 5B24D 3R45B 5B0YB 4WU8A 2Y2HA 5C3IB 3MVDA 3KWQB 3AN2A 2JE5A 5CPJC 5GT0C 1KX4C 2CV5C 4KGCA 4WNNA 1F66B 1KX3D 5B33C 4YS3D 3O62D 1P3AB 1P3GB 1ZLAD 3AYWA 4UUZA 5B2ID 1N1JB 1P3PD 5B32C 4YM6A 4Z66C 2RIQA 4Z2MG 4J8UA 3AZJC 5CPID 3WKJB 3B6FA 2FFFB 3MGRA 1TZYC 4Z5TB 3MGQD 5AY8A 1S32C 5GT3C 5CPJA 5GT0A 1KX4A 2CV5A 3AN2B 5AVBD 4NFTA 5B33A 4KGCB 1P3ID 4J8WC 1P3FD 5JRGB 1BFMA 5B1MD 2BYKA 2AROD 3AZHC 5B1LC 3WA9D 5B32A 4UUZB 4WV4B 4Z66A 5DNMB 4H9QA 3AZJA 1BH8B 1HQ3C 4R8PC 2F8NA 4G92B 4ZUXC 1TZYA 5B24B 3X1TD 3H0MC 5GXQD 3AZFC 1S32A 5GT3A 5KDMB 2BYMA 5GSUD 1AOIC 1BH9A 5AVCC 3WTPD 4JJND 1KX3B 1WWSA 3KSYA 3W99C 3O62B 1ZLAB 1H3OB 5B2IB 4J8WA 3VH5A 3LELC 1P3PB 3AZHA 5B1LA 2NQBD 5CPIB 1P3BC 1HQ3A 4KUDC 2HUEB 2YFWA 5JA4A 4UPKA 2XD5A 4EO5C 4G91B 4ZUXA 3MGQB 4H9RA 3FDDA 3AV2D 1TAFA 3MGSC 3AZFA 3B0CT 1P34C 1TZYB 1P3OC 1AOIA 5AVCA 5AVBB 5AV8D 3W99A 1P3IB 4NE5A 1P3FB 3LZ0C 5B1MB 3AV1D 3LELA 2AROB 3RELC 5CHLB 3W96C 3WA9B 5DNNC 3NQUA 5FUGB 3X1UD 5B0YC 3KWQC 5C3IC 1P3BA 2BG1A 4XUJD 2CWEA 4KUDA 3X1TB 1F66C 1HQ3B 1WWIA 5GXQB 1P3KD 1P3AC 5GSUB 3VH6W 3MGSA 3AFAD 1P34A 1P3OA 1B6WA 4JJNB 3H0LC 4H9SC 4WU9D 4DRAA 3WKJC 3LZ0A 2ZY3A 3RELA 3W96A 2NQBB 5DNNA 4J8VD 3MNND 4Z5TC 4Z2MH 3R45A 5B0YA 3KWQA 4H9PB 3AZID 3KUYD 1M1AD 1M19D 3AN2C 1F66A 2Y2NA 3H0RC 3AV2B 5B32G 1P3AA 5JRGC 4LD9D 1N1JA 2F8NG 5AV8B 5CP6D 4H9SA 5DNMC 3WKJA 4G92C 3UTBD 2YFVB 3X1UB 2UWXA 5B24C 4Z5TA 3REKD 4XUJB 2Y2JA 5CPKD 1KX3C 4YS3C 3O62C 1P3KB 1ZLAC 2J8PA 5AV9D 5B2IC 3AFAB 5JRGA 3A6ND 4J8XD 3UT9D 3C1CD 4QLCD 1P3PC 3MGPD 4WU9B 5CPIC 5DNMA 1BH8A 2HUEC 3WAAD 4J8VB 3MNNB 3MGQC 3UTAD 4G91C 5B24A 3AZED 2IO5B 5KDMA 3AZIB 1M1AB 2NZDD 1M19B 3W98D 3A6NA 5B31G 5AVBC 3UT9A 1KX3A 3O62A 5BT1D 4YS3A 3REHD 1P3IC 1H3OA 2G5IC 1P3FC 1ZLAA 4LD9B 5B1MC 5B2IA 3REID 2PYOD 2AROC 1P3PA 5CP6B 3WA9C 3LJAD 2RVQD 3NQJB 3AZND 5CPIA 2F8NK 3UTBB 5E5AD 3X1TC 4WJ3C 3MGQA 3EG5B 2FJ7D 3REKB 5GXQC 5B0ZD 2F2AC 5GSUC 5BO0B 3KXBD 2HIOD 1JFIB 4JJNC 5CPKB 1P3LD 5AV6D 1F1EA 5AVBA 3P5JB 5AV9B 1P3IA 3VH5T 1P3FA 3A6NB 5B1MA 3UT9B 3C1CB 4HGAB 4QLCB 2AROA 4YS3B 3MGPB 3X1VD 2ZY5A 2NQBC 3WA9A 5FUGA 4NE3A 4H9NB 5F99D 3WAAB 3KFUG 3AZLD 3C1BD 3UTAB 3X1TA 3AZEB 1Q9CA 3AV2C 5GXQA 2DQNC 5GSUA 2NZDB 3W98B 3WTPA 4JJNA 4R8PD 5AV8C 3B0BA 5BNXA 3REHB 3AZGD 3REIB 2PYOB 4XZQD 2Y2OA 2F8NH 3LJAB 2NQBA 3X1UC 3AZNB 2Y2KA 3X1SD 5BNVA 4XUJC 5E5AB 4H9PA 2FJ7B 2W8SA 5B31D 5B0ZB 1P3KC 2Y2IA 3AV2A 3KXBB 3AFAC 2HIOB 1M18D 1P3LB 5AV6B 4ZBJB 5AV8A 4WU9C 3B0CW 3AZMD 3WTPB 1ULYA 4E44A 5B40D 3AV1A 5BNXB 3X1VB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LZ1 D;  4J8V C;  3VH6 A;  3MNN C;  2YFV A;  3X1U A;  4DRB A;  2L5A A;  2IO5 C;  1KX5 D;  4XUJ A;  4X23 D;  5AV5 D;  3AZL B;  3C1B B;  3AZI C;  1M1A C;  1M19 C;  5BNV B;  1U35 D;  1P3K A;  3B6G D;  4LD9 C;  3AZK D;  3AFA A;  5CP6 C;  4WU9 A;  3W97 D;  4XZQ B;  3UTB C;  1P3G D;  4J8V A;  1ID3 D;  3MNN A;  3X1S B;  3AV1 B;  3REK C;  3TU4 D;  4CAY B;  3B0D B;  3REJ D;  3AZI A;  3KUY A;  5CPK C;  1P3M D;  1M1A A;  1M19 A;  5AV9 C;  1M18 B;  3A6N C;  4J8X C;  4LD9 A;  3UT9 C;  3W97 A;  3C1C C;  4HGA C;  4QLC C;  1EQZ D;  3MGP C;  5B2J D;  5CP6 A;  3AZM B;  4WU8 D;  3NQJ A;  3MVD D;  3AN2 D;  5B40 B;  3WAA C;  3UTB A;  3LZ1 B;  4KGC D;  4E45 A;  3UTA C;  3AZE C;  2JSS A;  1KX5 B;  3REK A;  3AYW D;  4X23 B;  5AV5 B;  5BO0 A;  2NZD C;  1JFI A;  3W98 C;  5CPK A;  1U35 B;  4YM6 D;  5BT1 C;  3B6G B;  3REH C;  4J8U D;  3AZK B;  3KUY B;  5AV9 A;  3REI C;  3B6F D;  4J8X A;  2PYO C;  3MGR D;  4KHA B;  3C1C A;  4QLC A;  3LJA C;  3MGP A;  4WZS B;  2RVQ C;  5AY8 D;  3AZN C;  3V9R B;  3W97 B;  1HTA A;  4H9N A;  5CPJ D;  5E5A C;  3WAA A;  5BS7 C;  5GT0 D;  2CV5 D;  1KX4 D;  1ID3 B;  3UTA A;  2FJ7 C;  3TU4 B;  3AZE A;  5B0Z C;  5B33 D;  3REJ B;  3KXB C;  2HIO C;  1P3M B;  4H9O B;  1P3L C;  2NZD A;  3W98 A;  5AV6 C;  4ZBJ C;  5B32 D;  4CSR B;  4Z66 D;  3REH A;  3AZJ D;  3WTP C;  3REI A;  2F8N D;  2PYO A;  5G49 B;  1EQZ B;  3X1V C;  5B2J B;  4WU8 B;  1TZY D;  3LJA A;  3MVD B;  4J8X B;  3AZN A;  5F99 C;  1S32 D;  5GT3 D;  4WNN B;  5E5A A;  3AZL C;  1R4V A;  5BS7 A;  3C1B C;  2FJ7 A;  5B0Z A;  3AYW B;  4J8W D;  3KXB A;  2HIO A;  1P3L A;  3AZH D;  5B1L D;  5AV6 A;  4YM6 B;  4AWL B;  4J8U B;  3AZG C;  3B6F B;  1HQ3 D;  4XZQ C;  3MGR B;  3X1V A;  4ZUX D;  5AY8 B;  3VH5 W;  3X1S C;  3AV1 C;  5F99 A;  3AZF D;  3B0D C;  5CPJ B;  5GT0 B;  1KX4 B;  2CV5 B;  1AOI D;  3AZL A;  5AVC D;  3C1B A;  5B31 C;  3WTP E;  3W99 D;  5B33 B;  1M18 C;  2LY8 A;  2BYK B;  3LEL D;  5B32 B;  4R8P A;  4Z66 B;  3AZM C;  4H9Q B;  3AZJ B;  3AZG A;  1P3B D;  5B40 C;  2F8N B;  4KUD D;  4XZQ A;  1B67 A;  3LZ1 C;  3VH6 T;  3X1S A;  1S32 B;  1KX5 C;  5GT3 B;  2BYM B;  4X23 C;  4CAY A;  3MGS D;  1P34 D;  5AV5 C;  1BH9 B;  1P3O D;  5F99 B;  5B31 A;  1U35 C;  3B6G C;  4J8W B;  3AZK C;  3KUY C;  3LZ0 D;  1M18 A;  3REL D;  3AZH B;  5B1L B;  3W96 D;  5DNN D;  3AZM A;  5B0Y D;  3KWQ D;  3W97 C;  2YFW B;  5B40 A;  4R8P B;  1P3G C;  5JA4 B;  3LZ1 A;  4ZUX B;  3AZG B;  1ID3 C;  4H9R B;  1F66 D;  3TU4 C;  1TAF B;  3AZF B;  1KX5 A;  1P3A D;  3REJ C;  4X23 A;  1AOI B;  5AV5 A;  5AVC B;  1P3M C;  3W99 B;  1U35 A;  3B6G A;  1A7W A;  3WKJ D;  4M6B A;  3AZK A;  3LEL B;  5B31 B;  1EQZ C;  4KHA A;  3NQU B;  5B2J C;  4WU8 C;  4Z5T D;  3MVD C;  1P3B B;  3V9R A;  4KUD B;  4NE6 A;  1P3G A;  4KGC C;  4EO5 B;  1ID3 A;  3TU4 A;  3AYW C;  3MGS B;  3REJ A;  1KU5 A;  1P34 B;  1P3O B;  5JRG D;  1P3M A;  4H9O A;  4YM6 C;  4AWL C;  4J8U C;  4CSR A;  5DNM D;  3LZ0 B;  3B6F C;  3MGR C;  3REL B;  3W96 B;  5G49 A;  1EQZ A;  5DNN B;  5B2J A;  5AY8 C;  5B24 D;  3R45 B;  5B0Y B;  4WU8 A;  5C3I B;  3MVD A;  3KWQ B;  3AN2 A;  5CPJ C;  5GT0 C;  1KX4 C;  2CV5 C;  4KGC A;  4WNN A;  1F66 B;  1KX3 D;  5B33 C;  4YS3 D;  3O62 D;  1P3A B;  1P3G B;  1ZLA D;  3AYW A;  4UUZ A;  5B2I D;  1N1J B;  1P3P D;  5B32 C;  4YM6 A;  4Z66 C;  4Z2M G;  4J8U A;  3AZJ C;  5CPI D;  3WKJ B;  3B6F A;  3MGR A;  1TZY C;  4Z5T B;  3MGQ D;  5AY8 A;  1S32 C;  5GT3 C;  5CPJ A;  5GT0 A;  1KX4 A;  2CV5 A;  3AN2 B;  5AVB D;  4NFT A;  5B33 A;  4KGC B;  1P3I D;  4J8W C;  1P3F D;  5JRG B;  1BFM A;  5B1M D;  2BYK A;  2ARO D;  3AZH C;  5B1L C;  3WA9 D;  5B32 A;  4UUZ B;  4WV4 B;  4Z66 A;  5DNM B;  4H9Q A;  3AZJ A;  1BH8 B;  1HQ3 C;  4R8P C;  2F8N A;  4G92 B;  4ZUX C;  1TZY A;  5B24 B;  3X1T D;  5GXQ D;  3AZF C;  1S32 A;  5GT3 A;  5KDM B;  2BYM A;  5GSU D;  1AOI C;  1BH9 A;  5AVC C;  3WTP D;  4JJN D;  1KX3 B;  1WWS A;  3KSY A;  3W99 C;  3O62 B;  1ZLA B;  1H3O B;  5B2I B;  4J8W A;  3VH5 A;  3LEL C;  1P3P B;  3AZH A;  5B1L A;  2NQB D;  5CPI B;  1P3B C;  1HQ3 A;  4KUD C;  2HUE B;  2YFW A;  5JA4 A;  4EO5 C;  3MGQ B;  4G91 B;  4ZUX A;  4H9R A;  3AV2 D;  1TAF A;  3MGS C;  3AZF A;  3B0C T;  1P34 C;  1TZY B;  1P3O C;  1AOI A;  5AVC A;  5AVB B;  5AV8 D;  3W99 A;  1P3I B;  4NE5 A;  1P3F B;  3LZ0 C;  5B1M B;  3AV1 D;  3LEL A;  2ARO B;  3REL C;  5CHL B;  3W96 C;  3WA9 B;  5DNN C;  3NQU A;  5FUG B;  3X1U D;  5B0Y C;  3KWQ C;  5C3I C;  1P3B A;  4XUJ D;  2CWE A;  4KUD A;  3X1T B;  1F66 C;  1HQ3 B;  1WWI A;  5GXQ B;  1P3K D;  1P3A C;  5GSU B;  3VH6 W;  3MGS A;  3AFA D;  1P34 A;  1P3O A;  1B6W A;  4JJN B;  4H9S C;  4WU9 D;  4DRA A;  3WKJ C;  3LZ0 A;  3REL A;  3W96 A;  2NQB B;  5DNN A;  4J8V D;  3MNN D;  4Z5T C;  4Z2M H;  3R45 A;  5B0Y A;  3KWQ A;  4H9P B;  3AZI D;  3KUY D;  1M1A D;  1M19 D;  3AN2 C;  1F66 A;  3AV2 B;  5B32 G;  1P3A A;  5JRG C;  4LD9 D;  1N1J A;  2F8N G;  5AV8 B;  5CP6 D;  4H9S A;  5DNM C;  3WKJ A;  4G92 C;  3UTB D;  2YFV B;  3X1U B;  5B24 C;  4Z5T A;  3REK D;  4XUJ B;  5CPK D;  1KX3 C;  4YS3 C;  3O62 C;  1P3K B;  1ZLA C;  5AV9 D;  5B2I C;  3AFA B;  5JRG A;  3A6N D;  4J8X D;  3UT9 D;  3C1C D;  4QLC D;  1P3P C;  3MGP D;  4WU9 B;  5CPI C;  5DNM A;  1BH8 A;  2HUE C;  3WAA D;  4J8V B;  3MNN B;  3MGQ C;  3UTA D;  4G91 C;  5B24 A;  3AZE D;  2IO5 B;  5KDM A;  3AZI B;  1M1A B;  2NZD D;  1M19 B;  3W98 D;  3A6N A;  5B31 G;  5AVB C;  3UT9 A;  1KX3 A;  3O62 A;  5BT1 D;  4YS3 A;  3REH D;  1P3I C;  1H3O A;  1P3F C;  1ZLA A;  4LD9 B;  5B1M C;  5B2I A;  3REI D;  2PYO D;  2ARO C;  1P3P A;  5CP6 B;  3WA9 C;  3LJA D;  2RVQ D;  3NQJ B;  3AZN D;  5CPI A;  2F8N K;  3UTB B;  5E5A D;  3X1T C;  3MGQ A;  2FJ7 D;  3REK B;  5GXQ C;  5B0Z D;  5GSU C;  5BO0 B;  3KXB D;  2HIO D;  1JFI B;  4JJN C;  5CPK B;  1P3L D;  5AV6 D;  1F1E A;  5AVB A;  5AV9 B;  1P3I A;  3VH5 T;  1P3F A;  3A6N B;  5B1M A;  3UT9 B;  3C1C B;  4QLC B;  4HGA B;  2ARO A;  4YS3 B;  3MGP B;  3X1V D;  2NQB C;  3WA9 A;  5FUG A;  4NE3 A;  4H9N B;  5F99 D;  3WAA B;  3AZL D;  3C1B D;  3UTA B;  3X1T A;  3AZE B;  1Q9C A;  3AV2 C;  5GXQ A;  5GSU A;  2NZD B;  3W98 B;  3WTP A;  4JJN A;  4R8P D;  5AV8 C;  3B0B A;  5BNX A;  3REH B;  3AZG D;  3REI B;  2PYO B;  4XZQ D;  2F8N H;  3LJA B;  2NQB A;  3X1U C;  3AZN B;  3X1S D;  5BNV A;  4XUJ C;  5E5A B;  4H9P A;  2FJ7 B;  5B31 D;  5B0Z B;  1P3K C;  3AV2 A;  3KXB B;  3AFA C;  2HIO B;  1M18 D;  1P3L B;  5AV6 B;  4ZBJ B;  5AV8 A;  4WU9 C;  3B0C W;  3AZM D;  3WTP B;  1ULY A;  4E44 A;  5B40 D;  3AV1 A;  5BNX B;  3X1V B; 
#chains in the Genus database with same CATH topology
 3LZ1 D;  4J8V C;  3VH6 A;  3AL0 C;  3MNN C;  2YFV A;  3X1U A;  4DRB A;  2L5A A;  2IO5 C;  1KX5 D;  4XUJ A;  1W2E A;  4X23 D;  5AV5 D;  3AZL B;  3C1B B;  3AZI C;  1M1A C;  1M19 C;  5BNV B;  1U35 D;  1P3K A;  3B6G D;  3A1I A;  4LD9 C;  3AZK D;  3AFA A;  2Y2Q A;  5CP6 C;  4WU9 A;  3W97 D;  4XZQ B;  3UTB C;  1P3G D;  4J8V A;  1ID3 D;  3MNN A;  3X1S B;  3AV1 B;  3REK C;  3TU4 D;  4CAY B;  3B0D B;  3REJ D;  3AZI A;  3KUY A;  5CPK C;  1P3M D;  1M1A A;  1M19 A;  5AV9 C;  1M18 B;  3A6N C;  4J8X C;  4LD9 A;  3UT9 C;  3W97 A;  3C1C C;  4HGA C;  4QLC C;  1EQZ D;  3MGP C;  5B2J D;  5CP6 A;  3EPK A;  3AZM B;  4WU8 D;  3NQJ A;  3MVD D;  3AN2 D;  5B40 B;  3WAA C;  3UTB A;  3LZ1 B;  4KGC D;  4E45 A;  3UTA C;  3AZE C;  3EPJ A;  2JSS A;  1KX5 B;  3REK A;  3AYW D;  4X23 B;  5AV5 B;  5BO0 A;  2NZD C;  1JFI A;  3W98 C;  5CPK A;  3F6T A;  1U35 B;  4YM6 D;  5BT1 C;  3B6G B;  3REH C;  4J8U D;  3AZK B;  3KUY B;  5AV9 A;  3REI C;  3B6F D;  4J8X A;  2PYO C;  3MGR D;  4KHA B;  3C1C A;  4QLC A;  3LJA C;  3MGP A;  2JCH A;  4WZS B;  2RVQ C;  5AY8 D;  3AZN C;  3V9R B;  3W97 B;  1HTA A;  2Y2M A;  4H9N A;  3EPL A;  5CPJ D;  5E5A C;  3WAA A;  5BS7 C;  5GT0 D;  2CV5 D;  1KX4 D;  1ID3 B;  3UTA A;  2FJ7 C;  3TU4 B;  3AZE A;  5B0Z C;  5B33 D;  3REJ B;  3KXB C;  2HIO C;  1P3M B;  4H9O B;  1P3L C;  2NZD A;  3W98 A;  5AV6 C;  2ZM5 A;  4ZBJ C;  5B32 D;  3EPH A;  4CSR B;  4Z66 D;  3REH A;  3AZJ D;  3WTP C;  3REI A;  2F8N D;  2PYO A;  5G49 B;  1EQZ B;  3X1V C;  5B2J B;  4WU8 B;  1TZY D;  3LJA A;  3MVD B;  4J8X B;  3AZN A;  5F99 C;  1S32 D;  5GT3 D;  4DQY B;  4WNN B;  5E5A A;  3AZL C;  1R4V A;  5BS7 A;  3C1B C;  2FJ7 A;  5B0Z A;  3AYW B;  4J8W D;  3KXB A;  2HIO A;  1P3L A;  3AZH D;  5B1L D;  5AV6 A;  4YM6 B;  4AWL B;  4J8U B;  3AZG C;  3B6F B;  1HQ3 D;  4XZQ C;  3MGR B;  1PZR A;  3X1V A;  4ZUX D;  5AY8 B;  3VH5 W;  3X1S C;  2G5H C;  3AV1 C;  2Y2L A;  3A1K A;  5F99 A;  3AZF D;  3B0D C;  5CPJ B;  5GT0 B;  2XD1 A;  2CV5 B;  1KX4 B;  1AOI D;  3AZL A;  5AVC D;  3C1B A;  5B31 C;  3WTP E;  2DF4 C;  3W99 D;  5B33 B;  1M18 C;  2LY8 A;  2BYK B;  3LEL D;  5B32 B;  4R8P A;  4Z66 B;  3AZM C;  4H9Q B;  3AZJ B;  3AZG A;  1P3B D;  5B40 C;  2F8N B;  4KUD D;  4XZQ A;  1B67 A;  3LZ1 C;  3VH6 T;  3X1S A;  1S32 B;  1KX5 C;  5GT3 B;  2BYM B;  4X23 C;  4CAY A;  3MGS D;  1P34 D;  5AV5 C;  1BH9 B;  1P3O D;  5F99 B;  5B31 A;  1U35 C;  3B6G C;  4J8W B;  3AZK C;  3KUY C;  3IP4 C;  3LZ0 D;  1M18 A;  3REL D;  3AZH B;  5B1L B;  2ZY2 A;  3W96 D;  1T3U A;  5DNN D;  3AZM A;  5B0Y D;  3KWQ D;  3W97 C;  2YFW B;  5B40 A;  4R8P B;  1P3G C;  5JA4 B;  3LZ1 A;  4ZUX B;  3AZG B;  1ID3 C;  4H9R B;  1F66 D;  1Z2C B;  3TU4 C;  1TAF B;  3AZF B;  1KX5 A;  1P3A D;  3REJ C;  4X23 A;  1AOI B;  5AV5 A;  5AVC B;  1P3M C;  2ZY4 A;  2VQR A;  3W99 B;  1U35 A;  3B6G A;  1A7W A;  3WKJ D;  4M6B A;  3AZK A;  3LEL B;  5B31 B;  1EQZ C;  4KHA A;  3NQU B;  5B2J C;  4WU8 C;  4Z5T D;  3MVD C;  1P3B B;  3V9R A;  4KUD B;  4NE6 A;  1P3G A;  4KGC C;  4EO5 B;  1ID3 A;  3TU4 A;  3AYW C;  3MGS B;  3REJ A;  1KU5 A;  1P34 B;  1P3O B;  2Y2G A;  5JRG D;  1P3M A;  4H9O A;  4YM6 C;  4AWL C;  4J8U C;  4CSR A;  5DNM D;  3LZ0 B;  3B6F C;  3MGR C;  3REL B;  3W96 B;  5G49 A;  1EQZ A;  5DNN B;  2Y2P A;  5B2J A;  5AY8 C;  5B24 D;  3R45 B;  5B0Y B;  4WU8 A;  2Y2H A;  5C3I B;  3MVD A;  3KWQ B;  3AN2 A;  2JE5 A;  5CPJ C;  5GT0 C;  1KX4 C;  2CV5 C;  4KGC A;  4WNN A;  1F66 B;  1KX3 D;  5B33 C;  4YS3 D;  3O62 D;  1P3A B;  1P3G B;  1ZLA D;  3AYW A;  4UUZ A;  5B2I D;  1N1J B;  1P3P D;  5B32 C;  4YM6 A;  4Z66 C;  2RIQ A;  4Z2M G;  4J8U A;  3AZJ C;  5CPI D;  3WKJ B;  3B6F A;  2FFF B;  3MGR A;  1TZY C;  4Z5T B;  3MGQ D;  5AY8 A;  1S32 C;  5GT3 C;  5CPJ A;  5GT0 A;  1KX4 A;  2CV5 A;  3AN2 B;  5AVB D;  4NFT A;  5B33 A;  4KGC B;  1P3I D;  4J8W C;  1P3F D;  5JRG B;  1BFM A;  5B1M D;  2BYK A;  2ARO D;  3AZH C;  5B1L C;  3WA9 D;  5B32 A;  4UUZ B;  4WV4 B;  4Z66 A;  5DNM B;  4H9Q A;  3AZJ A;  1BH8 B;  1HQ3 C;  4R8P C;  2F8N A;  4G92 B;  4ZUX C;  1TZY A;  5B24 B;  3X1T D;  3H0M C;  5GXQ D;  3AZF C;  1S32 A;  5GT3 A;  5KDM B;  2BYM A;  5GSU D;  1AOI C;  1BH9 A;  5AVC C;  3WTP D;  4JJN D;  1KX3 B;  1WWS A;  3KSY A;  3W99 C;  3O62 B;  1ZLA B;  1H3O B;  5B2I B;  4J8W A;  3VH5 A;  3LEL C;  1P3P B;  3AZH A;  5B1L A;  2NQB D;  5CPI B;  1P3B C;  1HQ3 A;  4KUD C;  2HUE B;  2YFW A;  5JA4 A;  4UPK A;  2XD5 A;  4EO5 C;  4G91 B;  4ZUX A;  3MGQ B;  4H9R A;  3FDD A;  3AV2 D;  1TAF A;  3MGS C;  3AZF A;  3B0C T;  1P34 C;  1TZY B;  1P3O C;  1AOI A;  5AVC A;  5AVB B;  5AV8 D;  3W99 A;  1P3I B;  4NE5 A;  1P3F B;  3LZ0 C;  5B1M B;  3AV1 D;  3LEL A;  2ARO B;  3REL C;  5CHL B;  3W96 C;  3WA9 B;  5DNN C;  3NQU A;  5FUG B;  3X1U D;  5B0Y C;  3KWQ C;  5C3I C;  1P3B A;  2BG1 A;  4XUJ D;  2CWE A;  4KUD A;  3X1T B;  1F66 C;  1HQ3 B;  1WWI A;  5GXQ B;  1P3K D;  1P3A C;  5GSU B;  3VH6 W;  3MGS A;  3AFA D;  1P34 A;  1P3O A;  1B6W A;  4JJN B;  3H0L C;  4H9S C;  4WU9 D;  4DRA A;  3WKJ C;  3LZ0 A;  2ZY3 A;  3REL A;  3W96 A;  2NQB B;  5DNN A;  4J8V D;  3MNN D;  4Z5T C;  4Z2M H;  3R45 A;  5B0Y A;  3KWQ A;  4H9P B;  3AZI D;  3KUY D;  1M1A D;  1M19 D;  3AN2 C;  1F66 A;  2Y2N A;  3H0R C;  3AV2 B;  5B32 G;  1P3A A;  5JRG C;  4LD9 D;  1N1J A;  2F8N G;  5AV8 B;  5CP6 D;  4H9S A;  5DNM C;  3WKJ A;  4G92 C;  3UTB D;  2YFV B;  3X1U B;  2UWX A;  5B24 C;  4Z5T A;  3REK D;  4XUJ B;  2Y2J A;  5CPK D;  1KX3 C;  4YS3 C;  3O62 C;  1P3K B;  1ZLA C;  2J8P A;  5AV9 D;  5B2I C;  3AFA B;  5JRG A;  3A6N D;  4J8X D;  3UT9 D;  3C1C D;  4QLC D;  1P3P C;  3MGP D;  4WU9 B;  5CPI C;  5DNM A;  1BH8 A;  2HUE C;  3WAA D;  4J8V B;  3MNN B;  3MGQ C;  3UTA D;  4G91 C;  5B24 A;  3AZE D;  2IO5 B;  5KDM A;  3AZI B;  1M1A B;  2NZD D;  1M19 B;  3W98 D;  3A6N A;  5B31 G;  5AVB C;  3UT9 A;  1KX3 A;  3O62 A;  5BT1 D;  4YS3 A;  3REH D;  1P3I C;  1H3O A;  2G5I C;  1P3F C;  1ZLA A;  4LD9 B;  5B1M C;  5B2I A;  3REI D;  2PYO D;  2ARO C;  1P3P A;  5CP6 B;  3WA9 C;  3LJA D;  2RVQ D;  3NQJ B;  3AZN D;  5CPI A;  2F8N K;  3UTB B;  5E5A D;  3X1T C;  4WJ3 C;  3MGQ A;  3EG5 B;  2FJ7 D;  3REK B;  5GXQ C;  5B0Z D;  2F2A C;  5GSU C;  5BO0 B;  3KXB D;  2HIO D;  1JFI B;  4JJN C;  5CPK B;  1P3L D;  5AV6 D;  1F1E A;  5AVB A;  3P5J B;  5AV9 B;  1P3I A;  3VH5 T;  1P3F A;  3A6N B;  5B1M A;  3UT9 B;  3C1C B;  4HGA B;  4QLC B;  2ARO A;  4YS3 B;  3MGP B;  3X1V D;  2ZY5 A;  2NQB C;  3WA9 A;  5FUG A;  4NE3 A;  4H9N B;  5F99 D;  3WAA B;  3KFU G;  3AZL D;  3C1B D;  3UTA B;  3X1T A;  3AZE B;  1Q9C A;  3AV2 C;  5GXQ A;  2DQN C;  5GSU A;  2NZD B;  3W98 B;  3WTP A;  4JJN A;  4R8P D;  5AV8 C;  3B0B A;  5BNX A;  3REH B;  3AZG D;  3REI B;  2PYO B;  4XZQ D;  2Y2O A;  2F8N H;  3LJA B;  2NQB A;  3X1U C;  3AZN B;  2Y2K A;  3X1S D;  5BNV A;  4XUJ C;  5E5A B;  4H9P A;  2FJ7 B;  2W8S A;  5B31 D;  5B0Z B;  1P3K C;  2Y2I A;  3AV2 A;  3KXB B;  3AFA C;  2HIO B;  1M18 D;  1P3L B;  5AV6 B;  4ZBJ B;  5AV8 A;  4WU9 C;  3B0C W;  3AZM D;  3WTP B;  1ULY A;  4E44 A;  5B40 D;  3AV1 A;  5BNX B;  3X1V B; 
#chains in the Genus database with same CATH homology
 3LZ1 D;  4J8V C;  3VH6 A;  3AL0 C;  3MNN C;  2YFV A;  3X1U A;  4DRB A;  2L5A A;  2IO5 C;  1KX5 D;  4XUJ A;  1W2E A;  4X23 D;  5AV5 D;  3AZL B;  3C1B B;  3AZI C;  1M1A C;  1M19 C;  5BNV B;  1U35 D;  1P3K A;  3B6G D;  3A1I A;  4LD9 C;  3AZK D;  3AFA A;  2Y2Q A;  5CP6 C;  4WU9 A;  3W97 D;  4XZQ B;  3UTB C;  1P3G D;  4J8V A;  1ID3 D;  3MNN A;  3X1S B;  3AV1 B;  3REK C;  3TU4 D;  4CAY B;  3B0D B;  3REJ D;  3AZI A;  3KUY A;  5CPK C;  1P3M D;  1M1A A;  1M19 A;  5AV9 C;  1M18 B;  3A6N C;  4J8X C;  4LD9 A;  3UT9 C;  3W97 A;  3C1C C;  4HGA C;  4QLC C;  1EQZ D;  3MGP C;  5B2J D;  5CP6 A;  3EPK A;  3AZM B;  4WU8 D;  3NQJ A;  3MVD D;  3AN2 D;  5B40 B;  3WAA C;  3UTB A;  3LZ1 B;  4KGC D;  4E45 A;  3UTA C;  3AZE C;  3EPJ A;  2JSS A;  1KX5 B;  3REK A;  3AYW D;  4X23 B;  5AV5 B;  5BO0 A;  2NZD C;  1JFI A;  3W98 C;  5CPK A;  3F6T A;  1U35 B;  4YM6 D;  5BT1 C;  3B6G B;  3REH C;  4J8U D;  3AZK B;  3KUY B;  5AV9 A;  3REI C;  3B6F D;  4J8X A;  2PYO C;  3MGR D;  4KHA B;  3C1C A;  4QLC A;  3LJA C;  3MGP A;  2JCH A;  4WZS B;  2RVQ C;  5AY8 D;  3AZN C;  3V9R B;  3W97 B;  1HTA A;  2Y2M A;  4H9N A;  3EPL A;  5CPJ D;  5E5A C;  3WAA A;  5BS7 C;  5GT0 D;  2CV5 D;  1KX4 D;  1ID3 B;  3UTA A;  2FJ7 C;  3TU4 B;  3AZE A;  5B0Z C;  5B33 D;  3REJ B;  3KXB C;  2HIO C;  1P3M B;  4H9O B;  1P3L C;  2NZD A;  3W98 A;  5AV6 C;  2ZM5 A;  4ZBJ C;  5B32 D;  3EPH A;  4CSR B;  4Z66 D;  3REH A;  3AZJ D;  3WTP C;  3REI A;  2F8N D;  2PYO A;  5G49 B;  1EQZ B;  3X1V C;  5B2J B;  4WU8 B;  1TZY D;  3LJA A;  3MVD B;  4J8X B;  3AZN A;  5F99 C;  1S32 D;  5GT3 D;  4DQY B;  4WNN B;  5E5A A;  3AZL C;  1R4V A;  5BS7 A;  3C1B C;  2FJ7 A;  5B0Z A;  3AYW B;  4J8W D;  3KXB A;  2HIO A;  1P3L A;  3AZH D;  5B1L D;  5AV6 A;  4YM6 B;  4AWL B;  4J8U B;  3AZG C;  3B6F B;  1HQ3 D;  4XZQ C;  3MGR B;  1PZR A;  3X1V A;  4ZUX D;  5AY8 B;  3VH5 W;  3X1S C;  2G5H C;  3AV1 C;  2Y2L A;  3A1K A;  5F99 A;  3AZF D;  3B0D C;  5CPJ B;  5GT0 B;  2XD1 A;  2CV5 B;  1KX4 B;  1AOI D;  3AZL A;  5AVC D;  3C1B A;  5B31 C;  3WTP E;  2DF4 C;  3W99 D;  5B33 B;  1M18 C;  2LY8 A;  2BYK B;  3LEL D;  5B32 B;  4R8P A;  4Z66 B;  3AZM C;  4H9Q B;  3AZJ B;  3AZG A;  1P3B D;  5B40 C;  2F8N B;  4KUD D;  4XZQ A;  1B67 A;  3LZ1 C;  3VH6 T;  3X1S A;  1S32 B;  1KX5 C;  5GT3 B;  2BYM B;  4X23 C;  4CAY A;  3MGS D;  1P34 D;  5AV5 C;  1BH9 B;  1P3O D;  5F99 B;  5B31 A;  1U35 C;  3B6G C;  4J8W B;  3AZK C;  3KUY C;  3IP4 C;  3LZ0 D;  1M18 A;  3REL D;  3AZH B;  5B1L B;  2ZY2 A;  3W96 D;  1T3U A;  5DNN D;  3AZM A;  5B0Y D;  3KWQ D;  3W97 C;  2YFW B;  5B40 A;  4R8P B;  1P3G C;  5JA4 B;  3LZ1 A;  4ZUX B;  3AZG B;  1ID3 C;  4H9R B;  1F66 D;  1Z2C B;  3TU4 C;  1TAF B;  3AZF B;  1KX5 A;  1P3A D;  3REJ C;  4X23 A;  1AOI B;  5AV5 A;  5AVC B;  1P3M C;  2ZY4 A;  2VQR A;  3W99 B;  1U35 A;  3B6G A;  1A7W A;  3WKJ D;  4M6B A;  3AZK A;  3LEL B;  5B31 B;  1EQZ C;  4KHA A;  3NQU B;  5B2J C;  4WU8 C;  4Z5T D;  3MVD C;  1P3B B;  3V9R A;  4KUD B;  4NE6 A;  1P3G A;  4KGC C;  4EO5 B;  1ID3 A;  3TU4 A;  3AYW C;  3MGS B;  3REJ A;  1KU5 A;  1P34 B;  1P3O B;  2Y2G A;  5JRG D;  1P3M A;  4H9O A;  4YM6 C;  4AWL C;  4J8U C;  4CSR A;  5DNM D;  3LZ0 B;  3B6F C;  3MGR C;  3REL B;  3W96 B;  5G49 A;  1EQZ A;  5DNN B;  2Y2P A;  5B2J A;  5AY8 C;  5B24 D;  3R45 B;  5B0Y B;  4WU8 A;  2Y2H A;  5C3I B;  3MVD A;  3KWQ B;  3AN2 A;  2JE5 A;  5CPJ C;  5GT0 C;  1KX4 C;  2CV5 C;  4KGC A;  4WNN A;  1F66 B;  1KX3 D;  5B33 C;  4YS3 D;  3O62 D;  1P3A B;  1P3G B;  1ZLA D;  3AYW A;  4UUZ A;  5B2I D;  1N1J B;  1P3P D;  5B32 C;  4YM6 A;  4Z66 C;  2RIQ A;  4Z2M G;  4J8U A;  3AZJ C;  5CPI D;  3WKJ B;  3B6F A;  2FFF B;  3MGR A;  1TZY C;  4Z5T B;  3MGQ D;  5AY8 A;  1S32 C;  5GT3 C;  5CPJ A;  5GT0 A;  1KX4 A;  2CV5 A;  3AN2 B;  5AVB D;  4NFT A;  5B33 A;  4KGC B;  1P3I D;  4J8W C;  1P3F D;  5JRG B;  1BFM A;  5B1M D;  2BYK A;  2ARO D;  3AZH C;  5B1L C;  3WA9 D;  5B32 A;  4UUZ B;  4WV4 B;  4Z66 A;  5DNM B;  4H9Q A;  3AZJ A;  1BH8 B;  1HQ3 C;  4R8P C;  2F8N A;  4G92 B;  4ZUX C;  1TZY A;  5B24 B;  3X1T D;  3H0M C;  5GXQ D;  3AZF C;  1S32 A;  5GT3 A;  5KDM B;  2BYM A;  5GSU D;  1AOI C;  1BH9 A;  5AVC C;  3WTP D;  4JJN D;  1KX3 B;  1WWS A;  3KSY A;  3W99 C;  3O62 B;  1ZLA B;  1H3O B;  5B2I B;  4J8W A;  3VH5 A;  3LEL C;  1P3P B;  3AZH A;  5B1L A;  2NQB D;  5CPI B;  1P3B C;  1HQ3 A;  4KUD C;  2HUE B;  2YFW A;  5JA4 A;  4UPK A;  2XD5 A;  4EO5 C;  4G91 B;  4ZUX A;  3MGQ B;  4H9R A;  3FDD A;  3AV2 D;  1TAF A;  3MGS C;  3AZF A;  3B0C T;  1P34 C;  1TZY B;  1P3O C;  1AOI A;  5AVC A;  5AVB B;  5AV8 D;  3W99 A;  1P3I B;  4NE5 A;  1P3F B;  3LZ0 C;  5B1M B;  3AV1 D;  3LEL A;  2ARO B;  3REL C;  5CHL B;  3W96 C;  3WA9 B;  5DNN C;  3NQU A;  5FUG B;  3X1U D;  5B0Y C;  3KWQ C;  5C3I C;  1P3B A;  2BG1 A;  4XUJ D;  2CWE A;  4KUD A;  3X1T B;  1F66 C;  1HQ3 B;  1WWI A;  5GXQ B;  1P3K D;  1P3A C;  5GSU B;  3VH6 W;  3MGS A;  3AFA D;  1P34 A;  1P3O A;  1B6W A;  4JJN B;  3H0L C;  4H9S C;  4WU9 D;  4DRA A;  3WKJ C;  3LZ0 A;  2ZY3 A;  3REL A;  3W96 A;  2NQB B;  5DNN A;  4J8V D;  3MNN D;  4Z5T C;  4Z2M H;  3R45 A;  5B0Y A;  3KWQ A;  4H9P B;  3AZI D;  3KUY D;  1M1A D;  1M19 D;  3AN2 C;  1F66 A;  2Y2N A;  3H0R C;  3AV2 B;  5B32 G;  1P3A A;  5JRG C;  4LD9 D;  1N1J A;  2F8N G;  5AV8 B;  5CP6 D;  4H9S A;  5DNM C;  3WKJ A;  4G92 C;  3UTB D;  2YFV B;  3X1U B;  2UWX A;  5B24 C;  4Z5T A;  3REK D;  4XUJ B;  2Y2J A;  5CPK D;  1KX3 C;  4YS3 C;  3O62 C;  1P3K B;  1ZLA C;  2J8P A;  5AV9 D;  5B2I C;  3AFA B;  5JRG A;  3A6N D;  4J8X D;  3UT9 D;  3C1C D;  4QLC D;  1P3P C;  3MGP D;  4WU9 B;  5CPI C;  5DNM A;  1BH8 A;  2HUE C;  3WAA D;  4J8V B;  3MNN B;  3MGQ C;  3UTA D;  4G91 C;  5B24 A;  3AZE D;  2IO5 B;  5KDM A;  3AZI B;  1M1A B;  2NZD D;  1M19 B;  3W98 D;  3A6N A;  5B31 G;  5AVB C;  3UT9 A;  1KX3 A;  3O62 A;  5BT1 D;  4YS3 A;  3REH D;  1P3I C;  1H3O A;  2G5I C;  1P3F C;  1ZLA A;  4LD9 B;  5B1M C;  5B2I A;  3REI D;  2PYO D;  2ARO C;  1P3P A;  5CP6 B;  3WA9 C;  3LJA D;  2RVQ D;  3NQJ B;  3AZN D;  5CPI A;  2F8N K;  3UTB B;  5E5A D;  3X1T C;  4WJ3 C;  3MGQ A;  3EG5 B;  2FJ7 D;  3REK B;  5GXQ C;  5B0Z D;  2F2A C;  5GSU C;  5BO0 B;  3KXB D;  2HIO D;  1JFI B;  4JJN C;  5CPK B;  1P3L D;  5AV6 D;  1F1E A;  5AVB A;  3P5J B;  5AV9 B;  1P3I A;  3VH5 T;  1P3F A;  3A6N B;  5B1M A;  3UT9 B;  3C1C B;  4HGA B;  4QLC B;  2ARO A;  4YS3 B;  3MGP B;  3X1V D;  2ZY5 A;  2NQB C;  3WA9 A;  5FUG A;  4NE3 A;  4H9N B;  5F99 D;  3WAA B;  3KFU G;  3AZL D;  3C1B D;  3UTA B;  3X1T A;  3AZE B;  1Q9C A;  3AV2 C;  5GXQ A;  2DQN C;  5GSU A;  2NZD B;  3W98 B;  3WTP A;  4JJN A;  4R8P D;  5AV8 C;  3B0B A;  5BNX A;  3REH B;  3AZG D;  3REI B;  2PYO B;  4XZQ D;  2Y2O A;  2F8N H;  3LJA B;  2NQB A;  3X1U C;  3AZN B;  2Y2K A;  3X1S D;  5BNV A;  4XUJ C;  5E5A B;  4H9P A;  2FJ7 B;  2W8S A;  5B31 D;  5B0Z B;  1P3K C;  2Y2I A;  3AV2 A;  3KXB B;  3AFA C;  2HIO B;  1M18 D;  1P3L B;  5AV6 B;  4ZBJ B;  5AV8 A;  4WU9 C;  3B0C W;  3AZM D;  3WTP B;  1ULY A;  4E44 A;  5B40 D;  3AV1 A;  5BNX B;  3X1V B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...