4HGAB

Structure of the variant histone h3.3-h4 heterodimer in complex with its chaperone daxx
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
93
structure length
93
Chain Sequence
PGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Death domain-associated protein 6
publication title Structure of the variant histone H3.3-H4 heterodimer in complex with its chaperone DAXX.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone/apoptosis
total genus 29
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2012-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4hgaB00
3LZ0D 2BYKB 1M19B 1P3GC 1P3FD 3AZEB 3NQJB 3AV2D 3AZFC 4WU8C 5B33A 2HIOC 5CPIC 3C1CA 1P3AD 5B31A 2CV5D 3UTAA 5B1MA 3REKD 3MGPC 5AV8C 3O62D 3AZMD 5B32G 5DNMC 4J8VD 2AROD 5E5AA 5B33B 5BS7A 3WTPD 4X23B 5B31B 1U35D 4EO5C 3UTAB 1R4VA 5B1MB 5AV6A 5B24D 2YFVB 4KUDC 4WU8A 3AZFA 2HIOA 2NZDC 5CPIA 1TAFA 5BNXA 1P3OB 4XZQD 5F99D 1S32D 5E5AB 4E45A 5B0ZD 3AZNB 3WAAB 3AYWC 4JJND 3MGPA 5AV8A 3A6NC 3REID 1P3MD 2FJ7B 5AV6B 3REHD 5GT3D 5DNMA 3AZJA 5AV5D 3KUYD 4KGCD 5CPIB 1TAFB 5B31G 5CPJA 4G92C 5BNVB 1P34C 3W98C 3AZKB 3W96D 3VH6W 5B40D 3W97B 2CWEA 3MGPB 4KUDA 4KHAA 4YM6A 1KX3C 2NZDA 3W99B 1P3KD 3KXBB 1M19D 3AZJB 5FUGB 5GT0C 2F8NH 3AZED 1P3PC 4R8PC 4WU9C 5CPJB 5BT1C 4HGAB 4EO5B 3MVDC 3AYWA 5JRGB 3A6NA 5GSUB 1EQZB 1KX5C 3TU4C 4KUDB 5AY8C 4YM6B 5AVCC 1M1AB 3VH6T 2F8NK 3B6GC 1P34A 3W98A 3UTBB 4QLCC 3AZGC 5B33D 3C1BB 3LZ1C 4J8XB 2LY8A 1M18C 4X23D 5B31D 4LD9D 3A6NB 1KX3A 3UTAD 4Z5TC 3X1SC 5B1MD 4J8UA 4ZUXB 5GXQC 3UT9C 1P3PA 3REJA 1TZYB 5C3IB 4R8PA 3MNNA 4WU9A 4G91C 3MVDA 1P3OD 1P3LA 4XUJC 5E5AD 5B1LC 4Z2MH 3LJAB 4WNNA 3AZND 3TU4A 3WAAD 3WKJD 2HUEC 5AY8A 1KU5A 5AVCA 3WTPE 3AN2C 3AZLC 1BH9A 5JA4A 2FJ7D 5AV6D 2IO5C 3B6GA 2BYMB 4YS3C 4J8UB 4QLCA 3AZGA 3REJB 3AZHB 4NE3A 4WU9B 3MNNB 3LZ1A 3MVDB 5CPID 1F66B 1M18A 3MGSC 1P3LB 1HQ3C 3X1VD 1KX4C 5B32B 4Z5TA 3X1SA 4WNNB 3AZKD 1ZLAA 3X1TB 3W97D 2NQBC 1ID3C 5GXQA 3KWQC 3UT9A 3AV1B 1JFIA 5B2IA 3W99D 3KXBD 4XUJA 5AVBB 3MGRC 3AZJD 5B1LA 5CPJD 3AFAC 4ZBJB 4NE6A 3WA9C 4H9QA 5JRGD 3RELC 3AZLA 3AN2A 5GSUD 1ZLAB 4DRAA 2F8NA 1EQZD 4YS3A 3AZIC 1P3BB 3UT9B 5B2IB 4H9RA 3X1UB 1N1JB 4YM6D 1M1AD 3MGSA 3VH6A 5G49A 1P3ID 5B2JC 3UTBD 5B0YC 5CP6A 4Z66C 1KX4A 4J8WD 3C1BD 1WWSA 5DNND 4J8XD 1AOIC 1ID3A 3KWQA 3B0DC 3C1CB 3AN2B 5CHLB 1WWIA 2PYOC 3B6FC 1A7WA 3MGRA 4H9RB 4ZUXD 1P3GA 1TZYD 3AFAA 5G49B 3WA9A 5CP6B 3RELA 3LJAD 3LELC 5AV9C 5CPKC 2YFWA 3LZ0C 1P3FC 4J8UD 5B0YA 3AV2C 4Z66A 1P3GB 3REJD 3AZHD 1P3AC 3MNND 1F66D 4WU8B 3AZFB 4H9NA 2HIOB 3B0CW 1P3LD 2CV5C 5BNXB 5BO0A 2PYOA 3V9RA 3B6FA 2RVQD 5B32D 3X1TD 3REKC 3O62C 3AV1D 3AZMC 5AV8B 3MGQD 4J8VC 5AVBD 2AROC 5DNMB 3WTPC 3LELA 5AV9A 5CPKA 1U35C 2PYOB 3V9RB 5B24C 1ZLAD 3R45A 1P3FA 3B0CT 3AV2A 1P3BD 5B2ID 3X1UD 1P3AA 4KHAB 4XZQC 1Q9CA 5F99C 2NZDB 2CV5A 1S32C 5B0ZC 3LELB 4JJNC 3REKA 3O62A 3REIC 1P3MC 3C1CD 3AYWB 3REHC 5GT3C 1P3FB 4Z2MG 3B0BA 2AROA 5AV5C 3KUYC 4KGCC 3WTPA 5GT0A 1U35A 2CV5B 4G92B 3W96C 5CP6D 1P34B 3W98B 5B40C 3REKB 2JSSA 1KX5A 1P3KC 1M19C 4XZQA 1KX3B 5F99A 1S32A 3AZEC 5B0ZA 1P3GD 5GT0B 4JJNA 1P3PB 3AZFD 4WU8D 4R8PB 2HIOD 3REIA 1P3MA 3REHA 4H9OA 5GT3A 5AV5A 3KUYA 4KGCA 1KX5B 3TU4B 5AY8B 5AVCB 3MGPD 5AV8D 1S32B 1BH9B 5JA4B 3W96A 4NFTA 3B6GB 5B33C 4QLCB 5B40A 5DNMD 3AZGB 4X23C 5B31C 4LD9C 4UUZA 3LZ1B 3UTAC 1M18B 4H9OB 4CSRA 1P3KA 5GT3B 2BYKA 5B1MC 1M19A 3AZEA 4Z5TB 3X1SB 3NQJA 4H9PA 5GXQB 1JFIB 4KUDD 1P3OC 4G91B 2NZDD 5E5AC 4XUJB 3WAAC 3AZNC 1HQ3A 5B1LB 4UUZB 3WKJC 4CSRB 3AYWD 2FJ7C 2NQBA 2HUEB 5AV6C 1F1EA 4H9QB 4WV4B 3A6ND 3AZLB 2IO5B 2F8NB 4M6BA 4YS3B 4H9PB 4X23A 4LD9A 3MGSB 3X1VC 3AZKC 4AWLC 1P34D 1HQ3B 3W98D 3W97C 2YFVA 1KX4B 2NQBB 1ID3B 3AZIA 3W99C 3KWQB 3KXBC 1P3OA 4WZSB 1HTAA 1KX3D 3AZJC 4CAYA 3MGRB 3AZNA 3WAAA 5B2JA 5CPJC 5GT0D 4LD9B 4HGAC 3WKJA 1P3PD 4WU9D 5JRGC 4R8PD 5BT1D 3MVDD 3AFAB 1AOIA 5GSUC 2FJ7A 3WA9B 1EQZC 3RELB 3VH5W 2F8NG 4YM6C 3AZIB 3TU4D 1KX5D 2YFWB 1M1AC 5AY8D 5BNVA 5AVCD 1P3IC 4CAYB 3UTBC 3X1VA 3AZKA 3B6GD 1B6WA 4DRBA 5B2JB 3C1BC 5DNNC 4J8XC 4QLCD 3W97A 4Z66B 5B0YB 4J8WC 3AZGD 3WKJB 3LZ1D 1AOIB 1M18D 4H9NB 3W99A 3B0DB 3KXBA 5BO0B 3B6FB 3LZ0A 5FUGA 1H3OA 4ZUXC 4Z5TD 3X1SD 1TZYC 5C3IC 5GXQD 3VH5T 3UT9D 5JRGA 3X1VB 5GSUA 4AWLB 4XUJD 3LJAC 1EQZA 1BFMA 5B1LD 5AV9B 5CPKB 3KSYA 1M1AA 3LZ0B 1ULYA 4J8UC 3AZMA 1H3OB 3UTBA 3AZLD 3AN2D 1P3IA 3R45B 2F8ND 3REJC 3AZHC 4YS3D 3MNNC 5DNNA 3C1BA 4J8WA 4J8XA 4J8VA 3AV2B 1F66C 1P3LC 1P3AB 3MGSD 2RVQC 5B32C 1HQ3D 3X1TC 5B24A 4ZUXA 3NQUA 1KX4D 3AV1C 1B67A 1TZYA 2NQBD 1ID3D 3O62B 3MGQC 3KWQD 3AZMB 1P3IB 5AVBC 4H9SC 4J8WB 5DNNB 3LJAA 4J8VB 2AROB 5KDMA 3MGRD 4ZBJC 3WTPB 1U35B 3AFAD 1ZLAC 4NE5A 3WA9D 1BH8A 2BYMA 3RELD 5B24B 3NQUB 1P3BC 5B2IC 3AZHA 3X1UC 3AZID 1F66A 2L5AA 4XZQB 5F99B 5B32A 5KDMB 5B2JD 3X1TA 5B0ZB 5B0YD 4Z66D 3AV1A 3C1CC 4JJNB 1AOID 3MGQA 3REIB 1P3MB 1BH8B 3REHB 5AVBA 2PYOD 3B6FD 4H9SA 5AV5B 3KUYB 4KGCB 3VH5A 5CP6C 3W96B 1P3BA 5BS7C 5B40B 3LELD 3X1UA 1N1JA 5AV9D 5CPKD 3MGQB 4E44A 1P3KB
chains in the Genus database with same CATH superfamily
3LZ0D 2BYKB 1M19B 1P3GC 1P3FD 3AZEB 3NQJB 3AV2D 3AZFC 4WU8C 5B33A 2HIOC 3P5JB 5CPIC 3C1CA 1P3AD 2XD5A 5B31A 2CV5D 2Y2JA 3UTAA 2Y2QA 5B1MA 3REKD 3MGPC 5AV8C 3O62D 3IP4C 3AZMD 5B32G 5DNMC 4J8VD 2AROD 5E5AA 5B33B 5BS7A 3WTPD 4X23B 5B31B 1U35D 4EO5C 3UTAB 1R4VA 5B1MB 5AV6A 5B24D 2YFVB 4KUDC 4WU8A 3AZFA 2HIOA 2NZDC 5CPIA 1TAFA 5BNXA 1P3OB 4XZQD 5F99D 1S32D 1P3IA 5E5AB 4E45A 5B0ZD 3AZNB 3WAAB 3AYWC 4JJND 3MGPA 5AV8A 3A6NC 3REID 1P3MD 2FJ7B 5AV6B 3REHD 5GT3D 5DNMA 3AZJA 5AV5D 3KUYD 4KGCD 5CPIB 1TAFB 5B31G 5CPJA 4G92C 5BNVB 2BG1A 3EPJA 1P34C 3W98C 3AZKB 3W96D 3VH6W 5B40D 3W97B 2G5IC 2CWEA 3MGPB 4KUDA 4KHAA 4YM6A 1KX3C 2NZDA 3W99B 1P3KD 3KXBB 1M19D 3AZJB 5FUGB 5GT0C 2F8NH 3AZED 1P3PC 4R8PC 4WU9C 5CPJB 5BT1C 4HGAB 4EO5B 3MVDC 3AYWA 5JRGB 3A6NA 2ZM5A 5GSUB 2Y2HA 1EQZB 2Y2IA 1KX5C 3TU4C 4KUDB 5AY8C 4YM6B 5AVCC 1M1AB 3VH6T 2F8NK 3B6GC 1P34A 3W98A 3UTBB 4QLCC 3AZGC 5B33D 3C1BB 3LZ1C 4J8XB 2LY8A 1M18C 4X23D 5B31D 4LD9D 3A6NB 1KX3A 3UTAD 4Z5TC 3X1SC 5B1MD 2G5HC 4J8UA 4ZUXB 5GXQC 3UT9C 1P3PA 3REJA 1TZYB 5C3IB 4R8PA 2JCHA 3MNNA 4G91C 3MVDA 4WU9A 2ZY4A 1P3OD 1P3LA 4XUJC 1T3UA 5B1LC 5E5AD 3EG5B 4Z2MH 3LJAB 4WNNA 3AZND 3TU4A 3WAAD 1PZRA 3WKJD 2HUEC 5AY8A 1KU5A 5AVCA 3WTPE 3AN2C 2Y2OA 1BH9A 5JA4A 3AZLC 2FJ7D 5AV6D 2IO5C 3B6GA 2BYMB 4YS3C 4J8UB 4QLCA 3AZGA 3REJB 3AZHB 4NE3A 4WU9B 3MNNB 3LZ1A 3MVDB 5CPID 1F66B 1M18A 3MGSC 1P3LB 1HQ3C 3X1VD 1KX4C 5B32B 4Z5TA 3X1SA 4WNNB 3AZKD 1ZLAA 3X1TB 3W97D 2NQBC 1ID3C 5GXQA 3KWQC 3UT9A 3AV1B 1JFIA 5B2IA 3W99D 3KXBD 4XUJA 5AVBB 3MGRC 3AZJD 5B1LA 5CPJD 3AFAC 4ZBJB 4NE6A 3WA9C 4H9QA 5JRGD 3RELC 3AZLA 3AN2A 5GSUD 1ZLAB 4DRAA 2F8NA 1EQZD 4YS3A 3AZIC 1P3BB 3UT9B 5B2IB 4H9RA 3X1UB 1N1JB 4YM6D 1M1AD 3MGSA 3VH6A 5G49A 1P3ID 5B2JC 3UTBD 5B0YC 5CP6A 4Z66C 1KX4A 4J8WD 3C1BD 1WWSA 5DNND 4J8XD 1AOIC 1ID3A 3KWQA 3B0DC 3C1CB 3AN2B 2Y2MA 5CHLB 1WWIA 2PYOC 3B6FC 1A7WA 3MGRA 4H9RB 4ZUXD 1P3GA 1TZYD 3AFAA 3AL0C 5G49B 2Y2GA 3WA9A 5CP6B 3RELA 3KFUG 3LJAD 3LELC 5AV9C 5CPKC 2YFWA 3LZ0C 1W2EA 1P3FC 4J8UD 5B0YA 3AV2C 4Z66A 3EPLA 1P3GB 2JE5A 3REJD 3AZHD 1P3AC 3MNND 1F66D 4WU8B 3AZFB 3FDDA 2FFFB 4H9NA 2HIOB 3B0CW 1P3LD 2CV5C 4WJ3C 5BNXB 5BO0A 2PYOA 3V9RA 3B6FA 2RVQD 5B32D 3X1TD 3REKC 3O62C 3AV1D 3AZMC 5AV8B 3MGQD 4J8VC 5AVBD 2AROC 5DNMB 3WTPC 3LELA 5AV9A 5CPKA 1U35C 2UWXA 2PYOB 3V9RB 5B24C 1ZLAD 2ZY5A 3R45A 1P3FA 3B0CT 3AV2A 1P3BD 5B2ID 3X1UD 1P3AA 2Y2NA 4KHAB 4XZQC 1Q9CA 5F99C 2NZDB 2CV5A 1S32C 5B0ZC 3LELB 2ZY3A 3EPKA 4JJNC 3REKA 3O62A 3REIC 1P3MC 3C1CD 3AYWB 3REHC 5GT3C 2Y2LA 4Z2MG 1P3FB 3B0BA 2AROA 5AV5C 3KUYC 4KGCC 3WTPA 5GT0A 1U35A 2CV5B 4G92B 3W96C 5CP6D 1P34B 3W98B 5B40C 3F6TA 3REKB 3A1KA 2JSSA 1KX5A 1P3KC 2DQNC 1M19C 4XZQA 1KX3B 5F99A 1S32A 3AZEC 5B0ZA 1P3GD 5GT0B 4JJNA 1P3PB 3AZFD 2Y2KA 4WU8D 4R8PB 2XD1A 2HIOD 3REIA 1P3MA 3REHA 4H9OA 5GT3A 3H0RC 5AV5A 3KUYA 4KGCA 1KX5B 2VQRA 3TU4B 5AY8B 5AVCB 3MGPD 5AV8D 1S32B 1BH9B 5JA4B 3W96A 4NFTA 3B6GB 5B33C 4QLCB 5B40A 5DNMD 3AZGB 4X23C 5B31C 4LD9C 4UUZA 3LZ1B 3UTAC 1M18B 4H9OB 4CSRA 1P3KA 5GT3B 2BYKA 5B1MC 1M19A 3H0MC 3AZEA 4Z5TB 3X1SB 3NQJA 4H9PA 5GXQB 1JFIB 4KUDD 1P3OC 4G91B 2NZDD 5E5AC 4XUJB 3WAAC 3AZNC 1HQ3A 5B1LB 4UUZB 3WKJC 4CSRB 3AYWD 2FJ7C 2NQBA 2HUEB 5AV6C 1F1EA 4H9QB 4WV4B 3A6ND 3AZLB 2IO5B 2F8NB 4M6BA 4YS3B 4H9PB 4X23A 2ZY2A 4LD9A 3MGSB 3X1VC 3AZKC 4AWLC 1P34D 1HQ3B 3W98D 3W97C 2YFVA 1KX4B 2NQBB 1ID3B 3AZIA 3W99C 3KWQB 3KXBC 1P3OA 4WZSB 1HTAA 1KX3D 3AZJC 4CAYA 3MGRB 3AZNA 3WAAA 5B2JA 5CPJC 5GT0D 2F2AC 4HGAC 4LD9B 3WKJA 1P3PD 4WU9D 5JRGC 4R8PD 5BT1D 3MVDD 2RIQA 3AFAB 5GSUC 1AOIA 2FJ7A 3EPHA 3WA9B 1EQZC 3RELB 3VH5W 2F8NG 4YM6C 3AZIB 3TU4D 1KX5D 2YFWB 3H0LC 1M1AC 5AY8D 5BNVA 5AVCD 1P3IC 4CAYB 3UTBC 3X1VA 3AZKA 2DF4C 3B6GD 1B6WA 4DRBA 5B2JB 3C1BC 5DNNC 4J8XC 4QLCD 3W97A 4Z66B 5B0YB 4J8WC 3AZGD 3WKJB 3LZ1D 1AOIB 1M18D 4H9NB 3W99A 3B0DB 3KXBA 5BO0B 3B6FB 3LZ0A 5FUGA 1H3OA 4ZUXC 4Z5TD 3X1SD 1TZYC 5C3IC 5GXQD 3VH5T 3UT9D 5JRGA 3X1VB 5GSUA 4AWLB 4XUJD 3LJAC 1EQZA 1BFMA 5B1LD 5AV9B 5CPKB 3KSYA 1M1AA 3LZ0B 1ULYA 4J8UC 3AZMA 1H3OB 4UPKA 3UTBA 3AZLD 4DQYB 3AN2D 3R45B 2F8ND 3REJC 3AZHC 4YS3D 3MNNC 5DNNA 3C1BA 4J8WA 4J8XA 4J8VA 3AV2B 1F66C 1P3LC 1P3AB 2Y2PA 3MGSD 2RVQC 5B32C 1HQ3D 3X1TC 5B24A 4ZUXA 3NQUA 1KX4D 3AV1C 1B67A 1TZYA 2NQBD 1ID3D 3O62B 3MGQC 3KWQD 3AZMB 1P3IB 5AVBC 4H9SC 4J8WB 5DNNB 3LJAA 4J8VB 2AROB 5KDMA 3MGRD 4ZBJC 3WTPB 1U35B 3AFAD 1ZLAC 4NE5A 3WA9D 1BH8A 2BYMA 3RELD 5B24B 3NQUB 1P3BC 5B2IC 3AZHA 3X1UC 3AZID 1F66A 2L5AA 4XZQB 5F99B 5B32A 5KDMB 2W8SA 5B2JD 1Z2CB 3X1TA 5B0ZB 5B0YD 4Z66D 3AV1A 3C1CC 4JJNB 1AOID 3A1IA 3MGQA 3REIB 1P3MB 1BH8B 3REHB 5AVBA 2PYOD 3B6FD 4H9SA 5AV5B 3KUYB 4KGCB 3VH5A 5CP6C 3W96B 1P3BA 5BS7C 2J8PA 5B40B 3LELD 3X1UA 1N1JA 5AV9D 5CPKD 3MGQB 4E44A 1P3KB
chains in the Genus database with same CATH topology
3LZ0D 2BYKB 1M19B 1P3GC 1P3FD 3AZEB 3NQJB 3AV2D 3AZFC 4WU8C 5B33A 2HIOC 3P5JB 5CPIC 3C1CA 1P3AD 2XD5A 5B31A 2CV5D 2Y2JA 3UTAA 2Y2QA 5B1MA 3REKD 3MGPC 5AV8C 3O62D 3IP4C 3AZMD 5B32G 5DNMC 4J8VD 2AROD 5E5AA 5B33B 5BS7A 3WTPD 4X23B 5B31B 1U35D 4EO5C 3UTAB 1R4VA 5B1MB 5AV6A 5B24D 2YFVB 4KUDC 4WU8A 3AZFA 2HIOA 2NZDC 5CPIA 1TAFA 5BNXA 1P3OB 4XZQD 5F99D 1S32D 1P3IA 5E5AB 4E45A 5B0ZD 3AZNB 3WAAB 3AYWC 4JJND 3MGPA 5AV8A 3A6NC 3REID 1P3MD 2FJ7B 5AV6B 3REHD 5GT3D 5DNMA 3AZJA 5AV5D 3KUYD 4KGCD 5CPIB 1TAFB 5B31G 5CPJA 4G92C 5BNVB 2BG1A 3EPJA 1P34C 3W98C 3AZKB 3W96D 3VH6W 5B40D 3W97B 2G5IC 2CWEA 3MGPB 4KUDA 4KHAA 4YM6A 1KX3C 2NZDA 3W99B 1P3KD 3KXBB 1M19D 3AZJB 5FUGB 5GT0C 2F8NH 3AZED 1P3PC 4R8PC 4WU9C 5CPJB 5BT1C 4HGAB 4EO5B 3MVDC 3AYWA 5JRGB 3A6NA 2ZM5A 5GSUB 2Y2HA 1EQZB 2Y2IA 1KX5C 3TU4C 4KUDB 5AY8C 4YM6B 5AVCC 1M1AB 3VH6T 2F8NK 3B6GC 1P34A 3W98A 3UTBB 4QLCC 3AZGC 5B33D 3C1BB 3LZ1C 4J8XB 2LY8A 1M18C 4X23D 5B31D 4LD9D 3A6NB 1KX3A 3UTAD 4Z5TC 3X1SC 5B1MD 2G5HC 4J8UA 4ZUXB 5GXQC 3UT9C 1P3PA 3REJA 1TZYB 5C3IB 4R8PA 2JCHA 3MNNA 4G91C 3MVDA 4WU9A 2ZY4A 1P3OD 1P3LA 4XUJC 1T3UA 5B1LC 5E5AD 3EG5B 4Z2MH 3LJAB 4WNNA 3AZND 3TU4A 3WAAD 1PZRA 3WKJD 2HUEC 5AY8A 1KU5A 5AVCA 3WTPE 3AN2C 2Y2OA 1BH9A 5JA4A 3AZLC 2FJ7D 5AV6D 2IO5C 3B6GA 2BYMB 4YS3C 4J8UB 4QLCA 3AZGA 3REJB 3AZHB 4NE3A 4WU9B 3MNNB 3LZ1A 3MVDB 5CPID 1F66B 1M18A 3MGSC 1P3LB 1HQ3C 3X1VD 1KX4C 5B32B 4Z5TA 3X1SA 4WNNB 3AZKD 1ZLAA 3X1TB 3W97D 2NQBC 1ID3C 5GXQA 3KWQC 3UT9A 3AV1B 1JFIA 5B2IA 3W99D 3KXBD 4XUJA 5AVBB 3MGRC 3AZJD 5B1LA 5CPJD 3AFAC 4ZBJB 4NE6A 3WA9C 4H9QA 5JRGD 3RELC 3AZLA 3AN2A 5GSUD 1ZLAB 4DRAA 2F8NA 1EQZD 4YS3A 3AZIC 1P3BB 3UT9B 5B2IB 4H9RA 3X1UB 1N1JB 4YM6D 1M1AD 3MGSA 3VH6A 5G49A 1P3ID 5B2JC 3UTBD 5B0YC 5CP6A 4Z66C 1KX4A 4J8WD 3C1BD 1WWSA 5DNND 4J8XD 1AOIC 1ID3A 3KWQA 3B0DC 3C1CB 3AN2B 2Y2MA 5CHLB 1WWIA 2PYOC 3B6FC 1A7WA 3MGRA 4H9RB 4ZUXD 1P3GA 1TZYD 3AFAA 3AL0C 5G49B 2Y2GA 3WA9A 5CP6B 3RELA 3KFUG 3LJAD 3LELC 5AV9C 5CPKC 2YFWA 3LZ0C 1W2EA 1P3FC 4J8UD 5B0YA 3AV2C 4Z66A 3EPLA 1P3GB 2JE5A 3REJD 3AZHD 1P3AC 3MNND 1F66D 4WU8B 3AZFB 3FDDA 2FFFB 4H9NA 2HIOB 3B0CW 1P3LD 2CV5C 4WJ3C 5BNXB 5BO0A 2PYOA 3V9RA 3B6FA 2RVQD 5B32D 3X1TD 3REKC 3O62C 3AV1D 3AZMC 5AV8B 3MGQD 4J8VC 5AVBD 2AROC 5DNMB 3WTPC 3LELA 5AV9A 5CPKA 1U35C 2UWXA 2PYOB 3V9RB 5B24C 1ZLAD 2ZY5A 3R45A 1P3FA 3B0CT 3AV2A 1P3BD 5B2ID 3X1UD 1P3AA 2Y2NA 4KHAB 4XZQC 1Q9CA 5F99C 2NZDB 2CV5A 1S32C 5B0ZC 3LELB 2ZY3A 3EPKA 4JJNC 3REKA 3O62A 3REIC 1P3MC 3C1CD 3AYWB 3REHC 5GT3C 2Y2LA 4Z2MG 1P3FB 3B0BA 2AROA 5AV5C 3KUYC 4KGCC 3WTPA 5GT0A 1U35A 2CV5B 4G92B 3W96C 5CP6D 1P34B 3W98B 5B40C 3F6TA 3REKB 3A1KA 2JSSA 1KX5A 1P3KC 2DQNC 1M19C 4XZQA 1KX3B 5F99A 1S32A 3AZEC 5B0ZA 1P3GD 5GT0B 4JJNA 1P3PB 3AZFD 2Y2KA 4WU8D 4R8PB 2XD1A 2HIOD 3REIA 1P3MA 3REHA 4H9OA 5GT3A 3H0RC 5AV5A 3KUYA 4KGCA 1KX5B 2VQRA 3TU4B 5AY8B 5AVCB 3MGPD 5AV8D 1S32B 1BH9B 5JA4B 3W96A 4NFTA 3B6GB 5B33C 4QLCB 5B40A 5DNMD 3AZGB 4X23C 5B31C 4LD9C 4UUZA 3LZ1B 3UTAC 1M18B 4H9OB 4CSRA 1P3KA 5GT3B 2BYKA 5B1MC 1M19A 3H0MC 3AZEA 4Z5TB 3X1SB 3NQJA 4H9PA 5GXQB 1JFIB 4KUDD 1P3OC 4G91B 2NZDD 5E5AC 4XUJB 3WAAC 3AZNC 1HQ3A 5B1LB 4UUZB 3WKJC 4CSRB 3AYWD 2FJ7C 2NQBA 2HUEB 5AV6C 1F1EA 4H9QB 4WV4B 3A6ND 3AZLB 2IO5B 2F8NB 4M6BA 4YS3B 4H9PB 4X23A 2ZY2A 4LD9A 3MGSB 3X1VC 3AZKC 4AWLC 1P34D 1HQ3B 3W98D 3W97C 2YFVA 1KX4B 2NQBB 1ID3B 3AZIA 3W99C 3KWQB 3KXBC 1P3OA 4WZSB 1HTAA 1KX3D 3AZJC 4CAYA 3MGRB 3AZNA 3WAAA 5B2JA 5CPJC 5GT0D 2F2AC 4HGAC 4LD9B 3WKJA 1P3PD 4WU9D 5JRGC 4R8PD 5BT1D 3MVDD 2RIQA 3AFAB 5GSUC 1AOIA 2FJ7A 3EPHA 3WA9B 1EQZC 3RELB 3VH5W 2F8NG 4YM6C 3AZIB 3TU4D 1KX5D 2YFWB 3H0LC 1M1AC 5AY8D 5BNVA 5AVCD 1P3IC 4CAYB 3UTBC 3X1VA 3AZKA 2DF4C 3B6GD 1B6WA 4DRBA 5B2JB 3C1BC 5DNNC 4J8XC 4QLCD 3W97A 4Z66B 5B0YB 4J8WC 3AZGD 3WKJB 3LZ1D 1AOIB 1M18D 4H9NB 3W99A 3B0DB 3KXBA 5BO0B 3B6FB 3LZ0A 5FUGA 1H3OA 4ZUXC 4Z5TD 3X1SD 1TZYC 5C3IC 5GXQD 3VH5T 3UT9D 5JRGA 3X1VB 5GSUA 4AWLB 4XUJD 3LJAC 1EQZA 1BFMA 5B1LD 5AV9B 5CPKB 3KSYA 1M1AA 3LZ0B 1ULYA 4J8UC 3AZMA 1H3OB 4UPKA 3UTBA 3AZLD 4DQYB 3AN2D 3R45B 2F8ND 3REJC 3AZHC 4YS3D 3MNNC 5DNNA 3C1BA 4J8WA 4J8XA 4J8VA 3AV2B 1F66C 1P3LC 1P3AB 2Y2PA 3MGSD 2RVQC 5B32C 1HQ3D 3X1TC 5B24A 4ZUXA 3NQUA 1KX4D 3AV1C 1B67A 1TZYA 2NQBD 1ID3D 3O62B 3MGQC 3KWQD 3AZMB 1P3IB 5AVBC 4H9SC 4J8WB 5DNNB 3LJAA 4J8VB 2AROB 5KDMA 3MGRD 4ZBJC 3WTPB 1U35B 3AFAD 1ZLAC 4NE5A 3WA9D 1BH8A 2BYMA 3RELD 5B24B 3NQUB 1P3BC 5B2IC 3AZHA 3X1UC 3AZID 1F66A 2L5AA 4XZQB 5F99B 5B32A 5KDMB 2W8SA 5B2JD 1Z2CB 3X1TA 5B0ZB 5B0YD 4Z66D 3AV1A 3C1CC 4JJNB 1AOID 3A1IA 3MGQA 3REIB 1P3MB 1BH8B 3REHB 5AVBA 2PYOD 3B6FD 4H9SA 5AV5B 3KUYB 4KGCB 3VH5A 5CP6C 3W96B 1P3BA 5BS7C 2J8PA 5B40B 3LELD 3X1UA 1N1JA 5AV9D 5CPKD 3MGQB 4E44A 1P3KB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LZ0 D;  2BYK B;  1M19 B;  1P3G C;  1P3F D;  3AZE B;  3NQJ B;  3AV2 D;  3AZF C;  4WU8 C;  5B33 A;  2HIO C;  5CPI C;  3C1C A;  1P3A D;  5B31 A;  2CV5 D;  3UTA A;  5B1M A;  3REK D;  3MGP C;  5AV8 C;  3O62 D;  3AZM D;  5B32 G;  5DNM C;  4J8V D;  2ARO D;  5E5A A;  5B33 B;  5BS7 A;  3WTP D;  4X23 B;  5B31 B;  1U35 D;  4EO5 C;  3UTA B;  1R4V A;  5B1M B;  5AV6 A;  5B24 D;  2YFV B;  4KUD C;  4WU8 A;  3AZF A;  2HIO A;  2NZD C;  5CPI A;  1TAF A;  5BNX A;  1P3O B;  4XZQ D;  5F99 D;  1S32 D;  5E5A B;  4E45 A;  5B0Z D;  3AZN B;  3WAA B;  3AYW C;  4JJN D;  3MGP A;  5AV8 A;  3A6N C;  3REI D;  1P3M D;  2FJ7 B;  5AV6 B;  3REH D;  5GT3 D;  5DNM A;  3AZJ A;  5AV5 D;  3KUY D;  4KGC D;  5CPI B;  1TAF B;  5B31 G;  5CPJ A;  4G92 C;  5BNV B;  1P34 C;  3W98 C;  3AZK B;  3W96 D;  3VH6 W;  5B40 D;  3W97 B;  2CWE A;  3MGP B;  4KUD A;  4KHA A;  4YM6 A;  1KX3 C;  2NZD A;  3W99 B;  1P3K D;  3KXB B;  1M19 D;  3AZJ B;  5FUG B;  5GT0 C;  2F8N H;  3AZE D;  1P3P C;  4R8P C;  4WU9 C;  5CPJ B;  5BT1 C;  4HGA B;  4EO5 B;  3MVD C;  3AYW A;  5JRG B;  3A6N A;  5GSU B;  1EQZ B;  1KX5 C;  3TU4 C;  4KUD B;  5AY8 C;  4YM6 B;  5AVC C;  1M1A B;  3VH6 T;  2F8N K;  3B6G C;  1P34 A;  3W98 A;  3UTB B;  4QLC C;  3AZG C;  5B33 D;  3C1B B;  3LZ1 C;  4J8X B;  2LY8 A;  1M18 C;  4X23 D;  5B31 D;  4LD9 D;  3A6N B;  1KX3 A;  3UTA D;  4Z5T C;  3X1S C;  5B1M D;  4J8U A;  4ZUX B;  5GXQ C;  3UT9 C;  1P3P A;  3REJ A;  1TZY B;  5C3I B;  4R8P A;  3MNN A;  4WU9 A;  4G91 C;  3MVD A;  1P3O D;  1P3L A;  4XUJ C;  5E5A D;  5B1L C;  4Z2M H;  3LJA B;  4WNN A;  3AZN D;  3TU4 A;  3WAA D;  3WKJ D;  2HUE C;  5AY8 A;  1KU5 A;  5AVC A;  3WTP E;  3AN2 C;  3AZL C;  1BH9 A;  5JA4 A;  2FJ7 D;  5AV6 D;  2IO5 C;  3B6G A;  2BYM B;  4YS3 C;  4J8U B;  4QLC A;  3AZG A;  3REJ B;  3AZH B;  4NE3 A;  4WU9 B;  3MNN B;  3LZ1 A;  3MVD B;  5CPI D;  1F66 B;  1M18 A;  3MGS C;  1P3L B;  1HQ3 C;  3X1V D;  1KX4 C;  5B32 B;  4Z5T A;  3X1S A;  4WNN B;  3AZK D;  1ZLA A;  3X1T B;  3W97 D;  2NQB C;  1ID3 C;  5GXQ A;  3KWQ C;  3UT9 A;  3AV1 B;  1JFI A;  5B2I A;  3W99 D;  3KXB D;  4XUJ A;  5AVB B;  3MGR C;  3AZJ D;  5B1L A;  5CPJ D;  3AFA C;  4ZBJ B;  4NE6 A;  3WA9 C;  4H9Q A;  5JRG D;  3REL C;  3AZL A;  3AN2 A;  5GSU D;  1ZLA B;  4DRA A;  2F8N A;  1EQZ D;  4YS3 A;  3AZI C;  1P3B B;  3UT9 B;  5B2I B;  4H9R A;  3X1U B;  1N1J B;  4YM6 D;  1M1A D;  3MGS A;  3VH6 A;  5G49 A;  1P3I D;  5B2J C;  3UTB D;  5B0Y C;  5CP6 A;  4Z66 C;  1KX4 A;  4J8W D;  3C1B D;  1WWS A;  5DNN D;  4J8X D;  1AOI C;  1ID3 A;  3KWQ A;  3B0D C;  3C1C B;  3AN2 B;  5CHL B;  1WWI A;  2PYO C;  3B6F C;  1A7W A;  3MGR A;  4H9R B;  4ZUX D;  1P3G A;  1TZY D;  3AFA A;  5G49 B;  3WA9 A;  5CP6 B;  3REL A;  3LJA D;  3LEL C;  5AV9 C;  5CPK C;  2YFW A;  3LZ0 C;  1P3F C;  4J8U D;  5B0Y A;  3AV2 C;  4Z66 A;  1P3G B;  3REJ D;  3AZH D;  1P3A C;  3MNN D;  1F66 D;  4WU8 B;  3AZF B;  4H9N A;  2HIO B;  3B0C W;  1P3L D;  2CV5 C;  5BNX B;  5BO0 A;  2PYO A;  3V9R A;  3B6F A;  2RVQ D;  5B32 D;  3X1T D;  3REK C;  3O62 C;  3AV1 D;  3AZM C;  5AV8 B;  3MGQ D;  4J8V C;  5AVB D;  2ARO C;  5DNM B;  3WTP C;  3LEL A;  5AV9 A;  5CPK A;  1U35 C;  2PYO B;  3V9R B;  5B24 C;  1ZLA D;  3R45 A;  1P3F A;  3B0C T;  3AV2 A;  1P3B D;  5B2I D;  3X1U D;  1P3A A;  4KHA B;  4XZQ C;  1Q9C A;  5F99 C;  2NZD B;  2CV5 A;  1S32 C;  5B0Z C;  3LEL B;  4JJN C;  3REK A;  3O62 A;  3REI C;  1P3M C;  3C1C D;  3AYW B;  3REH C;  5GT3 C;  1P3F B;  4Z2M G;  3B0B A;  2ARO A;  5AV5 C;  3KUY C;  4KGC C;  3WTP A;  5GT0 A;  1U35 A;  2CV5 B;  4G92 B;  3W96 C;  5CP6 D;  1P34 B;  3W98 B;  5B40 C;  3REK B;  2JSS A;  1KX5 A;  1P3K C;  1M19 C;  4XZQ A;  1KX3 B;  5F99 A;  1S32 A;  3AZE C;  5B0Z A;  1P3G D;  5GT0 B;  4JJN A;  1P3P B;  3AZF D;  4WU8 D;  4R8P B;  2HIO D;  3REI A;  1P3M A;  3REH A;  4H9O A;  5GT3 A;  5AV5 A;  3KUY A;  4KGC A;  1KX5 B;  3TU4 B;  5AY8 B;  5AVC B;  3MGP D;  5AV8 D;  1S32 B;  1BH9 B;  5JA4 B;  3W96 A;  4NFT A;  3B6G B;  5B33 C;  4QLC B;  5B40 A;  5DNM D;  3AZG B;  4X23 C;  5B31 C;  4LD9 C;  4UUZ A;  3LZ1 B;  3UTA C;  1M18 B;  4H9O B;  4CSR A;  1P3K A;  5GT3 B;  2BYK A;  5B1M C;  1M19 A;  3AZE A;  4Z5T B;  3X1S B;  3NQJ A;  4H9P A;  5GXQ B;  1JFI B;  4KUD D;  1P3O C;  4G91 B;  2NZD D;  5E5A C;  4XUJ B;  3WAA C;  3AZN C;  1HQ3 A;  5B1L B;  4UUZ B;  3WKJ C;  4CSR B;  3AYW D;  2FJ7 C;  2NQB A;  2HUE B;  5AV6 C;  1F1E A;  4H9Q B;  4WV4 B;  3A6N D;  3AZL B;  2IO5 B;  2F8N B;  4M6B A;  4YS3 B;  4H9P B;  4X23 A;  4LD9 A;  3MGS B;  3X1V C;  3AZK C;  4AWL C;  1P34 D;  1HQ3 B;  3W98 D;  3W97 C;  2YFV A;  1KX4 B;  2NQB B;  1ID3 B;  3AZI A;  3W99 C;  3KWQ B;  3KXB C;  1P3O A;  4WZS B;  1HTA A;  1KX3 D;  3AZJ C;  4CAY A;  3MGR B;  3AZN A;  3WAA A;  5B2J A;  5CPJ C;  5GT0 D;  4LD9 B;  4HGA C;  3WKJ A;  1P3P D;  4WU9 D;  5JRG C;  4R8P D;  5BT1 D;  3MVD D;  3AFA B;  1AOI A;  5GSU C;  2FJ7 A;  3WA9 B;  1EQZ C;  3REL B;  3VH5 W;  2F8N G;  4YM6 C;  3AZI B;  3TU4 D;  1KX5 D;  2YFW B;  1M1A C;  5AY8 D;  5BNV A;  5AVC D;  1P3I C;  4CAY B;  3UTB C;  3X1V A;  3AZK A;  3B6G D;  1B6W A;  4DRB A;  5B2J B;  3C1B C;  5DNN C;  4J8X C;  4QLC D;  3W97 A;  4Z66 B;  5B0Y B;  4J8W C;  3AZG D;  3WKJ B;  3LZ1 D;  1AOI B;  1M18 D;  4H9N B;  3W99 A;  3B0D B;  3KXB A;  5BO0 B;  3B6F B;  3LZ0 A;  5FUG A;  1H3O A;  4ZUX C;  4Z5T D;  3X1S D;  1TZY C;  5C3I C;  5GXQ D;  3VH5 T;  3UT9 D;  5JRG A;  3X1V B;  5GSU A;  4AWL B;  4XUJ D;  3LJA C;  1EQZ A;  1BFM A;  5B1L D;  5AV9 B;  5CPK B;  3KSY A;  1M1A A;  3LZ0 B;  1ULY A;  4J8U C;  3AZM A;  1H3O B;  3UTB A;  3AZL D;  3AN2 D;  1P3I A;  3R45 B;  2F8N D;  3REJ C;  3AZH C;  4YS3 D;  3MNN C;  5DNN A;  3C1B A;  4J8W A;  4J8X A;  4J8V A;  3AV2 B;  1F66 C;  1P3L C;  1P3A B;  3MGS D;  2RVQ C;  5B32 C;  1HQ3 D;  3X1T C;  5B24 A;  4ZUX A;  3NQU A;  1KX4 D;  3AV1 C;  1B67 A;  1TZY A;  2NQB D;  1ID3 D;  3O62 B;  3MGQ C;  3KWQ D;  3AZM B;  1P3I B;  5AVB C;  4H9S C;  4J8W B;  5DNN B;  3LJA A;  4J8V B;  2ARO B;  5KDM A;  3MGR D;  4ZBJ C;  3WTP B;  1U35 B;  3AFA D;  1ZLA C;  4NE5 A;  3WA9 D;  1BH8 A;  2BYM A;  3REL D;  5B24 B;  3NQU B;  1P3B C;  5B2I C;  3AZH A;  3X1U C;  3AZI D;  1F66 A;  2L5A A;  4XZQ B;  5F99 B;  5B32 A;  5KDM B;  5B2J D;  3X1T A;  5B0Z B;  5B0Y D;  4Z66 D;  3AV1 A;  3C1C C;  4JJN B;  1AOI D;  3MGQ A;  3REI B;  1P3M B;  1BH8 B;  3REH B;  5AVB A;  2PYO D;  3B6F D;  4H9S A;  5AV5 B;  3KUY B;  4KGC B;  3VH5 A;  5CP6 C;  3W96 B;  1P3B A;  5BS7 C;  5B40 B;  3LEL D;  3X1U A;  1N1J A;  5AV9 D;  5CPK D;  3MGQ B;  4E44 A;  1P3K B; 
#chains in the Genus database with same CATH topology
 3LZ0 D;  2BYK B;  1M19 B;  1P3G C;  1P3F D;  3AZE B;  3NQJ B;  3AV2 D;  3AZF C;  4WU8 C;  5B33 A;  2HIO C;  3P5J B;  5CPI C;  3C1C A;  1P3A D;  2XD5 A;  5B31 A;  2CV5 D;  2Y2J A;  3UTA A;  2Y2Q A;  5B1M A;  3REK D;  3MGP C;  5AV8 C;  3O62 D;  3IP4 C;  3AZM D;  5B32 G;  5DNM C;  4J8V D;  2ARO D;  5E5A A;  5B33 B;  5BS7 A;  3WTP D;  4X23 B;  5B31 B;  1U35 D;  4EO5 C;  3UTA B;  1R4V A;  5B1M B;  5AV6 A;  5B24 D;  2YFV B;  4KUD C;  4WU8 A;  3AZF A;  2HIO A;  2NZD C;  5CPI A;  1TAF A;  5BNX A;  1P3O B;  4XZQ D;  5F99 D;  1S32 D;  1P3I A;  5E5A B;  4E45 A;  5B0Z D;  3AZN B;  3WAA B;  3AYW C;  4JJN D;  3MGP A;  5AV8 A;  3A6N C;  3REI D;  1P3M D;  2FJ7 B;  5AV6 B;  3REH D;  5GT3 D;  5DNM A;  3AZJ A;  5AV5 D;  3KUY D;  4KGC D;  5CPI B;  1TAF B;  5B31 G;  5CPJ A;  4G92 C;  5BNV B;  2BG1 A;  3EPJ A;  1P34 C;  3W98 C;  3AZK B;  3W96 D;  3VH6 W;  5B40 D;  3W97 B;  2G5I C;  2CWE A;  3MGP B;  4KUD A;  4KHA A;  4YM6 A;  1KX3 C;  2NZD A;  3W99 B;  1P3K D;  3KXB B;  1M19 D;  3AZJ B;  5FUG B;  5GT0 C;  2F8N H;  3AZE D;  1P3P C;  4R8P C;  4WU9 C;  5CPJ B;  5BT1 C;  4HGA B;  4EO5 B;  3MVD C;  3AYW A;  5JRG B;  3A6N A;  2ZM5 A;  5GSU B;  2Y2H A;  1EQZ B;  2Y2I A;  1KX5 C;  3TU4 C;  4KUD B;  5AY8 C;  4YM6 B;  5AVC C;  1M1A B;  3VH6 T;  2F8N K;  3B6G C;  1P34 A;  3W98 A;  3UTB B;  4QLC C;  3AZG C;  5B33 D;  3C1B B;  3LZ1 C;  4J8X B;  2LY8 A;  1M18 C;  4X23 D;  5B31 D;  4LD9 D;  3A6N B;  1KX3 A;  3UTA D;  4Z5T C;  3X1S C;  5B1M D;  2G5H C;  4J8U A;  4ZUX B;  5GXQ C;  3UT9 C;  1P3P A;  3REJ A;  1TZY B;  5C3I B;  4R8P A;  2JCH A;  3MNN A;  4G91 C;  3MVD A;  4WU9 A;  2ZY4 A;  1P3O D;  1P3L A;  4XUJ C;  1T3U A;  5B1L C;  5E5A D;  3EG5 B;  4Z2M H;  3LJA B;  4WNN A;  3AZN D;  3TU4 A;  3WAA D;  1PZR A;  3WKJ D;  2HUE C;  5AY8 A;  1KU5 A;  5AVC A;  3WTP E;  3AN2 C;  2Y2O A;  1BH9 A;  5JA4 A;  3AZL C;  2FJ7 D;  5AV6 D;  2IO5 C;  3B6G A;  2BYM B;  4YS3 C;  4J8U B;  4QLC A;  3AZG A;  3REJ B;  3AZH B;  4NE3 A;  4WU9 B;  3MNN B;  3LZ1 A;  3MVD B;  5CPI D;  1F66 B;  1M18 A;  3MGS C;  1P3L B;  1HQ3 C;  3X1V D;  1KX4 C;  5B32 B;  4Z5T A;  3X1S A;  4WNN B;  3AZK D;  1ZLA A;  3X1T B;  3W97 D;  2NQB C;  1ID3 C;  5GXQ A;  3KWQ C;  3UT9 A;  3AV1 B;  1JFI A;  5B2I A;  3W99 D;  3KXB D;  4XUJ A;  5AVB B;  3MGR C;  3AZJ D;  5B1L A;  5CPJ D;  3AFA C;  4ZBJ B;  4NE6 A;  3WA9 C;  4H9Q A;  5JRG D;  3REL C;  3AZL A;  3AN2 A;  5GSU D;  1ZLA B;  4DRA A;  2F8N A;  1EQZ D;  4YS3 A;  3AZI C;  1P3B B;  3UT9 B;  5B2I B;  4H9R A;  3X1U B;  1N1J B;  4YM6 D;  1M1A D;  3MGS A;  3VH6 A;  5G49 A;  1P3I D;  5B2J C;  3UTB D;  5B0Y C;  5CP6 A;  4Z66 C;  1KX4 A;  4J8W D;  3C1B D;  1WWS A;  5DNN D;  4J8X D;  1AOI C;  1ID3 A;  3KWQ A;  3B0D C;  3C1C B;  3AN2 B;  2Y2M A;  5CHL B;  1WWI A;  2PYO C;  3B6F C;  1A7W A;  3MGR A;  4H9R B;  4ZUX D;  1P3G A;  1TZY D;  3AFA A;  3AL0 C;  5G49 B;  2Y2G A;  3WA9 A;  5CP6 B;  3REL A;  3KFU G;  3LJA D;  3LEL C;  5AV9 C;  5CPK C;  2YFW A;  3LZ0 C;  1W2E A;  1P3F C;  4J8U D;  5B0Y A;  3AV2 C;  4Z66 A;  3EPL A;  1P3G B;  2JE5 A;  3REJ D;  3AZH D;  1P3A C;  3MNN D;  1F66 D;  4WU8 B;  3AZF B;  3FDD A;  2FFF B;  4H9N A;  2HIO B;  3B0C W;  1P3L D;  2CV5 C;  4WJ3 C;  5BNX B;  5BO0 A;  2PYO A;  3V9R A;  3B6F A;  2RVQ D;  5B32 D;  3X1T D;  3REK C;  3O62 C;  3AV1 D;  3AZM C;  5AV8 B;  3MGQ D;  4J8V C;  5AVB D;  2ARO C;  5DNM B;  3WTP C;  3LEL A;  5AV9 A;  5CPK A;  1U35 C;  2UWX A;  2PYO B;  3V9R B;  5B24 C;  1ZLA D;  2ZY5 A;  3R45 A;  1P3F A;  3B0C T;  3AV2 A;  1P3B D;  5B2I D;  3X1U D;  1P3A A;  2Y2N A;  4KHA B;  4XZQ C;  1Q9C A;  5F99 C;  2NZD B;  2CV5 A;  1S32 C;  5B0Z C;  3LEL B;  2ZY3 A;  3EPK A;  4JJN C;  3REK A;  3O62 A;  3REI C;  1P3M C;  3C1C D;  3AYW B;  3REH C;  5GT3 C;  2Y2L A;  4Z2M G;  1P3F B;  3B0B A;  2ARO A;  5AV5 C;  3KUY C;  4KGC C;  3WTP A;  5GT0 A;  1U35 A;  2CV5 B;  4G92 B;  3W96 C;  5CP6 D;  1P34 B;  3W98 B;  5B40 C;  3F6T A;  3REK B;  3A1K A;  2JSS A;  1KX5 A;  1P3K C;  2DQN C;  1M19 C;  4XZQ A;  1KX3 B;  5F99 A;  1S32 A;  3AZE C;  5B0Z A;  1P3G D;  5GT0 B;  4JJN A;  1P3P B;  3AZF D;  2Y2K A;  4WU8 D;  4R8P B;  2XD1 A;  2HIO D;  3REI A;  1P3M A;  3REH A;  4H9O A;  5GT3 A;  3H0R C;  5AV5 A;  3KUY A;  4KGC A;  1KX5 B;  2VQR A;  3TU4 B;  5AY8 B;  5AVC B;  3MGP D;  5AV8 D;  1S32 B;  1BH9 B;  5JA4 B;  3W96 A;  4NFT A;  3B6G B;  5B33 C;  4QLC B;  5B40 A;  5DNM D;  3AZG B;  4X23 C;  5B31 C;  4LD9 C;  4UUZ A;  3LZ1 B;  3UTA C;  1M18 B;  4H9O B;  4CSR A;  1P3K A;  5GT3 B;  2BYK A;  5B1M C;  1M19 A;  3H0M C;  3AZE A;  4Z5T B;  3X1S B;  3NQJ A;  4H9P A;  5GXQ B;  1JFI B;  4KUD D;  1P3O C;  4G91 B;  2NZD D;  5E5A C;  4XUJ B;  3WAA C;  3AZN C;  1HQ3 A;  5B1L B;  4UUZ B;  3WKJ C;  4CSR B;  3AYW D;  2FJ7 C;  2NQB A;  2HUE B;  5AV6 C;  1F1E A;  4H9Q B;  4WV4 B;  3A6N D;  3AZL B;  2IO5 B;  2F8N B;  4M6B A;  4YS3 B;  4H9P B;  4X23 A;  2ZY2 A;  4LD9 A;  3MGS B;  3X1V C;  3AZK C;  4AWL C;  1P34 D;  1HQ3 B;  3W98 D;  3W97 C;  2YFV A;  1KX4 B;  2NQB B;  1ID3 B;  3AZI A;  3W99 C;  3KWQ B;  3KXB C;  1P3O A;  4WZS B;  1HTA A;  1KX3 D;  3AZJ C;  4CAY A;  3MGR B;  3AZN A;  3WAA A;  5B2J A;  5CPJ C;  5GT0 D;  2F2A C;  4HGA C;  4LD9 B;  3WKJ A;  1P3P D;  4WU9 D;  5JRG C;  4R8P D;  5BT1 D;  3MVD D;  2RIQ A;  3AFA B;  5GSU C;  1AOI A;  2FJ7 A;  3EPH A;  3WA9 B;  1EQZ C;  3REL B;  3VH5 W;  2F8N G;  4YM6 C;  3AZI B;  3TU4 D;  1KX5 D;  2YFW B;  3H0L C;  1M1A C;  5AY8 D;  5BNV A;  5AVC D;  1P3I C;  4CAY B;  3UTB C;  3X1V A;  3AZK A;  2DF4 C;  3B6G D;  1B6W A;  4DRB A;  5B2J B;  3C1B C;  5DNN C;  4J8X C;  4QLC D;  3W97 A;  4Z66 B;  5B0Y B;  4J8W C;  3AZG D;  3WKJ B;  3LZ1 D;  1AOI B;  1M18 D;  4H9N B;  3W99 A;  3B0D B;  3KXB A;  5BO0 B;  3B6F B;  3LZ0 A;  5FUG A;  1H3O A;  4ZUX C;  4Z5T D;  3X1S D;  1TZY C;  5C3I C;  5GXQ D;  3VH5 T;  3UT9 D;  5JRG A;  3X1V B;  5GSU A;  4AWL B;  4XUJ D;  3LJA C;  1EQZ A;  1BFM A;  5B1L D;  5AV9 B;  5CPK B;  3KSY A;  1M1A A;  3LZ0 B;  1ULY A;  4J8U C;  3AZM A;  1H3O B;  4UPK A;  3UTB A;  3AZL D;  4DQY B;  3AN2 D;  3R45 B;  2F8N D;  3REJ C;  3AZH C;  4YS3 D;  3MNN C;  5DNN A;  3C1B A;  4J8W A;  4J8X A;  4J8V A;  3AV2 B;  1F66 C;  1P3L C;  1P3A B;  2Y2P A;  3MGS D;  2RVQ C;  5B32 C;  1HQ3 D;  3X1T C;  5B24 A;  4ZUX A;  3NQU A;  1KX4 D;  3AV1 C;  1B67 A;  1TZY A;  2NQB D;  1ID3 D;  3O62 B;  3MGQ C;  3KWQ D;  3AZM B;  1P3I B;  5AVB C;  4H9S C;  4J8W B;  5DNN B;  3LJA A;  4J8V B;  2ARO B;  5KDM A;  3MGR D;  4ZBJ C;  3WTP B;  1U35 B;  3AFA D;  1ZLA C;  4NE5 A;  3WA9 D;  1BH8 A;  2BYM A;  3REL D;  5B24 B;  3NQU B;  1P3B C;  5B2I C;  3AZH A;  3X1U C;  3AZI D;  1F66 A;  2L5A A;  4XZQ B;  5F99 B;  5B32 A;  5KDM B;  2W8S A;  5B2J D;  1Z2C B;  3X1T A;  5B0Z B;  5B0Y D;  4Z66 D;  3AV1 A;  3C1C C;  4JJN B;  1AOI D;  3A1I A;  3MGQ A;  3REI B;  1P3M B;  1BH8 B;  3REH B;  5AVB A;  2PYO D;  3B6F D;  4H9S A;  5AV5 B;  3KUY B;  4KGC B;  3VH5 A;  5CP6 C;  3W96 B;  1P3B A;  5BS7 C;  2J8P A;  5B40 B;  3LEL D;  3X1U A;  1N1J A;  5AV9 D;  5CPK D;  3MGQ B;  4E44 A;  1P3K B; 
#chains in the Genus database with same CATH homology
 3LZ0 D;  2BYK B;  1M19 B;  1P3G C;  1P3F D;  3AZE B;  3NQJ B;  3AV2 D;  3AZF C;  4WU8 C;  5B33 A;  2HIO C;  3P5J B;  5CPI C;  3C1C A;  1P3A D;  2XD5 A;  5B31 A;  2CV5 D;  2Y2J A;  3UTA A;  2Y2Q A;  5B1M A;  3REK D;  3MGP C;  5AV8 C;  3O62 D;  3IP4 C;  3AZM D;  5B32 G;  5DNM C;  4J8V D;  2ARO D;  5E5A A;  5B33 B;  5BS7 A;  3WTP D;  4X23 B;  5B31 B;  1U35 D;  4EO5 C;  3UTA B;  1R4V A;  5B1M B;  5AV6 A;  5B24 D;  2YFV B;  4KUD C;  4WU8 A;  3AZF A;  2HIO A;  2NZD C;  5CPI A;  1TAF A;  5BNX A;  1P3O B;  4XZQ D;  5F99 D;  1S32 D;  1P3I A;  5E5A B;  4E45 A;  5B0Z D;  3AZN B;  3WAA B;  3AYW C;  4JJN D;  3MGP A;  5AV8 A;  3A6N C;  3REI D;  1P3M D;  2FJ7 B;  5AV6 B;  3REH D;  5GT3 D;  5DNM A;  3AZJ A;  5AV5 D;  3KUY D;  4KGC D;  5CPI B;  1TAF B;  5B31 G;  5CPJ A;  4G92 C;  5BNV B;  2BG1 A;  3EPJ A;  1P34 C;  3W98 C;  3AZK B;  3W96 D;  3VH6 W;  5B40 D;  3W97 B;  2G5I C;  2CWE A;  3MGP B;  4KUD A;  4KHA A;  4YM6 A;  1KX3 C;  2NZD A;  3W99 B;  1P3K D;  3KXB B;  1M19 D;  3AZJ B;  5FUG B;  5GT0 C;  2F8N H;  3AZE D;  1P3P C;  4R8P C;  4WU9 C;  5CPJ B;  5BT1 C;  4HGA B;  4EO5 B;  3MVD C;  3AYW A;  5JRG B;  3A6N A;  2ZM5 A;  5GSU B;  2Y2H A;  1EQZ B;  2Y2I A;  1KX5 C;  3TU4 C;  4KUD B;  5AY8 C;  4YM6 B;  5AVC C;  1M1A B;  3VH6 T;  2F8N K;  3B6G C;  1P34 A;  3W98 A;  3UTB B;  4QLC C;  3AZG C;  5B33 D;  3C1B B;  3LZ1 C;  4J8X B;  2LY8 A;  1M18 C;  4X23 D;  5B31 D;  4LD9 D;  3A6N B;  1KX3 A;  3UTA D;  4Z5T C;  3X1S C;  5B1M D;  2G5H C;  4J8U A;  4ZUX B;  5GXQ C;  3UT9 C;  1P3P A;  3REJ A;  1TZY B;  5C3I B;  4R8P A;  2JCH A;  3MNN A;  4G91 C;  3MVD A;  4WU9 A;  2ZY4 A;  1P3O D;  1P3L A;  4XUJ C;  1T3U A;  5B1L C;  5E5A D;  3EG5 B;  4Z2M H;  3LJA B;  4WNN A;  3AZN D;  3TU4 A;  3WAA D;  1PZR A;  3WKJ D;  2HUE C;  5AY8 A;  1KU5 A;  5AVC A;  3WTP E;  3AN2 C;  2Y2O A;  1BH9 A;  5JA4 A;  3AZL C;  2FJ7 D;  5AV6 D;  2IO5 C;  3B6G A;  2BYM B;  4YS3 C;  4J8U B;  4QLC A;  3AZG A;  3REJ B;  3AZH B;  4NE3 A;  4WU9 B;  3MNN B;  3LZ1 A;  3MVD B;  5CPI D;  1F66 B;  1M18 A;  3MGS C;  1P3L B;  1HQ3 C;  3X1V D;  1KX4 C;  5B32 B;  4Z5T A;  3X1S A;  4WNN B;  3AZK D;  1ZLA A;  3X1T B;  3W97 D;  2NQB C;  1ID3 C;  5GXQ A;  3KWQ C;  3UT9 A;  3AV1 B;  1JFI A;  5B2I A;  3W99 D;  3KXB D;  4XUJ A;  5AVB B;  3MGR C;  3AZJ D;  5B1L A;  5CPJ D;  3AFA C;  4ZBJ B;  4NE6 A;  3WA9 C;  4H9Q A;  5JRG D;  3REL C;  3AZL A;  3AN2 A;  5GSU D;  1ZLA B;  4DRA A;  2F8N A;  1EQZ D;  4YS3 A;  3AZI C;  1P3B B;  3UT9 B;  5B2I B;  4H9R A;  3X1U B;  1N1J B;  4YM6 D;  1M1A D;  3MGS A;  3VH6 A;  5G49 A;  1P3I D;  5B2J C;  3UTB D;  5B0Y C;  5CP6 A;  4Z66 C;  1KX4 A;  4J8W D;  3C1B D;  1WWS A;  5DNN D;  4J8X D;  1AOI C;  1ID3 A;  3KWQ A;  3B0D C;  3C1C B;  3AN2 B;  2Y2M A;  5CHL B;  1WWI A;  2PYO C;  3B6F C;  1A7W A;  3MGR A;  4H9R B;  4ZUX D;  1P3G A;  1TZY D;  3AFA A;  3AL0 C;  5G49 B;  2Y2G A;  3WA9 A;  5CP6 B;  3REL A;  3KFU G;  3LJA D;  3LEL C;  5AV9 C;  5CPK C;  2YFW A;  3LZ0 C;  1W2E A;  1P3F C;  4J8U D;  5B0Y A;  3AV2 C;  4Z66 A;  3EPL A;  1P3G B;  2JE5 A;  3REJ D;  3AZH D;  1P3A C;  3MNN D;  1F66 D;  4WU8 B;  3AZF B;  3FDD A;  2FFF B;  4H9N A;  2HIO B;  3B0C W;  1P3L D;  2CV5 C;  4WJ3 C;  5BNX B;  5BO0 A;  2PYO A;  3V9R A;  3B6F A;  2RVQ D;  5B32 D;  3X1T D;  3REK C;  3O62 C;  3AV1 D;  3AZM C;  5AV8 B;  3MGQ D;  4J8V C;  5AVB D;  2ARO C;  5DNM B;  3WTP C;  3LEL A;  5AV9 A;  5CPK A;  1U35 C;  2UWX A;  2PYO B;  3V9R B;  5B24 C;  1ZLA D;  2ZY5 A;  3R45 A;  1P3F A;  3B0C T;  3AV2 A;  1P3B D;  5B2I D;  3X1U D;  1P3A A;  2Y2N A;  4KHA B;  4XZQ C;  1Q9C A;  5F99 C;  2NZD B;  2CV5 A;  1S32 C;  5B0Z C;  3LEL B;  2ZY3 A;  3EPK A;  4JJN C;  3REK A;  3O62 A;  3REI C;  1P3M C;  3C1C D;  3AYW B;  3REH C;  5GT3 C;  2Y2L A;  4Z2M G;  1P3F B;  3B0B A;  2ARO A;  5AV5 C;  3KUY C;  4KGC C;  3WTP A;  5GT0 A;  1U35 A;  2CV5 B;  4G92 B;  3W96 C;  5CP6 D;  1P34 B;  3W98 B;  5B40 C;  3F6T A;  3REK B;  3A1K A;  2JSS A;  1KX5 A;  1P3K C;  2DQN C;  1M19 C;  4XZQ A;  1KX3 B;  5F99 A;  1S32 A;  3AZE C;  5B0Z A;  1P3G D;  5GT0 B;  4JJN A;  1P3P B;  3AZF D;  2Y2K A;  4WU8 D;  4R8P B;  2XD1 A;  2HIO D;  3REI A;  1P3M A;  3REH A;  4H9O A;  5GT3 A;  3H0R C;  5AV5 A;  3KUY A;  4KGC A;  1KX5 B;  2VQR A;  3TU4 B;  5AY8 B;  5AVC B;  3MGP D;  5AV8 D;  1S32 B;  1BH9 B;  5JA4 B;  3W96 A;  4NFT A;  3B6G B;  5B33 C;  4QLC B;  5B40 A;  5DNM D;  3AZG B;  4X23 C;  5B31 C;  4LD9 C;  4UUZ A;  3LZ1 B;  3UTA C;  1M18 B;  4H9O B;  4CSR A;  1P3K A;  5GT3 B;  2BYK A;  5B1M C;  1M19 A;  3H0M C;  3AZE A;  4Z5T B;  3X1S B;  3NQJ A;  4H9P A;  5GXQ B;  1JFI B;  4KUD D;  1P3O C;  4G91 B;  2NZD D;  5E5A C;  4XUJ B;  3WAA C;  3AZN C;  1HQ3 A;  5B1L B;  4UUZ B;  3WKJ C;  4CSR B;  3AYW D;  2FJ7 C;  2NQB A;  2HUE B;  5AV6 C;  1F1E A;  4H9Q B;  4WV4 B;  3A6N D;  3AZL B;  2IO5 B;  2F8N B;  4M6B A;  4YS3 B;  4H9P B;  4X23 A;  2ZY2 A;  4LD9 A;  3MGS B;  3X1V C;  3AZK C;  4AWL C;  1P34 D;  1HQ3 B;  3W98 D;  3W97 C;  2YFV A;  1KX4 B;  2NQB B;  1ID3 B;  3AZI A;  3W99 C;  3KWQ B;  3KXB C;  1P3O A;  4WZS B;  1HTA A;  1KX3 D;  3AZJ C;  4CAY A;  3MGR B;  3AZN A;  3WAA A;  5B2J A;  5CPJ C;  5GT0 D;  2F2A C;  4HGA C;  4LD9 B;  3WKJ A;  1P3P D;  4WU9 D;  5JRG C;  4R8P D;  5BT1 D;  3MVD D;  2RIQ A;  3AFA B;  5GSU C;  1AOI A;  2FJ7 A;  3EPH A;  3WA9 B;  1EQZ C;  3REL B;  3VH5 W;  2F8N G;  4YM6 C;  3AZI B;  3TU4 D;  1KX5 D;  2YFW B;  3H0L C;  1M1A C;  5AY8 D;  5BNV A;  5AVC D;  1P3I C;  4CAY B;  3UTB C;  3X1V A;  3AZK A;  2DF4 C;  3B6G D;  1B6W A;  4DRB A;  5B2J B;  3C1B C;  5DNN C;  4J8X C;  4QLC D;  3W97 A;  4Z66 B;  5B0Y B;  4J8W C;  3AZG D;  3WKJ B;  3LZ1 D;  1AOI B;  1M18 D;  4H9N B;  3W99 A;  3B0D B;  3KXB A;  5BO0 B;  3B6F B;  3LZ0 A;  5FUG A;  1H3O A;  4ZUX C;  4Z5T D;  3X1S D;  1TZY C;  5C3I C;  5GXQ D;  3VH5 T;  3UT9 D;  5JRG A;  3X1V B;  5GSU A;  4AWL B;  4XUJ D;  3LJA C;  1EQZ A;  1BFM A;  5B1L D;  5AV9 B;  5CPK B;  3KSY A;  1M1A A;  3LZ0 B;  1ULY A;  4J8U C;  3AZM A;  1H3O B;  4UPK A;  3UTB A;  3AZL D;  4DQY B;  3AN2 D;  3R45 B;  2F8N D;  3REJ C;  3AZH C;  4YS3 D;  3MNN C;  5DNN A;  3C1B A;  4J8W A;  4J8X A;  4J8V A;  3AV2 B;  1F66 C;  1P3L C;  1P3A B;  2Y2P A;  3MGS D;  2RVQ C;  5B32 C;  1HQ3 D;  3X1T C;  5B24 A;  4ZUX A;  3NQU A;  1KX4 D;  3AV1 C;  1B67 A;  1TZY A;  2NQB D;  1ID3 D;  3O62 B;  3MGQ C;  3KWQ D;  3AZM B;  1P3I B;  5AVB C;  4H9S C;  4J8W B;  5DNN B;  3LJA A;  4J8V B;  2ARO B;  5KDM A;  3MGR D;  4ZBJ C;  3WTP B;  1U35 B;  3AFA D;  1ZLA C;  4NE5 A;  3WA9 D;  1BH8 A;  2BYM A;  3REL D;  5B24 B;  3NQU B;  1P3B C;  5B2I C;  3AZH A;  3X1U C;  3AZI D;  1F66 A;  2L5A A;  4XZQ B;  5F99 B;  5B32 A;  5KDM B;  2W8S A;  5B2J D;  1Z2C B;  3X1T A;  5B0Z B;  5B0Y D;  4Z66 D;  3AV1 A;  3C1C C;  4JJN B;  1AOI D;  3A1I A;  3MGQ A;  3REI B;  1P3M B;  1BH8 B;  3REH B;  5AVB A;  2PYO D;  3B6F D;  4H9S A;  5AV5 B;  3KUY B;  4KGC B;  3VH5 A;  5CP6 C;  3W96 B;  1P3B A;  5BS7 C;  2J8P A;  5B40 B;  3LEL D;  3X1U A;  1N1J A;  5AV9 D;  5CPK D;  3MGQ B;  4E44 A;  1P3K B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...