4ZBJB

Ubn1 peptide bound to h3.3/h4/asf1
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
74
structure length
74
Chain Sequence
ALIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone chaperone ASF1
publication title Ubinuclein-1 confers histone H3.3-specific-binding by the HIRA histone chaperone complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Structural protein
total genus 26
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2015-04-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4zbjB00
5AV6B 5E5AB 3UT9B 3B0DC 3LZ0B 3B6FA 3W98D 4H9SA 4WU9B 5JRGB 2AROA 3REJD 1P3OD 1M18A 5AV9C 3C1BA 3V9RB 3AZIC 5B24A 5AVCD 2JSSA 1TAFA 3R45A 1U35A 4H9RB 5GT3C 3VH6A 3W97C 2HUEB 5B2IB 1M1AB 3WAAD 4R8PD 3NQJA 5B0YD 4UUZA 3AZFA 1KX4B 4HGAB 4NE6A 2RVQD 1N1JA 3VH5T 5AV6C 1P3AA 3MGQB 3UT9C 2BYKA 4YM6A 3AZHA 4Z5TA 1AOIA 4WU9C 5BNXA 5JRGC 2F8ND 5B32B 5AV9D 1KX3D 3X1TA 5B0ZB 4Z66A 3VH6W 5GT3D 5FUGA 1P3FA 3W97D 5BS7C 2FJ7D 3REJA 2HUEC 3X1SB 5B2IC 1M1AC 4WNNB 4WU8B 5CPJA 5DNNA 4WV4B 1KX4C 3B6FB 4HGAC 5AV6D 4X23D 5E5AD 3UT9D 3MGQC 2AROB 3LZ0D 1M18B 4WU9D 5JRGD 3KWQA 3C1BB 5B24B 5B2JD 1HTAA 4E45A 5B32C 4KHAA 1TAFB 4JJNA 3R45B 1U35B 5B0ZC 4KGCA 4AWLB 4CAYA 3VH5A 2F8NA 3B0CT 1P3ID 2NZDA 3NQJB 3AZFB 4UUZB 3X1SC 1M1AD 1F66A 4WU8C 1KX3A 1N1JB 1P3AB 3AV2D 1WWSA 2BYKB 4YM6B 4Z5TB 3AZHB 1AOIB 3B6FC 4H9SC 5BNXB 4G92B 2AROC 2FJ7A 1KX5A 1M18C 3C1BC 3X1TB 5B1MA 5B32D 3AZLA 4Z66B 4X23A 5E5AA 1U35C 3VH5W 5B0ZD 5FUGB 1P3FB 3LZ0A 3REJB 4AWLC 3TU4A 5B2JA 5CPJB 5DNNB 5CP6A 4QLCB 3AZFC 3X1SD 1P3AC 4NE3A 4YM6C 3AZHC 4Z5TC 1AOIC 3B6FD 3KWQB 4G92C 1P3IA 2AROD 4KHAB 3C1BD 5B24D 4JJNB 5GSUA 3AV2A 3X1TC 4LD9A 4KGCB 4Z66C 1ULYA 4CAYB 3RELD 1U35D 2F8NB 5CHLB 3KUYA 5B1LA 5AVBA 3UTAA 1P3FC 2NZDB 4G91B 3REJC 1P3OC 4H9QA 1F66B 5B31D 1KX3B 5CPJC 5DNNC 1P3AD 4YM6D 2FJ7B 3AZHD 4Z5TD 3MGPA 1KX5B 1P3MB 5B1MB 3AZLB 2RVQC 4JJNC 4X23B 3X1TD 4KGCC 4Z66D 3TU4B 5B2JB 1P3FD 2NZDC 5GXQD 3REID 5CP6B 4G91C 4H9PA 1F66C 1KX3C 5CPJD 5DNND 4QLCD 1Q9CA 2IO5B 4H9OA 3RELA 3AZKA 5C3IB 1P3IB 2FJ7C 3B6GA 1KX5C 2LY8A 3MGRA 3KWQD 5B31A 3WTPA 5GSUB 3AV2B 4LD9B 5B1MC 3AZLC 5GT0A 4NFTA 4JJND 4CSRA 4H9NA 5AY8D 5E5AC 4X23C 3X1VA 3KUYB 5B1LB 5AV8A 5AVBB 3LZ0C 3UTAB 4KGCD 3TU4C 4H9QB 2PYOD 5B2JC 2NZDD 5CP6C 4YS3A 3AZNA 1F66D 3AZJA 4Z2MH 3MGPB 2IO5C 1M19A 5C3IC 1P3IC 5GXQA 3REIA 1WWIA 1KX5D 2HIOA 5GSUC 1P3MD 3AV2C 4LD9C 4QLCA 3AZEA 5B1MD 3AZLD 1HQ3D 3O62A 3KUYC 5B1LC 5AVBC 3UTAC 1KU5A 5CPIA 3REHD 3TU4D 4H9PB 5CP6D 3B0BA 3AZGA 3RELB 4H9OB 5AY8A 3AZKB 1P3PD 3B6GB 3MGRB 5B31B 3WTPB 2PYOA 1P34A 4KUDD 5GT0B 3X1UA 4CSRB 5GSUD 4H9NB 4LD9D 3X1VB 2F8NH 2NQBA 3WKJD 5AV8B 3KUYD 5B1LD 5AVBD 3UTAD 4YS3B 3AZNB 5B24C 1P3BA 1P3MA 3KXBD 1HQ3A 3AZJB 3RELC 1M19B 5GXQB 3REIB 3B6GC 3MGPD 3REHA 3MGRC 5B31C 2HIOB 1BH8A 3AZEB 5GT0C 3LJAB 3O62B 1TZYA 3X1VC 1P3PA 5AV8C 5CPIB 4J8VA 4KUDA 4XUJA 1ID3A 4J8WA 4YS3C 3AZMA 3AZGB 3AZNC 5AY8B 4J8UA 3AV1A 3WKJA 3AZJC 1H3OA 3AYWA 5B32G 3AZKD 1M19C 2PYOB 5CPKA 1P34B 4EO5B 5GXQC 3REIC 3B6GD 3X1UB 3MGRD 3WTPD 2HIOC 4QLCC 3KXBA 3LELA 3AZEC 5GT0D 2NQBB 3O62C 3X1VD 2CV5D 4XZQD 1BH9A 3NQUA 5AV8D 3W96D 1P3GA 5CPIC 3MNND 3KWQC 2YFVA 4WZSB 1P3BB 3B0CW 4YS3D 3KSYA 1HQ3B 3AZGC 1EQZA 3AZND 5B33A 4DRBA 5AY8C 5DNMD 3AZJD 3REHB 5BT1C 1M19D 2PYOC 3AZIB 1P34C 3AFAA 4EO5C 1BH8B 3W99A 3X1UC 1TZYB 2HIOD 3AN2D 4J8XA 3AZED 2NQBC 1P3PB 3LJAD 3O62D 1S32A 3WA9A 4J8VB 4KUDB 5AV5D 4XUJB 1ID3B 4J8WB 2CWEA 5CPID 3AZMB 1A7WA 5B40A 5BO0A 1P3BC 1P3MC 3MVDD 4J8UB 3AV1B 3WKJB 1HQ3C 3AZGD 3C1CA 1H3OB 4ZUXD 4Z2MG 3AYWB 2CV5A 4XZQA 5CPKB 3W96A 3REHC 5BT1D 3MNNA 5G49A 3REKA 1P34D 3KXBB 3LELB 1P3LD 3X1UD 1TZYC 5KDMA 5DNMA 2NQBD 1P3KA 3LZ1A 1P3PC 1BH9B 3NQUB 5BNVA 1P3GB 4J8VC 2YFVB 3A6NA 4KUDC 4XUJC 1ID3C 4J8WC 1EQZB 3AZMC 2F8NK 3MGSD 5B33B 5F99D 1P3BD 3AN2A 1ZLAA 4J8UC 3AV1C 3WKJC 3LJAA 3AYWC 5CPKC 3AFAB 5AV5A 3W99B 2L5AA 3AZID 3UTBA 3MVDA 4J8XB 3KXBC 3LELC 2F8NG 4ZUXA 1S32B 1TZYD 3WA9B 3W98A 3MGPC 4ZBJB 1P3GC 4J8VD 1P3OA 5B40B 4DRAA 5BO0B 4XUJD 5AVCA 3WTPE 4J8WD 1P3LA 1ID3D 3AZMD 1EQZC 3C1CB 5B33C 4J8UD 4XZQB 3AV1D 2CV5B 3W96B 3MNNB 3AYWD 5G49B 3REKB 5CPKD 3WAAA 4R8PA 3AFAC 1F1EA 3W99C 3MGSC 5B0YA 1JFIA 3MGSA 5F99A 5KDMB 5DNMB 4J8XC 3LELD 1P3KB 3LZ1B 5BNVB 1S32C 1B6WA 3WA9C 3AZKC 3A6NB 1P3GD 4ZBJC 1BFMA 5B2ID 5AV9A 3WTPC 3AZIA 5B40C 3AN2B 1ZLAB 1KX4D 1EQZD 3C1CC 4M6BA 5B33D 5JA4A 2CV5C 4XZQC 5GT3A 3MGQD 5AV5B 3W96C 3W97A 1B67A 2YFWA 3MNNC 3REKC 3AFAD 3UTBB 3MVDB 3W99D 2BYMA 4ZUXB 3W98B 5DNMC 5AV6A 4J8XD 3UT9A 1P3KC 3LZ1C 1S32D 3WA9D 1P3OB 1R4VA 4WU9A 5JRGA 3A6NC 5AVCB 1P3LB 3V9RA 5B40D 4WU8D 3AN2C 1ZLAC 4NE5A 3LJAC 3C1CD 4H9RA 3WAAB 4R8PB 5AV5C 5BS7A 5B0YB 1M18D 3MGSB 5B2IA 1M1AA 5F99B 1JFIB 3REKD 3UTBC 3MVDC 3B0DB 1KX4A 3VH6T 4ZUXC 3W98C 3MGQA 3LZ1D 1P3KD 4E44A 5AV9B 3A6ND 5AVCC 1P3LC 5B32A 3AZFD 5JA4B 1ZLAD 5GT3B 5B0ZA 5B31G 3W97B 1AOID 2YFWB 3WAAC 4R8PC 5B0YC 2BYMB 3X1SA 5F99C 4WNNA 4WU8A 3UTBD
chains in the Genus database with same CATH superfamily
5AV6B 5E5AB 2RIQA 3UT9B 2XD5A 3B0DC 3LZ0B 3B6FA 3W98D 4H9SA 4WU9B 5JRGB 2AROA 2ZY2A 3REJD 1P3OD 1M18A 5AV9C 3C1BA 3V9RB 3AZIC 5B24A 3IP4C 5AVCD 2JSSA 1TAFA 3R45A 1U35A 4H9RB 5GT3C 3VH6A 3W97C 2HUEB 5B2IB 1M1AB 3WAAD 4R8PD 3NQJA 5B0YD 4UUZA 3AZFA 1KX4B 4HGAB 4NE6A 2RVQD 1N1JA 3VH5T 5AV6C 1P3AA 2XD1A 3EG5B 3MGQB 3UT9C 2BYKA 4YM6A 3AZHA 4Z5TA 1AOIA 4WU9C 5BNXA 5JRGC 2F8ND 5B32B 2Y2MA 2Y2NA 5AV9D 1KX3D 3X1TA 5B0ZB 4Z66A 3VH6W 3EPKA 5GT3D 5FUGA 3H0LC 1P3FA 3W97D 5BS7C 2FJ7D 3REJA 2HUEC 3X1SB 5B2IC 1M1AC 4WNNB 4WU8B 5CPJA 5DNNA 4WV4B 1KX4C 2G5HC 3B6FB 4HGAC 5AV6D 4X23D 5E5AD 3UT9D 3MGQC 2AROB 3LZ0D 1M18B 4WU9D 5JRGD 3KWQA 3C1BB 1HTAA 5B2JD 5B24B 4E45A 5B32C 2F2AC 4KHAA 1TAFB 4JJNA 3A1IA 3R45B 1U35B 5B0ZC 4KGCA 4AWLB 4CAYA 3VH5A 2F8NA 3B0CT 1P3ID 2NZDA 3NQJB 3AZFB 4UUZB 3X1SC 1M1AD 1F66A 4WU8C 3H0RC 1KX3A 1N1JB 1P3AB 2ZY4A 3AV2D 1WWSA 2BYKB 4YM6B 4Z5TB 3AZHB 1AOIB 3B6FC 4H9SC 5BNXB 4G92B 2AROC 2FJ7A 1KX5A 1M18C 3C1BC 3X1TB 5B1MA 5B32D 3AZLA 4Z66B 4X23A 5E5AA 1U35C 3VH5W 5B0ZD 5FUGB 1P3FB 3LZ0A 3REJB 4AWLC 3TU4A 5B2JA 5CPJB 5DNNB 5CP6A 4QLCB 3AZFC 3X1SD 1P3AC 4NE3A 4YM6C 3AZHC 4Z5TC 1AOIC 3B6FD 3KWQB 4G92C 1P3IA 2AROD 4KHAB 3C1BD 5B24D 4JJNB 5GSUA 3AV2A 3X1TC 4LD9A 4KGCB 4Z66C 1ULYA 2DQNC 4CAYB 3RELD 1U35D 2F8NB 3KFUG 5CHLB 3KUYA 5B1LA 5AVBA 3UTAA 1P3FC 2NZDB 4G91B 3REJC 1P3OC 4H9QA 1F66B 5B31D 1KX3B 5CPJC 5DNNC 2JE5A 2J8PA 1P3AD 4YM6D 2FJ7B 3AZHD 4Z5TD 3MGPA 1KX5B 1P3MB 5B1MB 3AZLB 2RVQC 4JJNC 4X23B 3X1TD 4KGCC 4Z66D 3TU4B 5B2JB 1P3FD 2NZDC 5GXQD 3REID 5CP6B 4G91C 4H9PA 1F66C 1KX3C 5CPJD 5DNND 4QLCD 1Q9CA 2IO5B 4H9OA 3RELA 3AZKA 5C3IB 1P3IB 2FJ7C 3B6GA 1KX5C 2LY8A 3MGRA 3KWQD 5B31A 3WTPA 5GSUB 3AV2B 4LD9B 5B1MC 3AZLC 5GT0A 4NFTA 4JJND 4CSRA 4H9NA 5AY8D 5E5AC 4X23C 3X1VA 3KUYB 2VQRA 5B1LB 5AV8A 5AVBB 3LZ0C 3UTAB 4KGCD 1T3UA 2ZM5A 3TU4C 4H9QB 2ZY5A 2PYOD 5B2JC 2NZDD 5CP6C 4YS3A 3AZNA 1F66D 3AZJA 4Z2MH 3MGPB 2IO5C 1M19A 5C3IC 1P3IC 5GXQA 3REIA 1WWIA 1KX5D 5GSUC 2HIOA 1P3MD 1PZRA 3AV2C 4QLCA 3AZEA 5B1MD 3AZLD 1Z2CB 1HQ3D 4LD9C 3O62A 3KUYC 5B1LC 5AVBC 3UTAC 1KU5A 5CPIA 3REHD 3TU4D 4H9PB 3H0MC 5CP6D 3B0BA 3AZGA 3RELB 3A1KA 4H9OB 5AY8A 3AZKB 1P3PD 3B6GB 3MGRB 5B31B 3WTPB 2PYOA 1P34A 4KUDD 5GT0B 3X1UA 4CSRB 5GSUD 4H9NB 4LD9D 3X1VB 2F8NH 4DQYB 2NQBA 3WKJD 5AV8B 3KUYD 5B1LD 5AVBD 3UTAD 4YS3B 3AZNB 5B24C 1P3BA 1P3MA 2UWXA 3KXBD 1HQ3A 3AZJB 3RELC 1M19B 2Y2QA 5GXQB 3REIB 3B6GC 2G5IC 3MGPD 3REHA 2W8SA 3MGRC 2BG1A 5B31C 2HIOB 1BH8A 3AZEB 5GT0C 3LJAB 1W2EA 3O62B 2Y2GA 1TZYA 3X1VC 1P3PA 5AV8C 5CPIB 4J8VA 4KUDA 2Y2LA 4XUJA 4J8WA 1ID3A 4YS3C 3AZMA 3AZGB 3AZNC 5AY8B 4J8UA 3AV1A 3WKJA 3AZJC 1H3OA 3AYWA 5B32G 3AZKD 1M19C 2PYOB 5CPKA 1P34B 4EO5B 5GXQC 3REIC 3B6GD 3X1UB 3MGRD 3WTPD 2HIOC 4QLCC 3KXBA 3LELA 2Y2HA 5GT0D 3AZEC 2NQBB 3O62C 3X1VD 2CV5D 4XZQD 1BH9A 3NQUA 5AV8D 3W96D 2Y2JA 5CPIC 1P3GA 2ZY3A 3MNND 3KWQC 2YFVA 4WZSB 1P3BB 3B0CW 4YS3D 3KSYA 1HQ3B 3AZGC 1EQZA 3AZND 5B33A 4DRBA 5AY8C 5DNMD 3AZJD 3REHB 5BT1C 1M19D 2PYOC 3AZIB 1P34C 3AFAA 4EO5C 1BH8B 3W99A 3X1UC 1TZYB 2HIOD 3AN2D 4J8XA 3AZED 2NQBC 1P3PB 3LJAD 3O62D 1S32A 3WA9A 4J8VB 4KUDB 5AV5D 4XUJB 1ID3B 4J8WB 2CWEA 5CPID 3AZMB 2Y2IA 1A7WA 5B40A 5BO0A 1P3BC 1P3MC 3MVDD 4J8UB 3AV1B 3WKJB 1HQ3C 3AZGD 3C1CA 1H3OB 4ZUXD 4Z2MG 3AYWB 2CV5A 4XZQA 5CPKB 3W96A 3REHC 5BT1D 3MNNA 5G49A 3REKA 1P34D 2JCHA 3KXBB 3LELB 1P3LD 3X1UD 1TZYC 5KDMA 5DNMA 2NQBD 1P3KA 3LZ1A 1P3PC 1BH9B 3NQUB 5BNVA 1P3GB 2Y2KA 4J8VC 2YFVB 3A6NA 4KUDC 4XUJC 1ID3C 4J8WC 1EQZB 3AZMC 2F8NK 3MGSD 5B33B 5F99D 1P3BD 3AN2A 1ZLAA 4J8UC 3AV1C 3WKJC 3LJAA 3AYWC 5CPKC 3AFAB 5AV5A 3EPJA 3W99B 2L5AA 3AZID 3UTBA 3MVDA 4J8XB 3KXBC 3LELC 2F8NG 4ZUXA 1S32B 1TZYD 3WA9B 3W98A 3AL0C 3MGPC 4ZBJB 1P3GC 4J8VD 1P3OA 5B40B 4DRAA 5BO0B 4XUJD 5AVCA 3WTPE 4J8WD 1P3LA 1ID3D 3AZMD 1EQZC 4WJ3C 3C1CB 5B33C 4J8UD 4XZQB 3AV1D 2CV5B 3W96B 3P5JB 3MNNB 3AYWD 5G49B 3REKB 5CPKD 3WAAA 4R8PA 3AFAC 1F1EA 3W99C 3MGSC 5B0YA 1JFIA 3MGSA 5F99A 5KDMB 5DNMB 4J8XC 3LELD 1P3KB 3LZ1B 5BNVB 1S32C 1B6WA 3WA9C 3AZKC 3A6NB 1P3GD 4ZBJC 1BFMA 5B2ID 5AV9A 3WTPC 3AZIA 5B40C 3AN2B 1ZLAB 1KX4D 1EQZD 2FFFB 3C1CC 4M6BA 5B33D 5JA4A 2CV5C 4XZQC 5GT3A 3MGQD 5AV5B 3W96C 3W97A 1B67A 2YFWA 3MNNC 3REKC 3AFAD 3UTBB 3MVDB 3W99D 2BYMA 4ZUXB 3W98B 5DNMC 5AV6A 4J8XD 2DF4C 3UT9A 1P3KC 3LZ1C 2Y2PA 1S32D 3WA9D 2Y2OA 1P3OB 1R4VA 4WU9A 5JRGA 3A6NC 5AVCB 1P3LB 3EPHA 3V9RA 5B40D 4WU8D 3AN2C 1ZLAC 3F6TA 4NE5A 3LJAC 3C1CD 4H9RA 3WAAB 4R8PB 5AV5C 5BS7A 5B0YB 1M18D 3MGSB 5B2IA 1M1AA 5F99B 1JFIB 3REKD 3UTBC 3MVDC 3B0DB 1KX4A 3VH6T 4ZUXC 3W98C 3MGQA 3LZ1D 1P3KD 3FDDA 4E44A 5AV9B 3A6ND 3EPLA 5AVCC 1P3LC 5B32A 3AZFD 5JA4B 1ZLAD 4UPKA 5GT3B 5B31G 5B0ZA 3W97B 1AOID 2YFWB 3WAAC 4R8PC 5B0YC 2BYMB 3X1SA 5F99C 4WNNA 4WU8A 3UTBD
chains in the Genus database with same CATH topology
5AV6B 5E5AB 2RIQA 3UT9B 2XD5A 3B0DC 3LZ0B 3B6FA 3W98D 4H9SA 4WU9B 5JRGB 2AROA 2ZY2A 3REJD 1P3OD 1M18A 5AV9C 3C1BA 3V9RB 3AZIC 5B24A 3IP4C 5AVCD 2JSSA 1TAFA 3R45A 1U35A 4H9RB 5GT3C 3VH6A 3W97C 2HUEB 5B2IB 1M1AB 3WAAD 4R8PD 3NQJA 5B0YD 4UUZA 3AZFA 1KX4B 4HGAB 4NE6A 2RVQD 1N1JA 3VH5T 5AV6C 1P3AA 2XD1A 3EG5B 3MGQB 3UT9C 2BYKA 4YM6A 3AZHA 4Z5TA 1AOIA 4WU9C 5BNXA 5JRGC 2F8ND 5B32B 2Y2MA 2Y2NA 5AV9D 1KX3D 3X1TA 5B0ZB 4Z66A 3VH6W 3EPKA 5GT3D 5FUGA 3H0LC 1P3FA 3W97D 5BS7C 2FJ7D 3REJA 2HUEC 3X1SB 5B2IC 1M1AC 4WNNB 4WU8B 5CPJA 5DNNA 4WV4B 1KX4C 2G5HC 3B6FB 4HGAC 5AV6D 4X23D 5E5AD 3UT9D 3MGQC 2AROB 3LZ0D 1M18B 4WU9D 5JRGD 3KWQA 3C1BB 1HTAA 5B2JD 5B24B 4E45A 5B32C 2F2AC 4KHAA 1TAFB 4JJNA 3A1IA 3R45B 1U35B 5B0ZC 4KGCA 4AWLB 4CAYA 3VH5A 2F8NA 3B0CT 1P3ID 2NZDA 3NQJB 3AZFB 4UUZB 3X1SC 1M1AD 1F66A 4WU8C 3H0RC 1KX3A 1N1JB 1P3AB 2ZY4A 3AV2D 1WWSA 2BYKB 4YM6B 4Z5TB 3AZHB 1AOIB 3B6FC 4H9SC 5BNXB 4G92B 2AROC 2FJ7A 1KX5A 1M18C 3C1BC 3X1TB 5B1MA 5B32D 3AZLA 4Z66B 4X23A 5E5AA 1U35C 3VH5W 5B0ZD 5FUGB 1P3FB 3LZ0A 3REJB 4AWLC 3TU4A 5B2JA 5CPJB 5DNNB 5CP6A 4QLCB 3AZFC 3X1SD 1P3AC 4NE3A 4YM6C 3AZHC 4Z5TC 1AOIC 3B6FD 3KWQB 4G92C 1P3IA 2AROD 4KHAB 3C1BD 5B24D 4JJNB 5GSUA 3AV2A 3X1TC 4LD9A 4KGCB 4Z66C 1ULYA 2DQNC 4CAYB 3RELD 1U35D 2F8NB 3KFUG 5CHLB 3KUYA 5B1LA 5AVBA 3UTAA 1P3FC 2NZDB 4G91B 3REJC 1P3OC 4H9QA 1F66B 5B31D 1KX3B 5CPJC 5DNNC 2JE5A 2J8PA 1P3AD 4YM6D 2FJ7B 3AZHD 4Z5TD 3MGPA 1KX5B 1P3MB 5B1MB 3AZLB 2RVQC 4JJNC 4X23B 3X1TD 4KGCC 4Z66D 3TU4B 5B2JB 1P3FD 2NZDC 5GXQD 3REID 5CP6B 4G91C 4H9PA 1F66C 1KX3C 5CPJD 5DNND 4QLCD 1Q9CA 2IO5B 4H9OA 3RELA 3AZKA 5C3IB 1P3IB 2FJ7C 3B6GA 1KX5C 2LY8A 3MGRA 3KWQD 5B31A 3WTPA 5GSUB 3AV2B 4LD9B 5B1MC 3AZLC 5GT0A 4NFTA 4JJND 4CSRA 4H9NA 5AY8D 5E5AC 4X23C 3X1VA 3KUYB 2VQRA 5B1LB 5AV8A 5AVBB 3LZ0C 3UTAB 4KGCD 1T3UA 2ZM5A 3TU4C 4H9QB 2ZY5A 2PYOD 5B2JC 2NZDD 5CP6C 4YS3A 3AZNA 1F66D 3AZJA 4Z2MH 3MGPB 2IO5C 1M19A 5C3IC 1P3IC 5GXQA 3REIA 1WWIA 1KX5D 5GSUC 2HIOA 1P3MD 1PZRA 3AV2C 4QLCA 3AZEA 5B1MD 3AZLD 1Z2CB 1HQ3D 4LD9C 3O62A 3KUYC 5B1LC 5AVBC 3UTAC 1KU5A 5CPIA 3REHD 3TU4D 4H9PB 3H0MC 5CP6D 3B0BA 3AZGA 3RELB 3A1KA 4H9OB 5AY8A 3AZKB 1P3PD 3B6GB 3MGRB 5B31B 3WTPB 2PYOA 1P34A 4KUDD 5GT0B 3X1UA 4CSRB 5GSUD 4H9NB 4LD9D 3X1VB 2F8NH 4DQYB 2NQBA 3WKJD 5AV8B 3KUYD 5B1LD 5AVBD 3UTAD 4YS3B 3AZNB 5B24C 1P3BA 1P3MA 2UWXA 3KXBD 1HQ3A 3AZJB 3RELC 1M19B 2Y2QA 5GXQB 3REIB 3B6GC 2G5IC 3MGPD 3REHA 2W8SA 3MGRC 2BG1A 5B31C 2HIOB 1BH8A 3AZEB 5GT0C 3LJAB 1W2EA 3O62B 2Y2GA 1TZYA 3X1VC 1P3PA 5AV8C 5CPIB 4J8VA 4KUDA 2Y2LA 4XUJA 4J8WA 1ID3A 4YS3C 3AZMA 3AZGB 3AZNC 5AY8B 4J8UA 3AV1A 3WKJA 3AZJC 1H3OA 3AYWA 5B32G 3AZKD 1M19C 2PYOB 5CPKA 1P34B 4EO5B 5GXQC 3REIC 3B6GD 3X1UB 3MGRD 3WTPD 2HIOC 4QLCC 3KXBA 3LELA 2Y2HA 5GT0D 3AZEC 2NQBB 3O62C 3X1VD 2CV5D 4XZQD 1BH9A 3NQUA 5AV8D 3W96D 2Y2JA 5CPIC 1P3GA 2ZY3A 3MNND 3KWQC 2YFVA 4WZSB 1P3BB 3B0CW 4YS3D 3KSYA 1HQ3B 3AZGC 1EQZA 3AZND 5B33A 4DRBA 5AY8C 5DNMD 3AZJD 3REHB 5BT1C 1M19D 2PYOC 3AZIB 1P34C 3AFAA 4EO5C 1BH8B 3W99A 3X1UC 1TZYB 2HIOD 3AN2D 4J8XA 3AZED 2NQBC 1P3PB 3LJAD 3O62D 1S32A 3WA9A 4J8VB 4KUDB 5AV5D 4XUJB 1ID3B 4J8WB 2CWEA 5CPID 3AZMB 2Y2IA 1A7WA 5B40A 5BO0A 1P3BC 1P3MC 3MVDD 4J8UB 3AV1B 3WKJB 1HQ3C 3AZGD 3C1CA 1H3OB 4ZUXD 4Z2MG 3AYWB 2CV5A 4XZQA 5CPKB 3W96A 3REHC 5BT1D 3MNNA 5G49A 3REKA 1P34D 2JCHA 3KXBB 3LELB 1P3LD 3X1UD 1TZYC 5KDMA 5DNMA 2NQBD 1P3KA 3LZ1A 1P3PC 1BH9B 3NQUB 5BNVA 1P3GB 2Y2KA 4J8VC 2YFVB 3A6NA 4KUDC 4XUJC 1ID3C 4J8WC 1EQZB 3AZMC 2F8NK 3MGSD 5B33B 5F99D 1P3BD 3AN2A 1ZLAA 4J8UC 3AV1C 3WKJC 3LJAA 3AYWC 5CPKC 3AFAB 5AV5A 3EPJA 3W99B 2L5AA 3AZID 3UTBA 3MVDA 4J8XB 3KXBC 3LELC 2F8NG 4ZUXA 1S32B 1TZYD 3WA9B 3W98A 3AL0C 3MGPC 4ZBJB 1P3GC 4J8VD 1P3OA 5B40B 4DRAA 5BO0B 4XUJD 5AVCA 3WTPE 4J8WD 1P3LA 1ID3D 3AZMD 1EQZC 4WJ3C 3C1CB 5B33C 4J8UD 4XZQB 3AV1D 2CV5B 3W96B 3P5JB 3MNNB 3AYWD 5G49B 3REKB 5CPKD 3WAAA 4R8PA 3AFAC 1F1EA 3W99C 3MGSC 5B0YA 1JFIA 3MGSA 5F99A 5KDMB 5DNMB 4J8XC 3LELD 1P3KB 3LZ1B 5BNVB 1S32C 1B6WA 3WA9C 3AZKC 3A6NB 1P3GD 4ZBJC 1BFMA 5B2ID 5AV9A 3WTPC 3AZIA 5B40C 3AN2B 1ZLAB 1KX4D 1EQZD 2FFFB 3C1CC 4M6BA 5B33D 5JA4A 2CV5C 4XZQC 5GT3A 3MGQD 5AV5B 3W96C 3W97A 1B67A 2YFWA 3MNNC 3REKC 3AFAD 3UTBB 3MVDB 3W99D 2BYMA 4ZUXB 3W98B 5DNMC 5AV6A 4J8XD 2DF4C 3UT9A 1P3KC 3LZ1C 2Y2PA 1S32D 3WA9D 2Y2OA 1P3OB 1R4VA 4WU9A 5JRGA 3A6NC 5AVCB 1P3LB 3EPHA 3V9RA 5B40D 4WU8D 3AN2C 1ZLAC 3F6TA 4NE5A 3LJAC 3C1CD 4H9RA 3WAAB 4R8PB 5AV5C 5BS7A 5B0YB 1M18D 3MGSB 5B2IA 1M1AA 5F99B 1JFIB 3REKD 3UTBC 3MVDC 3B0DB 1KX4A 3VH6T 4ZUXC 3W98C 3MGQA 3LZ1D 1P3KD 3FDDA 4E44A 5AV9B 3A6ND 3EPLA 5AVCC 1P3LC 5B32A 3AZFD 5JA4B 1ZLAD 4UPKA 5GT3B 5B31G 5B0ZA 3W97B 1AOID 2YFWB 3WAAC 4R8PC 5B0YC 2BYMB 3X1SA 5F99C 4WNNA 4WU8A 3UTBD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AV6 B;  5E5A B;  3UT9 B;  3B0D C;  3LZ0 B;  3B6F A;  3W98 D;  4H9S A;  4WU9 B;  5JRG B;  2ARO A;  3REJ D;  1P3O D;  1M18 A;  5AV9 C;  3C1B A;  3V9R B;  3AZI C;  5B24 A;  5AVC D;  2JSS A;  1TAF A;  3R45 A;  1U35 A;  4H9R B;  5GT3 C;  3VH6 A;  3W97 C;  2HUE B;  5B2I B;  1M1A B;  3WAA D;  4R8P D;  3NQJ A;  5B0Y D;  4UUZ A;  3AZF A;  1KX4 B;  4HGA B;  4NE6 A;  2RVQ D;  1N1J A;  3VH5 T;  5AV6 C;  1P3A A;  3MGQ B;  3UT9 C;  2BYK A;  4YM6 A;  3AZH A;  4Z5T A;  1AOI A;  4WU9 C;  5BNX A;  5JRG C;  2F8N D;  5B32 B;  5AV9 D;  1KX3 D;  3X1T A;  5B0Z B;  4Z66 A;  3VH6 W;  5GT3 D;  5FUG A;  1P3F A;  3W97 D;  5BS7 C;  2FJ7 D;  3REJ A;  2HUE C;  3X1S B;  5B2I C;  1M1A C;  4WNN B;  4WU8 B;  5CPJ A;  5DNN A;  4WV4 B;  1KX4 C;  3B6F B;  4HGA C;  5AV6 D;  4X23 D;  5E5A D;  3UT9 D;  3MGQ C;  2ARO B;  3LZ0 D;  1M18 B;  4WU9 D;  5JRG D;  3KWQ A;  3C1B B;  5B24 B;  5B2J D;  1HTA A;  4E45 A;  5B32 C;  4KHA A;  1TAF B;  4JJN A;  3R45 B;  1U35 B;  5B0Z C;  4KGC A;  4AWL B;  4CAY A;  3VH5 A;  2F8N A;  3B0C T;  1P3I D;  2NZD A;  3NQJ B;  3AZF B;  4UUZ B;  3X1S C;  1M1A D;  1F66 A;  4WU8 C;  1KX3 A;  1N1J B;  1P3A B;  3AV2 D;  1WWS A;  2BYK B;  4YM6 B;  4Z5T B;  3AZH B;  1AOI B;  3B6F C;  4H9S C;  5BNX B;  4G92 B;  2ARO C;  2FJ7 A;  1KX5 A;  1M18 C;  3C1B C;  3X1T B;  5B1M A;  5B32 D;  3AZL A;  4Z66 B;  4X23 A;  5E5A A;  1U35 C;  3VH5 W;  5B0Z D;  5FUG B;  1P3F B;  3LZ0 A;  3REJ B;  4AWL C;  3TU4 A;  5B2J A;  5CPJ B;  5DNN B;  5CP6 A;  4QLC B;  3AZF C;  3X1S D;  1P3A C;  4NE3 A;  4YM6 C;  3AZH C;  4Z5T C;  1AOI C;  3B6F D;  3KWQ B;  4G92 C;  1P3I A;  2ARO D;  4KHA B;  3C1B D;  5B24 D;  4JJN B;  5GSU A;  3AV2 A;  3X1T C;  4LD9 A;  4KGC B;  4Z66 C;  1ULY A;  4CAY B;  3REL D;  1U35 D;  2F8N B;  5CHL B;  3KUY A;  5B1L A;  5AVB A;  3UTA A;  1P3F C;  2NZD B;  4G91 B;  3REJ C;  1P3O C;  4H9Q A;  1F66 B;  5B31 D;  1KX3 B;  5CPJ C;  5DNN C;  1P3A D;  4YM6 D;  2FJ7 B;  3AZH D;  4Z5T D;  3MGP A;  1KX5 B;  1P3M B;  5B1M B;  3AZL B;  2RVQ C;  4JJN C;  4X23 B;  3X1T D;  4KGC C;  4Z66 D;  3TU4 B;  5B2J B;  1P3F D;  2NZD C;  5GXQ D;  3REI D;  5CP6 B;  4G91 C;  4H9P A;  1F66 C;  1KX3 C;  5CPJ D;  5DNN D;  4QLC D;  1Q9C A;  2IO5 B;  4H9O A;  3REL A;  3AZK A;  5C3I B;  1P3I B;  2FJ7 C;  3B6G A;  1KX5 C;  2LY8 A;  3MGR A;  3KWQ D;  5B31 A;  3WTP A;  5GSU B;  3AV2 B;  4LD9 B;  5B1M C;  3AZL C;  5GT0 A;  4NFT A;  4JJN D;  4CSR A;  4H9N A;  5AY8 D;  5E5A C;  4X23 C;  3X1V A;  3KUY B;  5B1L B;  5AV8 A;  5AVB B;  3LZ0 C;  3UTA B;  4KGC D;  3TU4 C;  4H9Q B;  2PYO D;  5B2J C;  2NZD D;  5CP6 C;  4YS3 A;  3AZN A;  1F66 D;  3AZJ A;  4Z2M H;  3MGP B;  2IO5 C;  1M19 A;  5C3I C;  1P3I C;  5GXQ A;  3REI A;  1WWI A;  1KX5 D;  2HIO A;  5GSU C;  1P3M D;  3AV2 C;  4LD9 C;  4QLC A;  3AZE A;  5B1M D;  3AZL D;  1HQ3 D;  3O62 A;  3KUY C;  5B1L C;  5AVB C;  3UTA C;  1KU5 A;  5CPI A;  3REH D;  3TU4 D;  4H9P B;  5CP6 D;  3B0B A;  3AZG A;  3REL B;  4H9O B;  5AY8 A;  3AZK B;  1P3P D;  3B6G B;  3MGR B;  5B31 B;  3WTP B;  2PYO A;  1P34 A;  4KUD D;  5GT0 B;  3X1U A;  4CSR B;  5GSU D;  4H9N B;  4LD9 D;  3X1V B;  2F8N H;  2NQB A;  3WKJ D;  5AV8 B;  3KUY D;  5B1L D;  5AVB D;  3UTA D;  4YS3 B;  3AZN B;  5B24 C;  1P3B A;  1P3M A;  3KXB D;  1HQ3 A;  3AZJ B;  3REL C;  1M19 B;  5GXQ B;  3REI B;  3B6G C;  3MGP D;  3REH A;  3MGR C;  5B31 C;  2HIO B;  1BH8 A;  3AZE B;  5GT0 C;  3LJA B;  3O62 B;  1TZY A;  3X1V C;  1P3P A;  5AV8 C;  5CPI B;  4J8V A;  4KUD A;  4XUJ A;  1ID3 A;  4J8W A;  4YS3 C;  3AZM A;  3AZG B;  3AZN C;  5AY8 B;  4J8U A;  3AV1 A;  3WKJ A;  3AZJ C;  1H3O A;  3AYW A;  5B32 G;  3AZK D;  1M19 C;  2PYO B;  5CPK A;  1P34 B;  4EO5 B;  5GXQ C;  3REI C;  3B6G D;  3X1U B;  3MGR D;  3WTP D;  2HIO C;  4QLC C;  3KXB A;  3LEL A;  3AZE C;  5GT0 D;  2NQB B;  3O62 C;  3X1V D;  2CV5 D;  4XZQ D;  1BH9 A;  3NQU A;  5AV8 D;  3W96 D;  1P3G A;  5CPI C;  3MNN D;  3KWQ C;  2YFV A;  4WZS B;  1P3B B;  3B0C W;  4YS3 D;  3KSY A;  1HQ3 B;  3AZG C;  1EQZ A;  3AZN D;  5B33 A;  4DRB A;  5AY8 C;  5DNM D;  3AZJ D;  3REH B;  5BT1 C;  1M19 D;  2PYO C;  3AZI B;  1P34 C;  3AFA A;  4EO5 C;  1BH8 B;  3W99 A;  3X1U C;  1TZY B;  2HIO D;  3AN2 D;  4J8X A;  3AZE D;  2NQB C;  1P3P B;  3LJA D;  3O62 D;  1S32 A;  3WA9 A;  4J8V B;  4KUD B;  5AV5 D;  4XUJ B;  1ID3 B;  4J8W B;  2CWE A;  5CPI D;  3AZM B;  1A7W A;  5B40 A;  5BO0 A;  1P3B C;  1P3M C;  3MVD D;  4J8U B;  3AV1 B;  3WKJ B;  1HQ3 C;  3AZG D;  3C1C A;  1H3O B;  4ZUX D;  4Z2M G;  3AYW B;  2CV5 A;  4XZQ A;  5CPK B;  3W96 A;  3REH C;  5BT1 D;  3MNN A;  5G49 A;  3REK A;  1P34 D;  3KXB B;  3LEL B;  1P3L D;  3X1U D;  1TZY C;  5KDM A;  5DNM A;  2NQB D;  1P3K A;  3LZ1 A;  1P3P C;  1BH9 B;  3NQU B;  5BNV A;  1P3G B;  4J8V C;  2YFV B;  3A6N A;  4KUD C;  4XUJ C;  1ID3 C;  4J8W C;  1EQZ B;  3AZM C;  2F8N K;  3MGS D;  5B33 B;  5F99 D;  1P3B D;  3AN2 A;  1ZLA A;  4J8U C;  3AV1 C;  3WKJ C;  3LJA A;  3AYW C;  5CPK C;  3AFA B;  5AV5 A;  3W99 B;  2L5A A;  3AZI D;  3UTB A;  3MVD A;  4J8X B;  3KXB C;  3LEL C;  2F8N G;  4ZUX A;  1S32 B;  1TZY D;  3WA9 B;  3W98 A;  3MGP C;  4ZBJ B;  1P3G C;  4J8V D;  1P3O A;  5B40 B;  4DRA A;  5BO0 B;  4XUJ D;  5AVC A;  3WTP E;  4J8W D;  1P3L A;  1ID3 D;  3AZM D;  1EQZ C;  3C1C B;  5B33 C;  4J8U D;  4XZQ B;  3AV1 D;  2CV5 B;  3W96 B;  3MNN B;  3AYW D;  5G49 B;  3REK B;  5CPK D;  3WAA A;  4R8P A;  3AFA C;  1F1E A;  3W99 C;  3MGS C;  5B0Y A;  1JFI A;  3MGS A;  5F99 A;  5KDM B;  5DNM B;  4J8X C;  3LEL D;  1P3K B;  3LZ1 B;  5BNV B;  1S32 C;  1B6W A;  3WA9 C;  3AZK C;  3A6N B;  1P3G D;  4ZBJ C;  1BFM A;  5B2I D;  5AV9 A;  3WTP C;  3AZI A;  5B40 C;  3AN2 B;  1ZLA B;  1KX4 D;  1EQZ D;  3C1C C;  4M6B A;  5B33 D;  5JA4 A;  2CV5 C;  4XZQ C;  5GT3 A;  3MGQ D;  5AV5 B;  3W96 C;  3W97 A;  1B67 A;  2YFW A;  3MNN C;  3REK C;  3AFA D;  3UTB B;  3MVD B;  3W99 D;  2BYM A;  4ZUX B;  3W98 B;  5DNM C;  5AV6 A;  4J8X D;  3UT9 A;  1P3K C;  3LZ1 C;  1S32 D;  3WA9 D;  1P3O B;  1R4V A;  4WU9 A;  5JRG A;  3A6N C;  5AVC B;  1P3L B;  3V9R A;  5B40 D;  4WU8 D;  3AN2 C;  1ZLA C;  4NE5 A;  3LJA C;  3C1C D;  4H9R A;  3WAA B;  4R8P B;  5AV5 C;  5BS7 A;  5B0Y B;  1M18 D;  3MGS B;  5B2I A;  1M1A A;  5F99 B;  1JFI B;  3REK D;  3UTB C;  3MVD C;  3B0D B;  1KX4 A;  3VH6 T;  4ZUX C;  3W98 C;  3MGQ A;  3LZ1 D;  1P3K D;  4E44 A;  5AV9 B;  3A6N D;  5AVC C;  1P3L C;  5B32 A;  3AZF D;  5JA4 B;  1ZLA D;  5GT3 B;  5B0Z A;  5B31 G;  3W97 B;  1AOI D;  2YFW B;  3WAA C;  4R8P C;  5B0Y C;  2BYM B;  3X1S A;  5F99 C;  4WNN A;  4WU8 A;  3UTB D; 
#chains in the Genus database with same CATH topology
 5AV6 B;  5E5A B;  2RIQ A;  3UT9 B;  2XD5 A;  3B0D C;  3LZ0 B;  3B6F A;  3W98 D;  4H9S A;  4WU9 B;  5JRG B;  2ARO A;  2ZY2 A;  3REJ D;  1P3O D;  1M18 A;  5AV9 C;  3C1B A;  3V9R B;  3AZI C;  5B24 A;  3IP4 C;  5AVC D;  2JSS A;  1TAF A;  3R45 A;  1U35 A;  4H9R B;  5GT3 C;  3VH6 A;  3W97 C;  2HUE B;  5B2I B;  1M1A B;  3WAA D;  4R8P D;  3NQJ A;  5B0Y D;  4UUZ A;  3AZF A;  1KX4 B;  4HGA B;  4NE6 A;  2RVQ D;  1N1J A;  3VH5 T;  5AV6 C;  1P3A A;  2XD1 A;  3EG5 B;  3MGQ B;  3UT9 C;  2BYK A;  4YM6 A;  3AZH A;  4Z5T A;  1AOI A;  4WU9 C;  5BNX A;  5JRG C;  2F8N D;  5B32 B;  2Y2M A;  2Y2N A;  5AV9 D;  1KX3 D;  3X1T A;  5B0Z B;  4Z66 A;  3VH6 W;  3EPK A;  5GT3 D;  5FUG A;  3H0L C;  1P3F A;  3W97 D;  5BS7 C;  2FJ7 D;  3REJ A;  2HUE C;  3X1S B;  5B2I C;  1M1A C;  4WNN B;  4WU8 B;  5CPJ A;  5DNN A;  4WV4 B;  1KX4 C;  2G5H C;  3B6F B;  4HGA C;  5AV6 D;  4X23 D;  5E5A D;  3UT9 D;  3MGQ C;  2ARO B;  3LZ0 D;  1M18 B;  4WU9 D;  5JRG D;  3KWQ A;  3C1B B;  1HTA A;  5B2J D;  5B24 B;  4E45 A;  5B32 C;  2F2A C;  4KHA A;  1TAF B;  4JJN A;  3A1I A;  3R45 B;  1U35 B;  5B0Z C;  4KGC A;  4AWL B;  4CAY A;  3VH5 A;  2F8N A;  3B0C T;  1P3I D;  2NZD A;  3NQJ B;  3AZF B;  4UUZ B;  3X1S C;  1M1A D;  1F66 A;  4WU8 C;  3H0R C;  1KX3 A;  1N1J B;  1P3A B;  2ZY4 A;  3AV2 D;  1WWS A;  2BYK B;  4YM6 B;  4Z5T B;  3AZH B;  1AOI B;  3B6F C;  4H9S C;  5BNX B;  4G92 B;  2ARO C;  2FJ7 A;  1KX5 A;  1M18 C;  3C1B C;  3X1T B;  5B1M A;  5B32 D;  3AZL A;  4Z66 B;  4X23 A;  5E5A A;  1U35 C;  3VH5 W;  5B0Z D;  5FUG B;  1P3F B;  3LZ0 A;  3REJ B;  4AWL C;  3TU4 A;  5B2J A;  5CPJ B;  5DNN B;  5CP6 A;  4QLC B;  3AZF C;  3X1S D;  1P3A C;  4NE3 A;  4YM6 C;  3AZH C;  4Z5T C;  1AOI C;  3B6F D;  3KWQ B;  4G92 C;  1P3I A;  2ARO D;  4KHA B;  3C1B D;  5B24 D;  4JJN B;  5GSU A;  3AV2 A;  3X1T C;  4LD9 A;  4KGC B;  4Z66 C;  1ULY A;  2DQN C;  4CAY B;  3REL D;  1U35 D;  2F8N B;  3KFU G;  5CHL B;  3KUY A;  5B1L A;  5AVB A;  3UTA A;  1P3F C;  2NZD B;  4G91 B;  3REJ C;  1P3O C;  4H9Q A;  1F66 B;  5B31 D;  1KX3 B;  5CPJ C;  5DNN C;  2JE5 A;  2J8P A;  1P3A D;  4YM6 D;  2FJ7 B;  3AZH D;  4Z5T D;  3MGP A;  1KX5 B;  1P3M B;  5B1M B;  3AZL B;  2RVQ C;  4JJN C;  4X23 B;  3X1T D;  4KGC C;  4Z66 D;  3TU4 B;  5B2J B;  1P3F D;  2NZD C;  5GXQ D;  3REI D;  5CP6 B;  4G91 C;  4H9P A;  1F66 C;  1KX3 C;  5CPJ D;  5DNN D;  4QLC D;  1Q9C A;  2IO5 B;  4H9O A;  3REL A;  3AZK A;  5C3I B;  1P3I B;  2FJ7 C;  3B6G A;  1KX5 C;  2LY8 A;  3MGR A;  3KWQ D;  5B31 A;  3WTP A;  5GSU B;  3AV2 B;  4LD9 B;  5B1M C;  3AZL C;  5GT0 A;  4NFT A;  4JJN D;  4CSR A;  4H9N A;  5AY8 D;  5E5A C;  4X23 C;  3X1V A;  3KUY B;  2VQR A;  5B1L B;  5AV8 A;  5AVB B;  3LZ0 C;  3UTA B;  4KGC D;  1T3U A;  2ZM5 A;  3TU4 C;  4H9Q B;  2ZY5 A;  2PYO D;  5B2J C;  2NZD D;  5CP6 C;  4YS3 A;  3AZN A;  1F66 D;  3AZJ A;  4Z2M H;  3MGP B;  2IO5 C;  1M19 A;  5C3I C;  1P3I C;  5GXQ A;  3REI A;  1WWI A;  1KX5 D;  5GSU C;  2HIO A;  1P3M D;  1PZR A;  3AV2 C;  4QLC A;  3AZE A;  5B1M D;  3AZL D;  1Z2C B;  1HQ3 D;  4LD9 C;  3O62 A;  3KUY C;  5B1L C;  5AVB C;  3UTA C;  1KU5 A;  5CPI A;  3REH D;  3TU4 D;  4H9P B;  3H0M C;  5CP6 D;  3B0B A;  3AZG A;  3REL B;  3A1K A;  4H9O B;  5AY8 A;  3AZK B;  1P3P D;  3B6G B;  3MGR B;  5B31 B;  3WTP B;  2PYO A;  1P34 A;  4KUD D;  5GT0 B;  3X1U A;  4CSR B;  5GSU D;  4H9N B;  4LD9 D;  3X1V B;  2F8N H;  4DQY B;  2NQB A;  3WKJ D;  5AV8 B;  3KUY D;  5B1L D;  5AVB D;  3UTA D;  4YS3 B;  3AZN B;  5B24 C;  1P3B A;  1P3M A;  2UWX A;  3KXB D;  1HQ3 A;  3AZJ B;  3REL C;  1M19 B;  2Y2Q A;  5GXQ B;  3REI B;  3B6G C;  2G5I C;  3MGP D;  3REH A;  2W8S A;  3MGR C;  2BG1 A;  5B31 C;  2HIO B;  1BH8 A;  3AZE B;  5GT0 C;  3LJA B;  1W2E A;  3O62 B;  2Y2G A;  1TZY A;  3X1V C;  1P3P A;  5AV8 C;  5CPI B;  4J8V A;  4KUD A;  2Y2L A;  4XUJ A;  4J8W A;  1ID3 A;  4YS3 C;  3AZM A;  3AZG B;  3AZN C;  5AY8 B;  4J8U A;  3AV1 A;  3WKJ A;  3AZJ C;  1H3O A;  3AYW A;  5B32 G;  3AZK D;  1M19 C;  2PYO B;  5CPK A;  1P34 B;  4EO5 B;  5GXQ C;  3REI C;  3B6G D;  3X1U B;  3MGR D;  3WTP D;  2HIO C;  4QLC C;  3KXB A;  3LEL A;  2Y2H A;  5GT0 D;  3AZE C;  2NQB B;  3O62 C;  3X1V D;  2CV5 D;  4XZQ D;  1BH9 A;  3NQU A;  5AV8 D;  3W96 D;  2Y2J A;  5CPI C;  1P3G A;  2ZY3 A;  3MNN D;  3KWQ C;  2YFV A;  4WZS B;  1P3B B;  3B0C W;  4YS3 D;  3KSY A;  1HQ3 B;  3AZG C;  1EQZ A;  3AZN D;  5B33 A;  4DRB A;  5AY8 C;  5DNM D;  3AZJ D;  3REH B;  5BT1 C;  1M19 D;  2PYO C;  3AZI B;  1P34 C;  3AFA A;  4EO5 C;  1BH8 B;  3W99 A;  3X1U C;  1TZY B;  2HIO D;  3AN2 D;  4J8X A;  3AZE D;  2NQB C;  1P3P B;  3LJA D;  3O62 D;  1S32 A;  3WA9 A;  4J8V B;  4KUD B;  5AV5 D;  4XUJ B;  1ID3 B;  4J8W B;  2CWE A;  5CPI D;  3AZM B;  2Y2I A;  1A7W A;  5B40 A;  5BO0 A;  1P3B C;  1P3M C;  3MVD D;  4J8U B;  3AV1 B;  3WKJ B;  1HQ3 C;  3AZG D;  3C1C A;  1H3O B;  4ZUX D;  4Z2M G;  3AYW B;  2CV5 A;  4XZQ A;  5CPK B;  3W96 A;  3REH C;  5BT1 D;  3MNN A;  5G49 A;  3REK A;  1P34 D;  2JCH A;  3KXB B;  3LEL B;  1P3L D;  3X1U D;  1TZY C;  5KDM A;  5DNM A;  2NQB D;  1P3K A;  3LZ1 A;  1P3P C;  1BH9 B;  3NQU B;  5BNV A;  1P3G B;  2Y2K A;  4J8V C;  2YFV B;  3A6N A;  4KUD C;  4XUJ C;  1ID3 C;  4J8W C;  1EQZ B;  3AZM C;  2F8N K;  3MGS D;  5B33 B;  5F99 D;  1P3B D;  3AN2 A;  1ZLA A;  4J8U C;  3AV1 C;  3WKJ C;  3LJA A;  3AYW C;  5CPK C;  3AFA B;  5AV5 A;  3EPJ A;  3W99 B;  2L5A A;  3AZI D;  3UTB A;  3MVD A;  4J8X B;  3KXB C;  3LEL C;  2F8N G;  4ZUX A;  1S32 B;  1TZY D;  3WA9 B;  3W98 A;  3AL0 C;  3MGP C;  4ZBJ B;  1P3G C;  4J8V D;  1P3O A;  5B40 B;  4DRA A;  5BO0 B;  4XUJ D;  5AVC A;  3WTP E;  4J8W D;  1P3L A;  1ID3 D;  3AZM D;  1EQZ C;  4WJ3 C;  3C1C B;  5B33 C;  4J8U D;  4XZQ B;  3AV1 D;  2CV5 B;  3W96 B;  3P5J B;  3MNN B;  3AYW D;  5G49 B;  3REK B;  5CPK D;  3WAA A;  4R8P A;  3AFA C;  1F1E A;  3W99 C;  3MGS C;  5B0Y A;  1JFI A;  3MGS A;  5F99 A;  5KDM B;  5DNM B;  4J8X C;  3LEL D;  1P3K B;  3LZ1 B;  5BNV B;  1S32 C;  1B6W A;  3WA9 C;  3AZK C;  3A6N B;  1P3G D;  4ZBJ C;  1BFM A;  5B2I D;  5AV9 A;  3WTP C;  3AZI A;  5B40 C;  3AN2 B;  1ZLA B;  1KX4 D;  1EQZ D;  2FFF B;  3C1C C;  4M6B A;  5B33 D;  5JA4 A;  2CV5 C;  4XZQ C;  5GT3 A;  3MGQ D;  5AV5 B;  3W96 C;  3W97 A;  1B67 A;  2YFW A;  3MNN C;  3REK C;  3AFA D;  3UTB B;  3MVD B;  3W99 D;  2BYM A;  4ZUX B;  3W98 B;  5DNM C;  5AV6 A;  4J8X D;  2DF4 C;  3UT9 A;  1P3K C;  3LZ1 C;  2Y2P A;  1S32 D;  3WA9 D;  2Y2O A;  1P3O B;  1R4V A;  4WU9 A;  5JRG A;  3A6N C;  5AVC B;  1P3L B;  3EPH A;  3V9R A;  5B40 D;  4WU8 D;  3AN2 C;  1ZLA C;  3F6T A;  4NE5 A;  3LJA C;  3C1C D;  4H9R A;  3WAA B;  4R8P B;  5AV5 C;  5BS7 A;  5B0Y B;  1M18 D;  3MGS B;  5B2I A;  1M1A A;  5F99 B;  1JFI B;  3REK D;  3UTB C;  3MVD C;  3B0D B;  1KX4 A;  3VH6 T;  4ZUX C;  3W98 C;  3MGQ A;  3LZ1 D;  1P3K D;  3FDD A;  4E44 A;  5AV9 B;  3A6N D;  3EPL A;  5AVC C;  1P3L C;  5B32 A;  3AZF D;  5JA4 B;  1ZLA D;  4UPK A;  5GT3 B;  5B31 G;  5B0Z A;  3W97 B;  1AOI D;  2YFW B;  3WAA C;  4R8P C;  5B0Y C;  2BYM B;  3X1S A;  5F99 C;  4WNN A;  4WU8 A;  3UTB D; 
#chains in the Genus database with same CATH homology
 5AV6 B;  5E5A B;  2RIQ A;  3UT9 B;  2XD5 A;  3B0D C;  3LZ0 B;  3B6F A;  3W98 D;  4H9S A;  4WU9 B;  5JRG B;  2ARO A;  2ZY2 A;  3REJ D;  1P3O D;  1M18 A;  5AV9 C;  3C1B A;  3V9R B;  3AZI C;  5B24 A;  3IP4 C;  5AVC D;  2JSS A;  1TAF A;  3R45 A;  1U35 A;  4H9R B;  5GT3 C;  3VH6 A;  3W97 C;  2HUE B;  5B2I B;  1M1A B;  3WAA D;  4R8P D;  3NQJ A;  5B0Y D;  4UUZ A;  3AZF A;  1KX4 B;  4HGA B;  4NE6 A;  2RVQ D;  1N1J A;  3VH5 T;  5AV6 C;  1P3A A;  2XD1 A;  3EG5 B;  3MGQ B;  3UT9 C;  2BYK A;  4YM6 A;  3AZH A;  4Z5T A;  1AOI A;  4WU9 C;  5BNX A;  5JRG C;  2F8N D;  5B32 B;  2Y2M A;  2Y2N A;  5AV9 D;  1KX3 D;  3X1T A;  5B0Z B;  4Z66 A;  3VH6 W;  3EPK A;  5GT3 D;  5FUG A;  3H0L C;  1P3F A;  3W97 D;  5BS7 C;  2FJ7 D;  3REJ A;  2HUE C;  3X1S B;  5B2I C;  1M1A C;  4WNN B;  4WU8 B;  5CPJ A;  5DNN A;  4WV4 B;  1KX4 C;  2G5H C;  3B6F B;  4HGA C;  5AV6 D;  4X23 D;  5E5A D;  3UT9 D;  3MGQ C;  2ARO B;  3LZ0 D;  1M18 B;  4WU9 D;  5JRG D;  3KWQ A;  3C1B B;  1HTA A;  5B2J D;  5B24 B;  4E45 A;  5B32 C;  2F2A C;  4KHA A;  1TAF B;  4JJN A;  3A1I A;  3R45 B;  1U35 B;  5B0Z C;  4KGC A;  4AWL B;  4CAY A;  3VH5 A;  2F8N A;  3B0C T;  1P3I D;  2NZD A;  3NQJ B;  3AZF B;  4UUZ B;  3X1S C;  1M1A D;  1F66 A;  4WU8 C;  3H0R C;  1KX3 A;  1N1J B;  1P3A B;  2ZY4 A;  3AV2 D;  1WWS A;  2BYK B;  4YM6 B;  4Z5T B;  3AZH B;  1AOI B;  3B6F C;  4H9S C;  5BNX B;  4G92 B;  2ARO C;  2FJ7 A;  1KX5 A;  1M18 C;  3C1B C;  3X1T B;  5B1M A;  5B32 D;  3AZL A;  4Z66 B;  4X23 A;  5E5A A;  1U35 C;  3VH5 W;  5B0Z D;  5FUG B;  1P3F B;  3LZ0 A;  3REJ B;  4AWL C;  3TU4 A;  5B2J A;  5CPJ B;  5DNN B;  5CP6 A;  4QLC B;  3AZF C;  3X1S D;  1P3A C;  4NE3 A;  4YM6 C;  3AZH C;  4Z5T C;  1AOI C;  3B6F D;  3KWQ B;  4G92 C;  1P3I A;  2ARO D;  4KHA B;  3C1B D;  5B24 D;  4JJN B;  5GSU A;  3AV2 A;  3X1T C;  4LD9 A;  4KGC B;  4Z66 C;  1ULY A;  2DQN C;  4CAY B;  3REL D;  1U35 D;  2F8N B;  3KFU G;  5CHL B;  3KUY A;  5B1L A;  5AVB A;  3UTA A;  1P3F C;  2NZD B;  4G91 B;  3REJ C;  1P3O C;  4H9Q A;  1F66 B;  5B31 D;  1KX3 B;  5CPJ C;  5DNN C;  2JE5 A;  2J8P A;  1P3A D;  4YM6 D;  2FJ7 B;  3AZH D;  4Z5T D;  3MGP A;  1KX5 B;  1P3M B;  5B1M B;  3AZL B;  2RVQ C;  4JJN C;  4X23 B;  3X1T D;  4KGC C;  4Z66 D;  3TU4 B;  5B2J B;  1P3F D;  2NZD C;  5GXQ D;  3REI D;  5CP6 B;  4G91 C;  4H9P A;  1F66 C;  1KX3 C;  5CPJ D;  5DNN D;  4QLC D;  1Q9C A;  2IO5 B;  4H9O A;  3REL A;  3AZK A;  5C3I B;  1P3I B;  2FJ7 C;  3B6G A;  1KX5 C;  2LY8 A;  3MGR A;  3KWQ D;  5B31 A;  3WTP A;  5GSU B;  3AV2 B;  4LD9 B;  5B1M C;  3AZL C;  5GT0 A;  4NFT A;  4JJN D;  4CSR A;  4H9N A;  5AY8 D;  5E5A C;  4X23 C;  3X1V A;  3KUY B;  2VQR A;  5B1L B;  5AV8 A;  5AVB B;  3LZ0 C;  3UTA B;  4KGC D;  1T3U A;  2ZM5 A;  3TU4 C;  4H9Q B;  2ZY5 A;  2PYO D;  5B2J C;  2NZD D;  5CP6 C;  4YS3 A;  3AZN A;  1F66 D;  3AZJ A;  4Z2M H;  3MGP B;  2IO5 C;  1M19 A;  5C3I C;  1P3I C;  5GXQ A;  3REI A;  1WWI A;  1KX5 D;  5GSU C;  2HIO A;  1P3M D;  1PZR A;  3AV2 C;  4QLC A;  3AZE A;  5B1M D;  3AZL D;  1Z2C B;  1HQ3 D;  4LD9 C;  3O62 A;  3KUY C;  5B1L C;  5AVB C;  3UTA C;  1KU5 A;  5CPI A;  3REH D;  3TU4 D;  4H9P B;  3H0M C;  5CP6 D;  3B0B A;  3AZG A;  3REL B;  3A1K A;  4H9O B;  5AY8 A;  3AZK B;  1P3P D;  3B6G B;  3MGR B;  5B31 B;  3WTP B;  2PYO A;  1P34 A;  4KUD D;  5GT0 B;  3X1U A;  4CSR B;  5GSU D;  4H9N B;  4LD9 D;  3X1V B;  2F8N H;  4DQY B;  2NQB A;  3WKJ D;  5AV8 B;  3KUY D;  5B1L D;  5AVB D;  3UTA D;  4YS3 B;  3AZN B;  5B24 C;  1P3B A;  1P3M A;  2UWX A;  3KXB D;  1HQ3 A;  3AZJ B;  3REL C;  1M19 B;  2Y2Q A;  5GXQ B;  3REI B;  3B6G C;  2G5I C;  3MGP D;  3REH A;  2W8S A;  3MGR C;  2BG1 A;  5B31 C;  2HIO B;  1BH8 A;  3AZE B;  5GT0 C;  3LJA B;  1W2E A;  3O62 B;  2Y2G A;  1TZY A;  3X1V C;  1P3P A;  5AV8 C;  5CPI B;  4J8V A;  4KUD A;  2Y2L A;  4XUJ A;  4J8W A;  1ID3 A;  4YS3 C;  3AZM A;  3AZG B;  3AZN C;  5AY8 B;  4J8U A;  3AV1 A;  3WKJ A;  3AZJ C;  1H3O A;  3AYW A;  5B32 G;  3AZK D;  1M19 C;  2PYO B;  5CPK A;  1P34 B;  4EO5 B;  5GXQ C;  3REI C;  3B6G D;  3X1U B;  3MGR D;  3WTP D;  2HIO C;  4QLC C;  3KXB A;  3LEL A;  2Y2H A;  5GT0 D;  3AZE C;  2NQB B;  3O62 C;  3X1V D;  2CV5 D;  4XZQ D;  1BH9 A;  3NQU A;  5AV8 D;  3W96 D;  2Y2J A;  5CPI C;  1P3G A;  2ZY3 A;  3MNN D;  3KWQ C;  2YFV A;  4WZS B;  1P3B B;  3B0C W;  4YS3 D;  3KSY A;  1HQ3 B;  3AZG C;  1EQZ A;  3AZN D;  5B33 A;  4DRB A;  5AY8 C;  5DNM D;  3AZJ D;  3REH B;  5BT1 C;  1M19 D;  2PYO C;  3AZI B;  1P34 C;  3AFA A;  4EO5 C;  1BH8 B;  3W99 A;  3X1U C;  1TZY B;  2HIO D;  3AN2 D;  4J8X A;  3AZE D;  2NQB C;  1P3P B;  3LJA D;  3O62 D;  1S32 A;  3WA9 A;  4J8V B;  4KUD B;  5AV5 D;  4XUJ B;  1ID3 B;  4J8W B;  2CWE A;  5CPI D;  3AZM B;  2Y2I A;  1A7W A;  5B40 A;  5BO0 A;  1P3B C;  1P3M C;  3MVD D;  4J8U B;  3AV1 B;  3WKJ B;  1HQ3 C;  3AZG D;  3C1C A;  1H3O B;  4ZUX D;  4Z2M G;  3AYW B;  2CV5 A;  4XZQ A;  5CPK B;  3W96 A;  3REH C;  5BT1 D;  3MNN A;  5G49 A;  3REK A;  1P34 D;  2JCH A;  3KXB B;  3LEL B;  1P3L D;  3X1U D;  1TZY C;  5KDM A;  5DNM A;  2NQB D;  1P3K A;  3LZ1 A;  1P3P C;  1BH9 B;  3NQU B;  5BNV A;  1P3G B;  2Y2K A;  4J8V C;  2YFV B;  3A6N A;  4KUD C;  4XUJ C;  1ID3 C;  4J8W C;  1EQZ B;  3AZM C;  2F8N K;  3MGS D;  5B33 B;  5F99 D;  1P3B D;  3AN2 A;  1ZLA A;  4J8U C;  3AV1 C;  3WKJ C;  3LJA A;  3AYW C;  5CPK C;  3AFA B;  5AV5 A;  3EPJ A;  3W99 B;  2L5A A;  3AZI D;  3UTB A;  3MVD A;  4J8X B;  3KXB C;  3LEL C;  2F8N G;  4ZUX A;  1S32 B;  1TZY D;  3WA9 B;  3W98 A;  3AL0 C;  3MGP C;  4ZBJ B;  1P3G C;  4J8V D;  1P3O A;  5B40 B;  4DRA A;  5BO0 B;  4XUJ D;  5AVC A;  3WTP E;  4J8W D;  1P3L A;  1ID3 D;  3AZM D;  1EQZ C;  4WJ3 C;  3C1C B;  5B33 C;  4J8U D;  4XZQ B;  3AV1 D;  2CV5 B;  3W96 B;  3P5J B;  3MNN B;  3AYW D;  5G49 B;  3REK B;  5CPK D;  3WAA A;  4R8P A;  3AFA C;  1F1E A;  3W99 C;  3MGS C;  5B0Y A;  1JFI A;  3MGS A;  5F99 A;  5KDM B;  5DNM B;  4J8X C;  3LEL D;  1P3K B;  3LZ1 B;  5BNV B;  1S32 C;  1B6W A;  3WA9 C;  3AZK C;  3A6N B;  1P3G D;  4ZBJ C;  1BFM A;  5B2I D;  5AV9 A;  3WTP C;  3AZI A;  5B40 C;  3AN2 B;  1ZLA B;  1KX4 D;  1EQZ D;  2FFF B;  3C1C C;  4M6B A;  5B33 D;  5JA4 A;  2CV5 C;  4XZQ C;  5GT3 A;  3MGQ D;  5AV5 B;  3W96 C;  3W97 A;  1B67 A;  2YFW A;  3MNN C;  3REK C;  3AFA D;  3UTB B;  3MVD B;  3W99 D;  2BYM A;  4ZUX B;  3W98 B;  5DNM C;  5AV6 A;  4J8X D;  2DF4 C;  3UT9 A;  1P3K C;  3LZ1 C;  2Y2P A;  1S32 D;  3WA9 D;  2Y2O A;  1P3O B;  1R4V A;  4WU9 A;  5JRG A;  3A6N C;  5AVC B;  1P3L B;  3EPH A;  3V9R A;  5B40 D;  4WU8 D;  3AN2 C;  1ZLA C;  3F6T A;  4NE5 A;  3LJA C;  3C1C D;  4H9R A;  3WAA B;  4R8P B;  5AV5 C;  5BS7 A;  5B0Y B;  1M18 D;  3MGS B;  5B2I A;  1M1A A;  5F99 B;  1JFI B;  3REK D;  3UTB C;  3MVD C;  3B0D B;  1KX4 A;  3VH6 T;  4ZUX C;  3W98 C;  3MGQ A;  3LZ1 D;  1P3K D;  3FDD A;  4E44 A;  5AV9 B;  3A6N D;  3EPL A;  5AVC C;  1P3L C;  5B32 A;  3AZF D;  5JA4 B;  1ZLA D;  4UPK A;  5GT3 B;  5B31 G;  5B0Z A;  3W97 B;  1AOI D;  2YFW B;  3WAA C;  4R8P C;  5B0Y C;  2BYM B;  3X1S A;  5F99 C;  4WNN A;  4WU8 A;  3UTB D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...