4ZBJB

Ubn1 peptide bound to h3.3/h4/asf1
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
74
structure length
74
Chain Sequence
ALIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Histone chaperone ASF1
publication title Ubinuclein-1 confers histone H3.3-specific-binding by the HIRA histone chaperone complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
total genus 26
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2015-04-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4zbjB00
4YM6C 5GT0D 3W97A 3AYWA 1KX4C 3X1SA 4H9OA 5BNXB 3AN2B 3AV2B 3AV1A 3X1VD 4Z2MH 1P3KB 4XUJD 4J8XB 2YFWA 3A6NA 5AVBC 5B32D 3AZID 5GSUC 4XZQD 5B31G 4ZUXA 4QLCB 1ID3A 1P3KA 3MGQB 5CHLB 5B1MB 3UTAD 3TU4C 3W98A 5E5AC 1BH8B 4DRAA 5BNVB 5AV5B 1P3BA 3UTBB 5JA4B 3B0CW 5G49A 3MGQA 4Z5TB 5CPIC 1F66D 2NQBC 1BH8A 3VH5A 3B6GC 3AZFB 5DNMC 4ZUXD 4R8PC 3X1TD 4Z66C 5JRGA 1M19C 1HQ3A 5KDMB 4KGCD 3B6FD 4WU9A 3MGRD 4Z2MG 2BYKB 3AZFA 3REIC 2RVQD 5BS7C 5AY8B 3LELA 5F99C 5KDMA 2F8NK 5CPKC 2YFVB 1HQ3D 5AV6C 4WU8A 4G92C 4HGAB 3AZJA 4WU9D 1EQZA 2IO5B 4WNNB 4X23D 4JJND 5DNND 5B31B 1P3FC 3KWQC 2HIOA 5B0ZD 5AV8D 3MGSB 1TZYC 1P3GC 4YM6A 5GT3D 3REJB 4DRBA 1P3PC 3W97C 4WU8D 3AZLD 5B1LB 3WA9D 3WAAB 3AFAB 1KX3B 1KX5B 3AZGC 5CPJB 1S32D 4J8UB 3REKB 3REJA 5AVBA 5B1LA 3MGPB 5FUGB 3NQUA 3AV2C 1KX3A 1P3IB 3WAAA 1ID3C 3RELB 1P3KC 3TU4A 3REKA 4YM6D 3B0BA 1KX4D 5B24B 3MGPA 5FUGA 5BT1C 1P3IA 2AROD 3WTPB 3MGQC 4KUDB 1R4VA 5B1MC 2NQBA 5BO0A 5AV5C 5B2IB 3B6GA 5AVBD 5DNMA 3REHD 3UTBC 5GSUD 5B24A 4R8PA 1M19A 3X1UA 5GXQB 3WTPA 2F8NB 4J8VB 5C3IB 1P3LD 4KUDA 4CAYB 4Z5TC 5E5AD 4ZBJB 1ZLAB 5B33D 3AZFC 2NZDB 5BS7A 3AZMD 5GXQA 4J8VA 1N1JB 3AZKB 5CPID 3C1CD 1H3OB 1P3MB 3C1BB 4Z66D 4J8WB 5AY8C 1N1JA 5AV6A 1H3OA 3REID 3C1BA 3MNNB 3O62B 5F99D 4HGAC 3W96B 2HIOC 3LZ1B 5CPKD 5GT0B 2IO5C 3MNNA 5AV9D 5CP6B 3O62A 3KXBD 1P3PA 4E45A 3X1VB 4XUJB 5B31C 3W96A 5B2JA 3LZ1A 5B32B 3AZGA 3MGSC 5CP6A 3REJC 5B1LC 3UTAB 5BNXA 3NQJB 3VH6T 3AN2A 3WAAC 3KWQD 3AFAC 3AV2A 1P3FD 1KX3C 5AVCD 1KX5C 5CPJC 4J8XA 1TZYD 4J8UC 3REKC 1P3GD 3AYWD 3W97D 1M1AB 2F8NH 3X1SD 3NQJA 3MGPC 4QLCA 1P3IC 3RELC 3AV1D 3AZGD 5B1MA 3X1TB 4KHAB 5BNVA 3A6ND 5AV5A 4E44A 3W99B 1U35B 3UTBA 5B24C 3X1UC 3MGRB 3AV2D 5JA4A 3WTPC 1M18B 1ID3D 3AZEB 1P3KD 4KUDC 4NFTA 4KHAA 4Z5TA 3W98D 3W99A 1P3BD 5B2IC 1U35A 5GXQC 1M18A 4J8VC 5C3IC 3UT9B 3AZEA 3MGQD 4ZBJC 2BYKA 3VH5W 5JRGD 5AY8A 2F8NG 3UT9A 3AZKC 4Z5TD 4X23B 4WZSB 1P34B 1P3MC 3AZFD 3C1BC 4JJNB 2YFVA 1P3AB 3LELD 3WKJB 2CV5B 4YS3B 3MNNC 4EO5C 1AOIB 3O62C 3KSYA 4UUZB 4WNNA 3WA9B 1P3AA 3W96C 5B31A 3AZJD 5B2JC 3LZ1C 1EQZD 3WKJA 5GT0C 4YS3A 3MGSA 5CP6C 1AOIA 4UUZA 3X1VC 3MVDB 3AN2C 2HIOD 4NE5A 3AFAA 4H9NB 1P3OB 3AZNB 5B32C 1KX4B 1KX5A 5CPJA 4J8XC 4J8UA 3B0DB 2AROB 3UTAC 3LZ0B 3MVDA 5B31D 4LD9B 4QLCC 4H9RB 1P3OA 3AZNA 3RELA 5B32G 2PYOB 3REHB 2LY8A 3REJD 1M1AC 5B1LD 1P3LB 4LD9A 3WAAD 3AFAD 3AZHB 1KX3D 5B33B 2PYOA 3TU4D 2JSSA 3R45B 4J8UD 3X1TC 3REKD 3LJAB 3AZMB 1JFIB 3W99C 5B2IA 1U35C 4M6BA 3MGPD 3C1CB 4WV4B 3AZHA 1P3ID 1M18C 2FJ7B 2F8NA 3AZEC 4CAYA 2NQBD 1KU5A 3LJAA 1JFIA 1ZLAA 3B6GD 5DNMD 5B24D 4R8PD 3KUYB 3X1UD 1M19D 2FJ7A 2NZDA 3WTPD 3UT9C 4KUDD 3AZKA 2HUEB 2L5AA 1TAFB 5B2ID 1P3MA 4AWLB 5B40B 3KUYA 4J8WA 5GXQD 5B0YB 4J8VD 5AV9B 3KXBB 3B0CT 4X23C 1P34C 5B40A 1P3AC 5B0YA 5AV6D 3WKJC 2CV5C 5GT0A 1P3MD 3AZIB 1A7WA 4YS3C 3C1BD 4XZQB 1AOIC 1P3GA 3WA9C 5AVCB 1Q9CA 3X1VA 4XUJA 4G91B 3AYWB 5B32A 3AZIA 3MNND 3X1SB 3O62D 1P3PD 3AV1B 3UTAA 3MVDC 3W96D 1F66B 5B2JD 3LZ1D 3A6NB 1P3OC 3AZNC 5CP6D 4ZUXB 3B0DC 2AROC 1ID3B 1M1AA 1B67A 4H9SA 3LZ0C 4KGCB 3B6FB 4LD9C 3AN2D 3W98B 1F66A 1P3BB 2PYOC 3REHC 4J8XD 3X1TA 5G49B 1P3LC 4KGCA 3B6FA 5BT1D 4QLCD 2CWEA 3MGRA 3AZHC 5B33C 3VH6A 5B1MD 5JRGB 3LJAC 3AZMC 1ZLAC 5AV5D 1HQ3B 1M1AD 3UTBD 4WU9B 2NZDC 3C1CC 2FJ7C 1B6WA 2BYMB 3W99D 3LELB 1U35D 5DNNB 3KUYC 4J8WC 1M18D 5B0ZB 5AV8B 3AZED 2HUEC 3VH6W 2BYMA 5GT3B 4X23A 1P34A 4WU8B 3AZLB 4AWLC 4JJNA 5B40C 5DNNA 3AZJB 1EQZB 5AY8D 5B0YC 5B0ZA 5AV8A 3UT9D 5AV9C 1S32B 3KXBC 5GT3A 2CV5A 3V9RB 3AZLA 3WA9A 2HIOB 4NE3A 4XUJC 1S32A 4YM6B 1P34D 3AZIC 3V9RA 4XZQC 1P3AD 5AVCC 4G91C 3WKJD 4H9NA 3AYWC 2CV5D 1KX4A 5AVBB 3WTPE 4YS3D 3MGSD 5GSUB 3X1SC 1AOID 3NQUB 2AROA 3AV1C 4H9SC 3LZ0A 3TU4B 1BH9B 4CSRB 1F66C 5E5AB 3A6NC 4H9RA 1KX5D 3REHA 5CPJD 5GSUA 4ZUXC 1WWSA 1P3LA 4KGCC 3MVDD 1BH9A 3B6FC 5CPIB 4CSRA 3W98C 5E5AA 3MGRC 5BO0B 2NQBB 1P3BC 1P3OD 3AZND 5B33A 3RELD 3B6GB 5DNMB 2RVQC 3R45A 4R8PB 1M19B 4Z66B 3X1UB 3AZMA 1WWIA 3LZ0D 4LD9D 5CPIA 3C1CA 1HTAA 4H9PB 2PYOD 3REIB 1BFMA 5JRGC 4H9QB 4Z66A 1HQ3C 5F99B 4WU9C 5CPKB 3AZHD 4H9PA 2F8ND 1ULYA 4NE6A 3REIA 4H9QA 3LJAD 1TAFA 3LELC 1ZLAD 5F99A 5AV6B 4G92B 4JJNC 5DNNC 2NZDD 1F1EA 5CPKA 2FJ7D 5B0ZC 5AV8C 5AV9A 3AZKD 3KXBA 5GT3C 4WU8C 3AZLC 3AZJC 3KUYD 1P3FB 3KWQB 4J8WD 1EQZC 1S32C 4EO5B 1TZYB 1P3GB 1P3PB 3W97B 4XZQA 4H9OB 5B40D 1P3FA 5B2JB 3KWQA 3VH5T 5B0YD 5AVCA 3AZGB 1TZYA 2YFWB
chains in the Genus database with same CATH superfamily
4YM6C 5GT0D 3W97A 3AYWA 1KX4C 3X1SA 4H9OA 5BNXB 3AN2B 3AV2B 3AV1A 3X1VD 4Z2MH 1P3KB 4XUJD 4J8XB 2YFWA 3A6NA 5AVBC 5B32D 3AZID 5GSUC 4XZQD 5B31G 4ZUXA 4QLCB 1ID3A 1P3KA 3MGQB 5CHLB 5B1MB 3UTAD 3TU4C 3W98A 5E5AC 1BH8B 4DRAA 5BNVB 5AV5B 1P3BA 3UTBB 5JA4B 3B0CW 5G49A 3MGQA 4Z5TB 5CPIC 1F66D 2NQBC 1BH8A 3VH5A 3B6GC 3AZFB 5DNMC 4ZUXD 4R8PC 3X1TD 4Z66C 5JRGA 1M19C 1HQ3A 5KDMB 4KGCD 3B6FD 4WU9A 3MGRD 4Z2MG 2BYKB 3AZFA 3REIC 2Y2PA 2RVQD 5BS7C 5AY8B 3LELA 5F99C 5KDMA 1Z2CB 2F8NK 5CPKC 2YFVB 1HQ3D 5AV6C 4WU8A 4G92C 4HGAB 3AZJA 4WU9D 1EQZA 2IO5B 2DQNC 4WNNB 4X23D 4JJND 5DNND 5B31B 1P3FC 3KWQC 2HIOA 5B0ZD 2ZY3A 5AV8D 3MGSB 1TZYC 1P3GC 2Y2JA 4YM6A 5GT3D 3REJB 4DRBA 1P3PC 2Y2QA 3W97C 4WU8D 3AZLD 5B1LB 3WA9D 3WAAB 3AFAB 1KX3B 4UPKA 1KX5B 3AZGC 5CPJB 1S32D 4J8UB 3REKB 3REJA 5AVBA 5B1LA 3EPLA 3MGPB 5FUGB 3NQUA 3AV2C 1KX3A 1P3IB 3WAAA 1ID3C 3RELB 1P3KC 3TU4A 3REKA 4YM6D 3B0BA 1KX4D 5B24B 3EPKA 3MGPA 5FUGA 5BT1C 1P3IA 2AROD 3WTPB 2Y2KA 3MGQC 4KUDB 1R4VA 5B1MC 3KFUG 2NQBA 5BO0A 5AV5C 5B2IB 3B6GA 5AVBD 5DNMA 3REHD 3UTBC 5GSUD 5B24A 2JCHA 4R8PA 3X1UA 1M19A 5GXQB 3WTPA 2F8NB 4J8VB 5C3IB 1P3LD 4KUDA 4CAYB 4Z5TC 5E5AD 4ZBJB 1ZLAB 5B33D 3AZFC 2NZDB 5BS7A 3AZMD 5GXQA 4J8VA 1N1JB 3IP4C 3AZKB 5CPID 2UWXA 3C1CD 1H3OB 1P3MB 2XD1A 3C1BB 4Z66D 2Y2HA 4J8WB 5AY8C 1N1JA 5AV6A 1H3OA 3REID 3C1BA 3MNNB 3O62B 3AL0C 5F99D 4HGAC 3W96B 2HIOC 3LZ1B 5CPKD 5GT0B 2IO5C 3MNNA 2Y2LA 5CP6B 5AV9D 3O62A 3KXBD 1P3PA 3P5JB 4E45A 3X1VB 4XUJB 5B31C 3W96A 5B2JA 3LZ1A 5B32B 3AZGA 3MGSC 5CP6A 2W8SA 3REJC 5B1LC 3UTAB 5BNXA 3NQJB 3VH6T 3AN2A 3WAAC 3KWQD 3AFAC 3AV2A 1P3FD 1KX3C 5AVCD 1KX5C 5CPJC 4J8XA 1TZYD 4J8UC 3REKC 1P3GD 3AYWD 3W97D 1M1AB 2F8NH 3X1SD 3NQJA 3MGPC 4QLCA 2FFFB 1P3IC 3FDDA 3H0MC 3RELC 3AV1D 3AZGD 2DF4C 5B1MA 3X1TB 4KHAB 5BNVA 3A6ND 5AV5A 4E44A 3W99B 4WJ3C 1U35B 3UTBA 5B24C 3X1UC 3MGRB 3AV2D 5JA4A 3WTPC 1M18B 1ID3D 3AZEB 2Y2MA 2ZY5A 1P3KD 4KUDC 4NFTA 4KHAA 4Z5TA 3W98D 3W99A 2XD5A 1P3BD 2Y2NA 5B2IC 1U35A 2BG1A 5GXQC 1M18A 4J8VC 5C3IC 3UT9B 3AZEA 2JE5A 3MGQD 2Y2OA 4ZBJC 2BYKA 3VH5W 5JRGD 5AY8A 2F8NG 3UT9A 3F6TA 3AZKC 4Z5TD 4X23B 4WZSB 1P34B 1P3MC 3AZFD 3A1IA 3C1BC 4JJNB 2YFVA 1W2EA 3EPHA 1P3AB 3LELD 3H0RC 2ZY4A 3WKJB 2CV5B 4YS3B 3MNNC 4EO5C 3EPJA 1AOIB 3O62C 3KSYA 4UUZB 4WNNA 3WA9B 2ZM5A 1P3AA 3W96C 2VQRA 5B31A 3AZJD 5B2JC 3LZ1C 1EQZD 3WKJA 5GT0C 4YS3A 3MGSA 5CP6C 1AOIA 4UUZA 3X1VC 2G5IC 3MVDB 3AN2C 2HIOD 4NE5A 3AFAA 4H9NB 1P3OB 3AZNB 5B32C 1KX4B 1KX5A 5CPJA 4J8XC 4J8UA 3B0DB 2AROB 3UTAC 3LZ0B 3MVDA 5B31D 4LD9B 4QLCC 4H9RB 1P3OA 3AZNA 3RELA 5B32G 2PYOB 3REHB 2LY8A 3REJD 1M1AC 2Y2IA 5B1LD 2J8PA 1P3LB 4LD9A 3WAAD 3AFAD 2ZY2A 3AZHB 1KX3D 5B33B 2PYOA 3TU4D 2JSSA 3R45B 4J8UD 3X1TC 3REKD 3LJAB 3AZMB 1JFIB 3W99C 5B2IA 1U35C 4M6BA 3MGPD 3C1CB 4WV4B 3AZHA 1P3ID 1M18C 2FJ7B 2F8NA 3AZEC 4CAYA 2NQBD 1KU5A 3LJAA 1JFIA 1ZLAA 3B6GD 5DNMD 5B24D 4R8PD 3KUYB 3X1UD 1M19D 2FJ7A 2NZDA 3WTPD 3UT9C 4KUDD 3AZKA 2HUEB 2L5AA 1TAFB 5B2ID 1P3MA 4AWLB 5B40B 3KUYA 4J8WA 5GXQD 5B0YB 4J8VD 5AV9B 3KXBB 3B0CT 4X23C 1P34C 5B40A 1P3AC 5B0YA 5AV6D 3WKJC 2CV5C 5GT0A 1P3MD 3AZIB 1A7WA 4YS3C 3C1BD 4XZQB 1AOIC 1P3GA 3WA9C 2Y2GA 5AVCB 1Q9CA 3X1VA 4XUJA 4G91B 3AYWB 5B32A 3AZIA 3MNND 3X1SB 3O62D 1P3PD 3AV1B 3UTAA 3MVDC 3W96D 1F66B 5B2JD 3LZ1D 3A6NB 1P3OC 3AZNC 5CP6D 4ZUXB 3B0DC 2AROC 1ID3B 1M1AA 1B67A 4H9SA 3LZ0C 4KGCB 3B6FB 4LD9C 3AN2D 3W98B 1F66A 1P3BB 2PYOC 1T3UA 3REHC 4J8XD 3X1TA 5G49B 1P3LC 4KGCA 3B6FA 5BT1D 4QLCD 2CWEA 3MGRA 3AZHC 5B33C 3VH6A 5B1MD 5JRGB 3LJAC 3AZMC 1ZLAC 5AV5D 1HQ3B 1M1AD 3UTBD 4WU9B 2NZDC 3C1CC 2FJ7C 1B6WA 2BYMB 3W99D 3LELB 1U35D 5DNNB 3KUYC 4J8WC 1M18D 5B0ZB 5AV8B 3AZED 2G5HC 2HUEC 3VH6W 2BYMA 5GT3B 4X23A 1P34A 4WU8B 3AZLB 4AWLC 2F2AC 4JJNA 5DNNA 5B40C 3AZJB 1EQZB 5AY8D 5B0YC 5B0ZA 5AV8A 3UT9D 5AV9C 1S32B 3KXBC 5GT3A 2CV5A 3V9RB 3AZLA 3A1KA 2RIQA 3WA9A 2HIOB 4NE3A 4XUJC 1S32A 4YM6B 1P34D 3AZIC 3V9RA 4XZQC 1P3AD 5AVCC 4G91C 3WKJD 4H9NA 3AYWC 2CV5D 1KX4A 5AVBB 3WTPE 4YS3D 3MGSD 5GSUB 3X1SC 1AOID 3NQUB 2AROA 3AV1C 4H9SC 3LZ0A 3TU4B 1BH9B 4CSRB 1F66C 5E5AB 3A6NC 4H9RA 1KX5D 3REHA 5CPJD 5GSUA 4ZUXC 1WWSA 1P3LA 4KGCC 3MVDD 1BH9A 3B6FC 5CPIB 4CSRA 3W98C 5E5AA 3MGRC 5BO0B 2NQBB 1P3BC 1P3OD 3AZND 5B33A 3RELD 3B6GB 5DNMB 2RVQC 3R45A 4R8PB 1PZRA 4Z66B 3X1UB 1M19B 3AZMA 1WWIA 3LZ0D 4LD9D 5CPIA 3C1CA 1HTAA 4H9PB 2PYOD 3REIB 1BFMA 5JRGC 4H9QB 4Z66A 1HQ3C 5F99B 4WU9C 5CPKB 3AZHD 4H9PA 2F8ND 1ULYA 3H0LC 4NE6A 3REIA 4H9QA 3LJAD 1TAFA 3LELC 1ZLAD 5F99A 5AV6B 4G92B 4JJNC 5DNNC 2NZDD 1F1EA 5CPKA 2FJ7D 5B0ZC 5AV8C 5AV9A 3AZKD 3KXBA 5GT3C 4WU8C 3AZLC 3AZJC 3KUYD 3EG5B 1P3FB 3KWQB 4J8WD 4DQYB 1EQZC 1S32C 4EO5B 1TZYB 1P3GB 1P3PB 3W97B 4XZQA 4H9OB 5B40D 1P3FA 5B2JB 3KWQA 3VH5T 5B0YD 5AVCA 3AZGB 1TZYA 2YFWB
chains in the Genus database with same CATH topology
4YM6C 5GT0D 3W97A 3AYWA 1KX4C 3X1SA 4H9OA 5BNXB 3AN2B 3AV2B 3AV1A 3X1VD 4Z2MH 1P3KB 4XUJD 4J8XB 2YFWA 3A6NA 5AVBC 5B32D 3AZID 5GSUC 4XZQD 5B31G 4ZUXA 4QLCB 1ID3A 1P3KA 3MGQB 5CHLB 5B1MB 3UTAD 3TU4C 3W98A 5E5AC 1BH8B 4DRAA 5BNVB 5AV5B 1P3BA 3UTBB 5JA4B 3B0CW 5G49A 3MGQA 4Z5TB 5CPIC 1F66D 2NQBC 1BH8A 3VH5A 3B6GC 3AZFB 5DNMC 4ZUXD 4R8PC 3X1TD 4Z66C 5JRGA 1M19C 1HQ3A 5KDMB 4KGCD 3B6FD 4WU9A 3MGRD 4Z2MG 2BYKB 3AZFA 3REIC 2Y2PA 2RVQD 5BS7C 5AY8B 3LELA 5F99C 5KDMA 1Z2CB 2F8NK 5CPKC 2YFVB 1HQ3D 5AV6C 4WU8A 4G92C 4HGAB 3AZJA 4WU9D 1EQZA 2IO5B 2DQNC 4WNNB 4X23D 4JJND 5DNND 5B31B 1P3FC 3KWQC 2HIOA 5B0ZD 2ZY3A 5AV8D 3MGSB 1TZYC 1P3GC 2Y2JA 4YM6A 5GT3D 3REJB 4DRBA 1P3PC 2Y2QA 3W97C 4WU8D 3AZLD 5B1LB 3WA9D 3WAAB 3AFAB 1KX3B 4UPKA 1KX5B 3AZGC 5CPJB 1S32D 4J8UB 3REKB 3REJA 5AVBA 5B1LA 3EPLA 3MGPB 5FUGB 3NQUA 3AV2C 1KX3A 1P3IB 3WAAA 1ID3C 3RELB 1P3KC 3TU4A 3REKA 4YM6D 3B0BA 1KX4D 5B24B 3EPKA 3MGPA 5FUGA 5BT1C 1P3IA 2AROD 3WTPB 2Y2KA 3MGQC 4KUDB 1R4VA 5B1MC 3KFUG 2NQBA 5BO0A 5AV5C 5B2IB 3B6GA 5AVBD 5DNMA 3REHD 3UTBC 5GSUD 5B24A 2JCHA 4R8PA 3X1UA 1M19A 5GXQB 3WTPA 2F8NB 4J8VB 5C3IB 1P3LD 4KUDA 4CAYB 4Z5TC 5E5AD 4ZBJB 1ZLAB 5B33D 3AZFC 2NZDB 5BS7A 3AZMD 5GXQA 4J8VA 1N1JB 3IP4C 3AZKB 5CPID 2UWXA 3C1CD 1H3OB 1P3MB 2XD1A 3C1BB 4Z66D 2Y2HA 4J8WB 5AY8C 1N1JA 5AV6A 1H3OA 3REID 3C1BA 3MNNB 3O62B 3AL0C 5F99D 4HGAC 3W96B 2HIOC 3LZ1B 5CPKD 5GT0B 2IO5C 3MNNA 2Y2LA 5CP6B 5AV9D 3O62A 3KXBD 1P3PA 3P5JB 4E45A 3X1VB 4XUJB 5B31C 3W96A 5B2JA 3LZ1A 5B32B 3AZGA 3MGSC 5CP6A 2W8SA 3REJC 5B1LC 3UTAB 5BNXA 3NQJB 3VH6T 3AN2A 3WAAC 3KWQD 3AFAC 3AV2A 1P3FD 1KX3C 5AVCD 1KX5C 5CPJC 4J8XA 1TZYD 4J8UC 3REKC 1P3GD 3AYWD 3W97D 1M1AB 2F8NH 3X1SD 3NQJA 3MGPC 4QLCA 2FFFB 1P3IC 3FDDA 3H0MC 3RELC 3AV1D 3AZGD 2DF4C 5B1MA 3X1TB 4KHAB 5BNVA 3A6ND 5AV5A 4E44A 3W99B 4WJ3C 1U35B 3UTBA 5B24C 3X1UC 3MGRB 3AV2D 5JA4A 3WTPC 1M18B 1ID3D 3AZEB 2Y2MA 2ZY5A 1P3KD 4KUDC 4NFTA 4KHAA 4Z5TA 3W98D 3W99A 2XD5A 1P3BD 2Y2NA 5B2IC 1U35A 2BG1A 5GXQC 1M18A 4J8VC 5C3IC 3UT9B 3AZEA 2JE5A 3MGQD 2Y2OA 4ZBJC 2BYKA 3VH5W 5JRGD 5AY8A 2F8NG 3UT9A 3F6TA 3AZKC 4Z5TD 4X23B 4WZSB 1P34B 1P3MC 3AZFD 3A1IA 3C1BC 4JJNB 2YFVA 1W2EA 3EPHA 1P3AB 3LELD 3H0RC 2ZY4A 3WKJB 2CV5B 4YS3B 3MNNC 4EO5C 3EPJA 1AOIB 3O62C 3KSYA 4UUZB 4WNNA 3WA9B 2ZM5A 1P3AA 3W96C 2VQRA 5B31A 3AZJD 5B2JC 3LZ1C 1EQZD 3WKJA 5GT0C 4YS3A 3MGSA 5CP6C 1AOIA 4UUZA 3X1VC 2G5IC 3MVDB 3AN2C 2HIOD 4NE5A 3AFAA 4H9NB 1P3OB 3AZNB 5B32C 1KX4B 1KX5A 5CPJA 4J8XC 4J8UA 3B0DB 2AROB 3UTAC 3LZ0B 3MVDA 5B31D 4LD9B 4QLCC 4H9RB 1P3OA 3AZNA 3RELA 5B32G 2PYOB 3REHB 2LY8A 3REJD 1M1AC 2Y2IA 5B1LD 2J8PA 1P3LB 4LD9A 3WAAD 3AFAD 2ZY2A 3AZHB 1KX3D 5B33B 2PYOA 3TU4D 2JSSA 3R45B 4J8UD 3X1TC 3REKD 3LJAB 3AZMB 1JFIB 3W99C 5B2IA 1U35C 4M6BA 3MGPD 3C1CB 4WV4B 3AZHA 1P3ID 1M18C 2FJ7B 2F8NA 3AZEC 4CAYA 2NQBD 1KU5A 3LJAA 1JFIA 1ZLAA 3B6GD 5DNMD 5B24D 4R8PD 3KUYB 3X1UD 1M19D 2FJ7A 2NZDA 3WTPD 3UT9C 4KUDD 3AZKA 2HUEB 2L5AA 1TAFB 5B2ID 1P3MA 4AWLB 5B40B 3KUYA 4J8WA 5GXQD 5B0YB 4J8VD 5AV9B 3KXBB 3B0CT 4X23C 1P34C 5B40A 1P3AC 5B0YA 5AV6D 3WKJC 2CV5C 5GT0A 1P3MD 3AZIB 1A7WA 4YS3C 3C1BD 4XZQB 1AOIC 1P3GA 3WA9C 2Y2GA 5AVCB 1Q9CA 3X1VA 4XUJA 4G91B 3AYWB 5B32A 3AZIA 3MNND 3X1SB 3O62D 1P3PD 3AV1B 3UTAA 3MVDC 3W96D 1F66B 5B2JD 3LZ1D 3A6NB 1P3OC 3AZNC 5CP6D 4ZUXB 3B0DC 2AROC 1ID3B 1M1AA 1B67A 4H9SA 3LZ0C 4KGCB 3B6FB 4LD9C 3AN2D 3W98B 1F66A 1P3BB 2PYOC 1T3UA 3REHC 4J8XD 3X1TA 5G49B 1P3LC 4KGCA 3B6FA 5BT1D 4QLCD 2CWEA 3MGRA 3AZHC 5B33C 3VH6A 5B1MD 5JRGB 3LJAC 3AZMC 1ZLAC 5AV5D 1HQ3B 1M1AD 3UTBD 4WU9B 2NZDC 3C1CC 2FJ7C 1B6WA 2BYMB 3W99D 3LELB 1U35D 5DNNB 3KUYC 4J8WC 1M18D 5B0ZB 5AV8B 3AZED 2G5HC 2HUEC 3VH6W 2BYMA 5GT3B 4X23A 1P34A 4WU8B 3AZLB 4AWLC 2F2AC 4JJNA 5DNNA 5B40C 3AZJB 1EQZB 5AY8D 5B0YC 5B0ZA 5AV8A 3UT9D 5AV9C 1S32B 3KXBC 5GT3A 2CV5A 3V9RB 3AZLA 3A1KA 2RIQA 3WA9A 2HIOB 4NE3A 4XUJC 1S32A 4YM6B 1P34D 3AZIC 3V9RA 4XZQC 1P3AD 5AVCC 4G91C 3WKJD 4H9NA 3AYWC 2CV5D 1KX4A 5AVBB 3WTPE 4YS3D 3MGSD 5GSUB 3X1SC 1AOID 3NQUB 2AROA 3AV1C 4H9SC 3LZ0A 3TU4B 1BH9B 4CSRB 1F66C 5E5AB 3A6NC 4H9RA 1KX5D 3REHA 5CPJD 5GSUA 4ZUXC 1WWSA 1P3LA 4KGCC 3MVDD 1BH9A 3B6FC 5CPIB 4CSRA 3W98C 5E5AA 3MGRC 5BO0B 2NQBB 1P3BC 1P3OD 3AZND 5B33A 3RELD 3B6GB 5DNMB 2RVQC 3R45A 4R8PB 1PZRA 4Z66B 3X1UB 1M19B 3AZMA 1WWIA 3LZ0D 4LD9D 5CPIA 3C1CA 1HTAA 4H9PB 2PYOD 3REIB 1BFMA 5JRGC 4H9QB 4Z66A 1HQ3C 5F99B 4WU9C 5CPKB 3AZHD 4H9PA 2F8ND 1ULYA 3H0LC 4NE6A 3REIA 4H9QA 3LJAD 1TAFA 3LELC 1ZLAD 5F99A 5AV6B 4G92B 4JJNC 5DNNC 2NZDD 1F1EA 5CPKA 2FJ7D 5B0ZC 5AV8C 5AV9A 3AZKD 3KXBA 5GT3C 4WU8C 3AZLC 3AZJC 3KUYD 3EG5B 1P3FB 3KWQB 4J8WD 4DQYB 1EQZC 1S32C 4EO5B 1TZYB 1P3GB 1P3PB 3W97B 4XZQA 4H9OB 5B40D 1P3FA 5B2JB 3KWQA 3VH5T 5B0YD 5AVCA 3AZGB 1TZYA 2YFWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YM6 C;  5GT0 D;  3W97 A;  3AYW A;  1KX4 C;  3X1S A;  4H9O A;  5BNX B;  3AN2 B;  3AV2 B;  3AV1 A;  3X1V D;  4Z2M H;  1P3K B;  4XUJ D;  4J8X B;  2YFW A;  3A6N A;  5AVB C;  5B32 D;  3AZI D;  5GSU C;  4XZQ D;  5B31 G;  4ZUX A;  4QLC B;  1ID3 A;  1P3K A;  3MGQ B;  5CHL B;  5B1M B;  3UTA D;  3TU4 C;  3W98 A;  5E5A C;  1BH8 B;  4DRA A;  5BNV B;  5AV5 B;  1P3B A;  3UTB B;  5JA4 B;  3B0C W;  5G49 A;  3MGQ A;  4Z5T B;  5CPI C;  1F66 D;  2NQB C;  1BH8 A;  3VH5 A;  3B6G C;  3AZF B;  5DNM C;  4ZUX D;  4R8P C;  3X1T D;  4Z66 C;  5JRG A;  1M19 C;  1HQ3 A;  5KDM B;  4KGC D;  3B6F D;  4WU9 A;  3MGR D;  4Z2M G;  2BYK B;  3AZF A;  3REI C;  2RVQ D;  5BS7 C;  5AY8 B;  3LEL A;  5F99 C;  5KDM A;  2F8N K;  5CPK C;  2YFV B;  1HQ3 D;  5AV6 C;  4WU8 A;  4G92 C;  4HGA B;  3AZJ A;  4WU9 D;  1EQZ A;  2IO5 B;  4WNN B;  4X23 D;  4JJN D;  5DNN D;  5B31 B;  1P3F C;  3KWQ C;  2HIO A;  5B0Z D;  5AV8 D;  3MGS B;  1TZY C;  1P3G C;  4YM6 A;  5GT3 D;  3REJ B;  4DRB A;  1P3P C;  3W97 C;  4WU8 D;  3AZL D;  5B1L B;  3WA9 D;  3WAA B;  3AFA B;  1KX3 B;  1KX5 B;  3AZG C;  5CPJ B;  1S32 D;  4J8U B;  3REK B;  3REJ A;  5AVB A;  5B1L A;  3MGP B;  5FUG B;  3NQU A;  3AV2 C;  1KX3 A;  1P3I B;  3WAA A;  1ID3 C;  3REL B;  1P3K C;  3TU4 A;  3REK A;  4YM6 D;  3B0B A;  1KX4 D;  5B24 B;  3MGP A;  5FUG A;  5BT1 C;  1P3I A;  2ARO D;  3WTP B;  3MGQ C;  4KUD B;  1R4V A;  5B1M C;  2NQB A;  5BO0 A;  5AV5 C;  5B2I B;  3B6G A;  5AVB D;  5DNM A;  3REH D;  3UTB C;  5GSU D;  5B24 A;  4R8P A;  1M19 A;  3X1U A;  5GXQ B;  3WTP A;  2F8N B;  4J8V B;  5C3I B;  1P3L D;  4KUD A;  4CAY B;  4Z5T C;  5E5A D;  4ZBJ B;  1ZLA B;  5B33 D;  3AZF C;  2NZD B;  5BS7 A;  3AZM D;  5GXQ A;  4J8V A;  1N1J B;  3AZK B;  5CPI D;  3C1C D;  1H3O B;  1P3M B;  3C1B B;  4Z66 D;  4J8W B;  5AY8 C;  1N1J A;  5AV6 A;  1H3O A;  3REI D;  3C1B A;  3MNN B;  3O62 B;  5F99 D;  4HGA C;  3W96 B;  2HIO C;  3LZ1 B;  5CPK D;  5GT0 B;  2IO5 C;  3MNN A;  5AV9 D;  5CP6 B;  3O62 A;  3KXB D;  1P3P A;  4E45 A;  3X1V B;  4XUJ B;  5B31 C;  3W96 A;  5B2J A;  3LZ1 A;  5B32 B;  3AZG A;  3MGS C;  5CP6 A;  3REJ C;  5B1L C;  3UTA B;  5BNX A;  3NQJ B;  3VH6 T;  3AN2 A;  3WAA C;  3KWQ D;  3AFA C;  3AV2 A;  1P3F D;  1KX3 C;  5AVC D;  1KX5 C;  5CPJ C;  4J8X A;  1TZY D;  4J8U C;  3REK C;  1P3G D;  3AYW D;  3W97 D;  1M1A B;  2F8N H;  3X1S D;  3NQJ A;  3MGP C;  4QLC A;  1P3I C;  3REL C;  3AV1 D;  3AZG D;  5B1M A;  3X1T B;  4KHA B;  5BNV A;  3A6N D;  5AV5 A;  4E44 A;  3W99 B;  1U35 B;  3UTB A;  5B24 C;  3X1U C;  3MGR B;  3AV2 D;  5JA4 A;  3WTP C;  1M18 B;  1ID3 D;  3AZE B;  1P3K D;  4KUD C;  4NFT A;  4KHA A;  4Z5T A;  3W98 D;  3W99 A;  1P3B D;  5B2I C;  1U35 A;  5GXQ C;  1M18 A;  4J8V C;  5C3I C;  3UT9 B;  3AZE A;  3MGQ D;  4ZBJ C;  2BYK A;  3VH5 W;  5JRG D;  5AY8 A;  2F8N G;  3UT9 A;  3AZK C;  4Z5T D;  4X23 B;  4WZS B;  1P34 B;  1P3M C;  3AZF D;  3C1B C;  4JJN B;  2YFV A;  1P3A B;  3LEL D;  3WKJ B;  2CV5 B;  4YS3 B;  3MNN C;  4EO5 C;  1AOI B;  3O62 C;  3KSY A;  4UUZ B;  4WNN A;  3WA9 B;  1P3A A;  3W96 C;  5B31 A;  3AZJ D;  5B2J C;  3LZ1 C;  1EQZ D;  3WKJ A;  5GT0 C;  4YS3 A;  3MGS A;  5CP6 C;  1AOI A;  4UUZ A;  3X1V C;  3MVD B;  3AN2 C;  2HIO D;  4NE5 A;  3AFA A;  4H9N B;  1P3O B;  3AZN B;  5B32 C;  1KX4 B;  1KX5 A;  5CPJ A;  4J8X C;  4J8U A;  3B0D B;  2ARO B;  3UTA C;  3LZ0 B;  3MVD A;  5B31 D;  4LD9 B;  4QLC C;  4H9R B;  1P3O A;  3AZN A;  3REL A;  5B32 G;  2PYO B;  3REH B;  2LY8 A;  3REJ D;  1M1A C;  5B1L D;  1P3L B;  4LD9 A;  3WAA D;  3AFA D;  3AZH B;  1KX3 D;  5B33 B;  2PYO A;  3TU4 D;  2JSS A;  3R45 B;  4J8U D;  3X1T C;  3REK D;  3LJA B;  3AZM B;  1JFI B;  3W99 C;  5B2I A;  1U35 C;  4M6B A;  3MGP D;  3C1C B;  4WV4 B;  3AZH A;  1P3I D;  1M18 C;  2FJ7 B;  2F8N A;  3AZE C;  4CAY A;  2NQB D;  1KU5 A;  3LJA A;  1JFI A;  1ZLA A;  3B6G D;  5DNM D;  5B24 D;  4R8P D;  3KUY B;  3X1U D;  1M19 D;  2FJ7 A;  2NZD A;  3WTP D;  3UT9 C;  4KUD D;  3AZK A;  2HUE B;  2L5A A;  1TAF B;  5B2I D;  1P3M A;  4AWL B;  5B40 B;  3KUY A;  4J8W A;  5GXQ D;  5B0Y B;  4J8V D;  5AV9 B;  3KXB B;  3B0C T;  4X23 C;  1P34 C;  5B40 A;  1P3A C;  5B0Y A;  5AV6 D;  3WKJ C;  2CV5 C;  5GT0 A;  1P3M D;  3AZI B;  1A7W A;  4YS3 C;  3C1B D;  4XZQ B;  1AOI C;  1P3G A;  3WA9 C;  5AVC B;  1Q9C A;  3X1V A;  4XUJ A;  4G91 B;  3AYW B;  5B32 A;  3AZI A;  3MNN D;  3X1S B;  3O62 D;  1P3P D;  3AV1 B;  3UTA A;  3MVD C;  3W96 D;  1F66 B;  5B2J D;  3LZ1 D;  3A6N B;  1P3O C;  3AZN C;  5CP6 D;  4ZUX B;  3B0D C;  2ARO C;  1ID3 B;  1M1A A;  1B67 A;  4H9S A;  3LZ0 C;  4KGC B;  3B6F B;  4LD9 C;  3AN2 D;  3W98 B;  1F66 A;  1P3B B;  2PYO C;  3REH C;  4J8X D;  3X1T A;  5G49 B;  1P3L C;  4KGC A;  3B6F A;  5BT1 D;  4QLC D;  2CWE A;  3MGR A;  3AZH C;  5B33 C;  3VH6 A;  5B1M D;  5JRG B;  3LJA C;  3AZM C;  1ZLA C;  5AV5 D;  1HQ3 B;  1M1A D;  3UTB D;  4WU9 B;  2NZD C;  3C1C C;  2FJ7 C;  1B6W A;  2BYM B;  3W99 D;  3LEL B;  1U35 D;  5DNN B;  3KUY C;  4J8W C;  1M18 D;  5B0Z B;  5AV8 B;  3AZE D;  2HUE C;  3VH6 W;  2BYM A;  5GT3 B;  4X23 A;  1P34 A;  4WU8 B;  3AZL B;  4AWL C;  4JJN A;  5B40 C;  5DNN A;  3AZJ B;  1EQZ B;  5AY8 D;  5B0Y C;  5B0Z A;  5AV8 A;  3UT9 D;  5AV9 C;  1S32 B;  3KXB C;  5GT3 A;  2CV5 A;  3V9R B;  3AZL A;  3WA9 A;  2HIO B;  4NE3 A;  4XUJ C;  1S32 A;  4YM6 B;  1P34 D;  3AZI C;  3V9R A;  4XZQ C;  1P3A D;  5AVC C;  4G91 C;  3WKJ D;  4H9N A;  3AYW C;  2CV5 D;  1KX4 A;  5AVB B;  3WTP E;  4YS3 D;  3MGS D;  5GSU B;  3X1S C;  1AOI D;  3NQU B;  2ARO A;  3AV1 C;  4H9S C;  3LZ0 A;  3TU4 B;  1BH9 B;  4CSR B;  1F66 C;  5E5A B;  3A6N C;  4H9R A;  1KX5 D;  3REH A;  5CPJ D;  5GSU A;  4ZUX C;  1WWS A;  1P3L A;  4KGC C;  3MVD D;  1BH9 A;  3B6F C;  5CPI B;  4CSR A;  3W98 C;  5E5A A;  3MGR C;  5BO0 B;  2NQB B;  1P3B C;  1P3O D;  3AZN D;  5B33 A;  3REL D;  3B6G B;  5DNM B;  2RVQ C;  3R45 A;  4R8P B;  1M19 B;  4Z66 B;  3X1U B;  3AZM A;  1WWI A;  3LZ0 D;  4LD9 D;  5CPI A;  3C1C A;  1HTA A;  4H9P B;  2PYO D;  3REI B;  1BFM A;  5JRG C;  4H9Q B;  4Z66 A;  1HQ3 C;  5F99 B;  4WU9 C;  5CPK B;  3AZH D;  4H9P A;  2F8N D;  1ULY A;  4NE6 A;  3REI A;  4H9Q A;  3LJA D;  1TAF A;  3LEL C;  1ZLA D;  5F99 A;  5AV6 B;  4G92 B;  4JJN C;  5DNN C;  2NZD D;  1F1E A;  5CPK A;  2FJ7 D;  5B0Z C;  5AV8 C;  5AV9 A;  3AZK D;  3KXB A;  5GT3 C;  4WU8 C;  3AZL C;  3AZJ C;  3KUY D;  1P3F B;  3KWQ B;  4J8W D;  1EQZ C;  1S32 C;  4EO5 B;  1TZY B;  1P3G B;  1P3P B;  3W97 B;  4XZQ A;  4H9O B;  5B40 D;  1P3F A;  5B2J B;  3KWQ A;  3VH5 T;  5B0Y D;  5AVC A;  3AZG B;  1TZY A;  2YFW B; 
#chains in the Genus database with same CATH topology
 4YM6 C;  5GT0 D;  3W97 A;  3AYW A;  1KX4 C;  3X1S A;  4H9O A;  5BNX B;  3AN2 B;  3AV2 B;  3AV1 A;  3X1V D;  4Z2M H;  1P3K B;  4XUJ D;  4J8X B;  2YFW A;  3A6N A;  5AVB C;  5B32 D;  3AZI D;  5GSU C;  4XZQ D;  5B31 G;  4ZUX A;  4QLC B;  1ID3 A;  1P3K A;  3MGQ B;  5CHL B;  5B1M B;  3UTA D;  3TU4 C;  3W98 A;  5E5A C;  1BH8 B;  4DRA A;  5BNV B;  5AV5 B;  1P3B A;  3UTB B;  5JA4 B;  3B0C W;  5G49 A;  3MGQ A;  4Z5T B;  5CPI C;  1F66 D;  2NQB C;  1BH8 A;  3VH5 A;  3B6G C;  3AZF B;  5DNM C;  4ZUX D;  4R8P C;  3X1T D;  4Z66 C;  5JRG A;  1M19 C;  1HQ3 A;  5KDM B;  4KGC D;  3B6F D;  4WU9 A;  3MGR D;  4Z2M G;  2BYK B;  3AZF A;  3REI C;  2Y2P A;  2RVQ D;  5BS7 C;  5AY8 B;  3LEL A;  5F99 C;  5KDM A;  1Z2C B;  2F8N K;  5CPK C;  2YFV B;  1HQ3 D;  5AV6 C;  4WU8 A;  4G92 C;  4HGA B;  3AZJ A;  4WU9 D;  1EQZ A;  2IO5 B;  2DQN C;  4WNN B;  4X23 D;  4JJN D;  5DNN D;  5B31 B;  1P3F C;  3KWQ C;  2HIO A;  5B0Z D;  2ZY3 A;  5AV8 D;  3MGS B;  1TZY C;  1P3G C;  2Y2J A;  4YM6 A;  5GT3 D;  3REJ B;  4DRB A;  1P3P C;  2Y2Q A;  3W97 C;  4WU8 D;  3AZL D;  5B1L B;  3WA9 D;  3WAA B;  3AFA B;  1KX3 B;  4UPK A;  1KX5 B;  3AZG C;  5CPJ B;  1S32 D;  4J8U B;  3REK B;  3REJ A;  5AVB A;  5B1L A;  3EPL A;  3MGP B;  5FUG B;  3NQU A;  3AV2 C;  1KX3 A;  1P3I B;  3WAA A;  1ID3 C;  3REL B;  1P3K C;  3TU4 A;  3REK A;  4YM6 D;  3B0B A;  1KX4 D;  5B24 B;  3EPK A;  3MGP A;  5FUG A;  5BT1 C;  1P3I A;  2ARO D;  3WTP B;  2Y2K A;  3MGQ C;  4KUD B;  1R4V A;  5B1M C;  3KFU G;  2NQB A;  5BO0 A;  5AV5 C;  5B2I B;  3B6G A;  5AVB D;  5DNM A;  3REH D;  3UTB C;  5GSU D;  5B24 A;  2JCH A;  4R8P A;  3X1U A;  1M19 A;  5GXQ B;  3WTP A;  2F8N B;  4J8V B;  5C3I B;  1P3L D;  4KUD A;  4CAY B;  4Z5T C;  5E5A D;  4ZBJ B;  1ZLA B;  5B33 D;  3AZF C;  2NZD B;  5BS7 A;  3AZM D;  5GXQ A;  4J8V A;  1N1J B;  3IP4 C;  3AZK B;  5CPI D;  2UWX A;  3C1C D;  1H3O B;  1P3M B;  2XD1 A;  3C1B B;  4Z66 D;  2Y2H A;  4J8W B;  5AY8 C;  1N1J A;  5AV6 A;  1H3O A;  3REI D;  3C1B A;  3MNN B;  3O62 B;  3AL0 C;  5F99 D;  4HGA C;  3W96 B;  2HIO C;  3LZ1 B;  5CPK D;  5GT0 B;  2IO5 C;  3MNN A;  2Y2L A;  5CP6 B;  5AV9 D;  3O62 A;  3KXB D;  1P3P A;  3P5J B;  4E45 A;  3X1V B;  4XUJ B;  5B31 C;  3W96 A;  5B2J A;  3LZ1 A;  5B32 B;  3AZG A;  3MGS C;  5CP6 A;  2W8S A;  3REJ C;  5B1L C;  3UTA B;  5BNX A;  3NQJ B;  3VH6 T;  3AN2 A;  3WAA C;  3KWQ D;  3AFA C;  3AV2 A;  1P3F D;  1KX3 C;  5AVC D;  1KX5 C;  5CPJ C;  4J8X A;  1TZY D;  4J8U C;  3REK C;  1P3G D;  3AYW D;  3W97 D;  1M1A B;  2F8N H;  3X1S D;  3NQJ A;  3MGP C;  4QLC A;  2FFF B;  1P3I C;  3FDD A;  3H0M C;  3REL C;  3AV1 D;  3AZG D;  2DF4 C;  5B1M A;  3X1T B;  4KHA B;  5BNV A;  3A6N D;  5AV5 A;  4E44 A;  3W99 B;  4WJ3 C;  1U35 B;  3UTB A;  5B24 C;  3X1U C;  3MGR B;  3AV2 D;  5JA4 A;  3WTP C;  1M18 B;  1ID3 D;  3AZE B;  2Y2M A;  2ZY5 A;  1P3K D;  4KUD C;  4NFT A;  4KHA A;  4Z5T A;  3W98 D;  3W99 A;  2XD5 A;  1P3B D;  2Y2N A;  5B2I C;  1U35 A;  2BG1 A;  5GXQ C;  1M18 A;  4J8V C;  5C3I C;  3UT9 B;  3AZE A;  2JE5 A;  3MGQ D;  2Y2O A;  4ZBJ C;  2BYK A;  3VH5 W;  5JRG D;  5AY8 A;  2F8N G;  3UT9 A;  3F6T A;  3AZK C;  4Z5T D;  4X23 B;  4WZS B;  1P34 B;  1P3M C;  3AZF D;  3A1I A;  3C1B C;  4JJN B;  2YFV A;  1W2E A;  3EPH A;  1P3A B;  3LEL D;  3H0R C;  2ZY4 A;  3WKJ B;  2CV5 B;  4YS3 B;  3MNN C;  4EO5 C;  3EPJ A;  1AOI B;  3O62 C;  3KSY A;  4UUZ B;  4WNN A;  3WA9 B;  2ZM5 A;  1P3A A;  3W96 C;  2VQR A;  5B31 A;  3AZJ D;  5B2J C;  3LZ1 C;  1EQZ D;  3WKJ A;  5GT0 C;  4YS3 A;  3MGS A;  5CP6 C;  1AOI A;  4UUZ A;  3X1V C;  2G5I C;  3MVD B;  3AN2 C;  2HIO D;  4NE5 A;  3AFA A;  4H9N B;  1P3O B;  3AZN B;  5B32 C;  1KX4 B;  1KX5 A;  5CPJ A;  4J8X C;  4J8U A;  3B0D B;  2ARO B;  3UTA C;  3LZ0 B;  3MVD A;  5B31 D;  4LD9 B;  4QLC C;  4H9R B;  1P3O A;  3AZN A;  3REL A;  5B32 G;  2PYO B;  3REH B;  2LY8 A;  3REJ D;  1M1A C;  2Y2I A;  5B1L D;  2J8P A;  1P3L B;  4LD9 A;  3WAA D;  3AFA D;  2ZY2 A;  3AZH B;  1KX3 D;  5B33 B;  2PYO A;  3TU4 D;  2JSS A;  3R45 B;  4J8U D;  3X1T C;  3REK D;  3LJA B;  3AZM B;  1JFI B;  3W99 C;  5B2I A;  1U35 C;  4M6B A;  3MGP D;  3C1C B;  4WV4 B;  3AZH A;  1P3I D;  1M18 C;  2FJ7 B;  2F8N A;  3AZE C;  4CAY A;  2NQB D;  1KU5 A;  3LJA A;  1JFI A;  1ZLA A;  3B6G D;  5DNM D;  5B24 D;  4R8P D;  3KUY B;  3X1U D;  1M19 D;  2FJ7 A;  2NZD A;  3WTP D;  3UT9 C;  4KUD D;  3AZK A;  2HUE B;  2L5A A;  1TAF B;  5B2I D;  1P3M A;  4AWL B;  5B40 B;  3KUY A;  4J8W A;  5GXQ D;  5B0Y B;  4J8V D;  5AV9 B;  3KXB B;  3B0C T;  4X23 C;  1P34 C;  5B40 A;  1P3A C;  5B0Y A;  5AV6 D;  3WKJ C;  2CV5 C;  5GT0 A;  1P3M D;  3AZI B;  1A7W A;  4YS3 C;  3C1B D;  4XZQ B;  1AOI C;  1P3G A;  3WA9 C;  2Y2G A;  5AVC B;  1Q9C A;  3X1V A;  4XUJ A;  4G91 B;  3AYW B;  5B32 A;  3AZI A;  3MNN D;  3X1S B;  3O62 D;  1P3P D;  3AV1 B;  3UTA A;  3MVD C;  3W96 D;  1F66 B;  5B2J D;  3LZ1 D;  3A6N B;  1P3O C;  3AZN C;  5CP6 D;  4ZUX B;  3B0D C;  2ARO C;  1ID3 B;  1M1A A;  1B67 A;  4H9S A;  3LZ0 C;  4KGC B;  3B6F B;  4LD9 C;  3AN2 D;  3W98 B;  1F66 A;  1P3B B;  2PYO C;  1T3U A;  3REH C;  4J8X D;  3X1T A;  5G49 B;  1P3L C;  4KGC A;  3B6F A;  5BT1 D;  4QLC D;  2CWE A;  3MGR A;  3AZH C;  5B33 C;  3VH6 A;  5B1M D;  5JRG B;  3LJA C;  3AZM C;  1ZLA C;  5AV5 D;  1HQ3 B;  1M1A D;  3UTB D;  4WU9 B;  2NZD C;  3C1C C;  2FJ7 C;  1B6W A;  2BYM B;  3W99 D;  3LEL B;  1U35 D;  5DNN B;  3KUY C;  4J8W C;  1M18 D;  5B0Z B;  5AV8 B;  3AZE D;  2G5H C;  2HUE C;  3VH6 W;  2BYM A;  5GT3 B;  4X23 A;  1P34 A;  4WU8 B;  3AZL B;  4AWL C;  2F2A C;  4JJN A;  5DNN A;  5B40 C;  3AZJ B;  1EQZ B;  5AY8 D;  5B0Y C;  5B0Z A;  5AV8 A;  3UT9 D;  5AV9 C;  1S32 B;  3KXB C;  5GT3 A;  2CV5 A;  3V9R B;  3AZL A;  3A1K A;  2RIQ A;  3WA9 A;  2HIO B;  4NE3 A;  4XUJ C;  1S32 A;  4YM6 B;  1P34 D;  3AZI C;  3V9R A;  4XZQ C;  1P3A D;  5AVC C;  4G91 C;  3WKJ D;  4H9N A;  3AYW C;  2CV5 D;  1KX4 A;  5AVB B;  3WTP E;  4YS3 D;  3MGS D;  5GSU B;  3X1S C;  1AOI D;  3NQU B;  2ARO A;  3AV1 C;  4H9S C;  3LZ0 A;  3TU4 B;  1BH9 B;  4CSR B;  1F66 C;  5E5A B;  3A6N C;  4H9R A;  1KX5 D;  3REH A;  5CPJ D;  5GSU A;  4ZUX C;  1WWS A;  1P3L A;  4KGC C;  3MVD D;  1BH9 A;  3B6F C;  5CPI B;  4CSR A;  3W98 C;  5E5A A;  3MGR C;  5BO0 B;  2NQB B;  1P3B C;  1P3O D;  3AZN D;  5B33 A;  3REL D;  3B6G B;  5DNM B;  2RVQ C;  3R45 A;  4R8P B;  1PZR A;  4Z66 B;  3X1U B;  1M19 B;  3AZM A;  1WWI A;  3LZ0 D;  4LD9 D;  5CPI A;  3C1C A;  1HTA A;  4H9P B;  2PYO D;  3REI B;  1BFM A;  5JRG C;  4H9Q B;  4Z66 A;  1HQ3 C;  5F99 B;  4WU9 C;  5CPK B;  3AZH D;  4H9P A;  2F8N D;  1ULY A;  3H0L C;  4NE6 A;  3REI A;  4H9Q A;  3LJA D;  1TAF A;  3LEL C;  1ZLA D;  5F99 A;  5AV6 B;  4G92 B;  4JJN C;  5DNN C;  2NZD D;  1F1E A;  5CPK A;  2FJ7 D;  5B0Z C;  5AV8 C;  5AV9 A;  3AZK D;  3KXB A;  5GT3 C;  4WU8 C;  3AZL C;  3AZJ C;  3KUY D;  3EG5 B;  1P3F B;  3KWQ B;  4J8W D;  4DQY B;  1EQZ C;  1S32 C;  4EO5 B;  1TZY B;  1P3G B;  1P3P B;  3W97 B;  4XZQ A;  4H9O B;  5B40 D;  1P3F A;  5B2J B;  3KWQ A;  3VH5 T;  5B0Y D;  5AVC A;  3AZG B;  1TZY A;  2YFW B; 
#chains in the Genus database with same CATH homology
 4YM6 C;  5GT0 D;  3W97 A;  3AYW A;  1KX4 C;  3X1S A;  4H9O A;  5BNX B;  3AN2 B;  3AV2 B;  3AV1 A;  3X1V D;  4Z2M H;  1P3K B;  4XUJ D;  4J8X B;  2YFW A;  3A6N A;  5AVB C;  5B32 D;  3AZI D;  5GSU C;  4XZQ D;  5B31 G;  4ZUX A;  4QLC B;  1ID3 A;  1P3K A;  3MGQ B;  5CHL B;  5B1M B;  3UTA D;  3TU4 C;  3W98 A;  5E5A C;  1BH8 B;  4DRA A;  5BNV B;  5AV5 B;  1P3B A;  3UTB B;  5JA4 B;  3B0C W;  5G49 A;  3MGQ A;  4Z5T B;  5CPI C;  1F66 D;  2NQB C;  1BH8 A;  3VH5 A;  3B6G C;  3AZF B;  5DNM C;  4ZUX D;  4R8P C;  3X1T D;  4Z66 C;  5JRG A;  1M19 C;  1HQ3 A;  5KDM B;  4KGC D;  3B6F D;  4WU9 A;  3MGR D;  4Z2M G;  2BYK B;  3AZF A;  3REI C;  2Y2P A;  2RVQ D;  5BS7 C;  5AY8 B;  3LEL A;  5F99 C;  5KDM A;  1Z2C B;  2F8N K;  5CPK C;  2YFV B;  1HQ3 D;  5AV6 C;  4WU8 A;  4G92 C;  4HGA B;  3AZJ A;  4WU9 D;  1EQZ A;  2IO5 B;  2DQN C;  4WNN B;  4X23 D;  4JJN D;  5DNN D;  5B31 B;  1P3F C;  3KWQ C;  2HIO A;  5B0Z D;  2ZY3 A;  5AV8 D;  3MGS B;  1TZY C;  1P3G C;  2Y2J A;  4YM6 A;  5GT3 D;  3REJ B;  4DRB A;  1P3P C;  2Y2Q A;  3W97 C;  4WU8 D;  3AZL D;  5B1L B;  3WA9 D;  3WAA B;  3AFA B;  1KX3 B;  4UPK A;  1KX5 B;  3AZG C;  5CPJ B;  1S32 D;  4J8U B;  3REK B;  3REJ A;  5AVB A;  5B1L A;  3EPL A;  3MGP B;  5FUG B;  3NQU A;  3AV2 C;  1KX3 A;  1P3I B;  3WAA A;  1ID3 C;  3REL B;  1P3K C;  3TU4 A;  3REK A;  4YM6 D;  3B0B A;  1KX4 D;  5B24 B;  3EPK A;  3MGP A;  5FUG A;  5BT1 C;  1P3I A;  2ARO D;  3WTP B;  2Y2K A;  3MGQ C;  4KUD B;  1R4V A;  5B1M C;  3KFU G;  2NQB A;  5BO0 A;  5AV5 C;  5B2I B;  3B6G A;  5AVB D;  5DNM A;  3REH D;  3UTB C;  5GSU D;  5B24 A;  2JCH A;  4R8P A;  3X1U A;  1M19 A;  5GXQ B;  3WTP A;  2F8N B;  4J8V B;  5C3I B;  1P3L D;  4KUD A;  4CAY B;  4Z5T C;  5E5A D;  4ZBJ B;  1ZLA B;  5B33 D;  3AZF C;  2NZD B;  5BS7 A;  3AZM D;  5GXQ A;  4J8V A;  1N1J B;  3IP4 C;  3AZK B;  5CPI D;  2UWX A;  3C1C D;  1H3O B;  1P3M B;  2XD1 A;  3C1B B;  4Z66 D;  2Y2H A;  4J8W B;  5AY8 C;  1N1J A;  5AV6 A;  1H3O A;  3REI D;  3C1B A;  3MNN B;  3O62 B;  3AL0 C;  5F99 D;  4HGA C;  3W96 B;  2HIO C;  3LZ1 B;  5CPK D;  5GT0 B;  2IO5 C;  3MNN A;  2Y2L A;  5CP6 B;  5AV9 D;  3O62 A;  3KXB D;  1P3P A;  3P5J B;  4E45 A;  3X1V B;  4XUJ B;  5B31 C;  3W96 A;  5B2J A;  3LZ1 A;  5B32 B;  3AZG A;  3MGS C;  5CP6 A;  2W8S A;  3REJ C;  5B1L C;  3UTA B;  5BNX A;  3NQJ B;  3VH6 T;  3AN2 A;  3WAA C;  3KWQ D;  3AFA C;  3AV2 A;  1P3F D;  1KX3 C;  5AVC D;  1KX5 C;  5CPJ C;  4J8X A;  1TZY D;  4J8U C;  3REK C;  1P3G D;  3AYW D;  3W97 D;  1M1A B;  2F8N H;  3X1S D;  3NQJ A;  3MGP C;  4QLC A;  2FFF B;  1P3I C;  3FDD A;  3H0M C;  3REL C;  3AV1 D;  3AZG D;  2DF4 C;  5B1M A;  3X1T B;  4KHA B;  5BNV A;  3A6N D;  5AV5 A;  4E44 A;  3W99 B;  4WJ3 C;  1U35 B;  3UTB A;  5B24 C;  3X1U C;  3MGR B;  3AV2 D;  5JA4 A;  3WTP C;  1M18 B;  1ID3 D;  3AZE B;  2Y2M A;  2ZY5 A;  1P3K D;  4KUD C;  4NFT A;  4KHA A;  4Z5T A;  3W98 D;  3W99 A;  2XD5 A;  1P3B D;  2Y2N A;  5B2I C;  1U35 A;  2BG1 A;  5GXQ C;  1M18 A;  4J8V C;  5C3I C;  3UT9 B;  3AZE A;  2JE5 A;  3MGQ D;  2Y2O A;  4ZBJ C;  2BYK A;  3VH5 W;  5JRG D;  5AY8 A;  2F8N G;  3UT9 A;  3F6T A;  3AZK C;  4Z5T D;  4X23 B;  4WZS B;  1P34 B;  1P3M C;  3AZF D;  3A1I A;  3C1B C;  4JJN B;  2YFV A;  1W2E A;  3EPH A;  1P3A B;  3LEL D;  3H0R C;  2ZY4 A;  3WKJ B;  2CV5 B;  4YS3 B;  3MNN C;  4EO5 C;  3EPJ A;  1AOI B;  3O62 C;  3KSY A;  4UUZ B;  4WNN A;  3WA9 B;  2ZM5 A;  1P3A A;  3W96 C;  2VQR A;  5B31 A;  3AZJ D;  5B2J C;  3LZ1 C;  1EQZ D;  3WKJ A;  5GT0 C;  4YS3 A;  3MGS A;  5CP6 C;  1AOI A;  4UUZ A;  3X1V C;  2G5I C;  3MVD B;  3AN2 C;  2HIO D;  4NE5 A;  3AFA A;  4H9N B;  1P3O B;  3AZN B;  5B32 C;  1KX4 B;  1KX5 A;  5CPJ A;  4J8X C;  4J8U A;  3B0D B;  2ARO B;  3UTA C;  3LZ0 B;  3MVD A;  5B31 D;  4LD9 B;  4QLC C;  4H9R B;  1P3O A;  3AZN A;  3REL A;  5B32 G;  2PYO B;  3REH B;  2LY8 A;  3REJ D;  1M1A C;  2Y2I A;  5B1L D;  2J8P A;  1P3L B;  4LD9 A;  3WAA D;  3AFA D;  2ZY2 A;  3AZH B;  1KX3 D;  5B33 B;  2PYO A;  3TU4 D;  2JSS A;  3R45 B;  4J8U D;  3X1T C;  3REK D;  3LJA B;  3AZM B;  1JFI B;  3W99 C;  5B2I A;  1U35 C;  4M6B A;  3MGP D;  3C1C B;  4WV4 B;  3AZH A;  1P3I D;  1M18 C;  2FJ7 B;  2F8N A;  3AZE C;  4CAY A;  2NQB D;  1KU5 A;  3LJA A;  1JFI A;  1ZLA A;  3B6G D;  5DNM D;  5B24 D;  4R8P D;  3KUY B;  3X1U D;  1M19 D;  2FJ7 A;  2NZD A;  3WTP D;  3UT9 C;  4KUD D;  3AZK A;  2HUE B;  2L5A A;  1TAF B;  5B2I D;  1P3M A;  4AWL B;  5B40 B;  3KUY A;  4J8W A;  5GXQ D;  5B0Y B;  4J8V D;  5AV9 B;  3KXB B;  3B0C T;  4X23 C;  1P34 C;  5B40 A;  1P3A C;  5B0Y A;  5AV6 D;  3WKJ C;  2CV5 C;  5GT0 A;  1P3M D;  3AZI B;  1A7W A;  4YS3 C;  3C1B D;  4XZQ B;  1AOI C;  1P3G A;  3WA9 C;  2Y2G A;  5AVC B;  1Q9C A;  3X1V A;  4XUJ A;  4G91 B;  3AYW B;  5B32 A;  3AZI A;  3MNN D;  3X1S B;  3O62 D;  1P3P D;  3AV1 B;  3UTA A;  3MVD C;  3W96 D;  1F66 B;  5B2J D;  3LZ1 D;  3A6N B;  1P3O C;  3AZN C;  5CP6 D;  4ZUX B;  3B0D C;  2ARO C;  1ID3 B;  1M1A A;  1B67 A;  4H9S A;  3LZ0 C;  4KGC B;  3B6F B;  4LD9 C;  3AN2 D;  3W98 B;  1F66 A;  1P3B B;  2PYO C;  1T3U A;  3REH C;  4J8X D;  3X1T A;  5G49 B;  1P3L C;  4KGC A;  3B6F A;  5BT1 D;  4QLC D;  2CWE A;  3MGR A;  3AZH C;  5B33 C;  3VH6 A;  5B1M D;  5JRG B;  3LJA C;  3AZM C;  1ZLA C;  5AV5 D;  1HQ3 B;  1M1A D;  3UTB D;  4WU9 B;  2NZD C;  3C1C C;  2FJ7 C;  1B6W A;  2BYM B;  3W99 D;  3LEL B;  1U35 D;  5DNN B;  3KUY C;  4J8W C;  1M18 D;  5B0Z B;  5AV8 B;  3AZE D;  2G5H C;  2HUE C;  3VH6 W;  2BYM A;  5GT3 B;  4X23 A;  1P34 A;  4WU8 B;  3AZL B;  4AWL C;  2F2A C;  4JJN A;  5DNN A;  5B40 C;  3AZJ B;  1EQZ B;  5AY8 D;  5B0Y C;  5B0Z A;  5AV8 A;  3UT9 D;  5AV9 C;  1S32 B;  3KXB C;  5GT3 A;  2CV5 A;  3V9R B;  3AZL A;  3A1K A;  2RIQ A;  3WA9 A;  2HIO B;  4NE3 A;  4XUJ C;  1S32 A;  4YM6 B;  1P34 D;  3AZI C;  3V9R A;  4XZQ C;  1P3A D;  5AVC C;  4G91 C;  3WKJ D;  4H9N A;  3AYW C;  2CV5 D;  1KX4 A;  5AVB B;  3WTP E;  4YS3 D;  3MGS D;  5GSU B;  3X1S C;  1AOI D;  3NQU B;  2ARO A;  3AV1 C;  4H9S C;  3LZ0 A;  3TU4 B;  1BH9 B;  4CSR B;  1F66 C;  5E5A B;  3A6N C;  4H9R A;  1KX5 D;  3REH A;  5CPJ D;  5GSU A;  4ZUX C;  1WWS A;  1P3L A;  4KGC C;  3MVD D;  1BH9 A;  3B6F C;  5CPI B;  4CSR A;  3W98 C;  5E5A A;  3MGR C;  5BO0 B;  2NQB B;  1P3B C;  1P3O D;  3AZN D;  5B33 A;  3REL D;  3B6G B;  5DNM B;  2RVQ C;  3R45 A;  4R8P B;  1PZR A;  4Z66 B;  3X1U B;  1M19 B;  3AZM A;  1WWI A;  3LZ0 D;  4LD9 D;  5CPI A;  3C1C A;  1HTA A;  4H9P B;  2PYO D;  3REI B;  1BFM A;  5JRG C;  4H9Q B;  4Z66 A;  1HQ3 C;  5F99 B;  4WU9 C;  5CPK B;  3AZH D;  4H9P A;  2F8N D;  1ULY A;  3H0L C;  4NE6 A;  3REI A;  4H9Q A;  3LJA D;  1TAF A;  3LEL C;  1ZLA D;  5F99 A;  5AV6 B;  4G92 B;  4JJN C;  5DNN C;  2NZD D;  1F1E A;  5CPK A;  2FJ7 D;  5B0Z C;  5AV8 C;  5AV9 A;  3AZK D;  3KXB A;  5GT3 C;  4WU8 C;  3AZL C;  3AZJ C;  3KUY D;  3EG5 B;  1P3F B;  3KWQ B;  4J8W D;  4DQY B;  1EQZ C;  1S32 C;  4EO5 B;  1TZY B;  1P3G B;  1P3P B;  3W97 B;  4XZQ A;  4H9O B;  5B40 D;  1P3F A;  5B2J B;  3KWQ A;  3VH5 T;  5B0Y D;  5AVC A;  3AZG B;  1TZY A;  2YFW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...