5CPKD

Nucleosome containing methylated sat2l dna
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
92
structure length
92
Chain Sequence
SRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Influence of DNA methylation on positioning and DNA flexibility of nucleosomes with pericentric satellite DNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 35
structure length 92
sequence length 92
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5cpkD00
5AY8B 3UTBD 1P3BB 5B2JD 4YM6A 2FJ7C 5JRGC 3B6FA 4WU8C 3MGQC 4YS3B 1P3AC 5C3IC 3C1BC 1AOIB 5GT0B 4R8PB 1ID3B 1ZLAB 3X1VD 1HQ3C 4H9RA 5B0ZA 5B31C 5DNMD 4UUZA 5AV9B 4KGCA 4H9SA 2F8NA 4J8WA 1A7WA 3O62A 3AFAB 4J8XA 3A6NA 5CPIC 3LZ1B 5DNND 5CP6C 3VH6A 4KGCC 5AVCB 4LD9A 5B24B 4J8WC 3B0DB 3O62C 1EQZA 4Z2MH 3W99C 5AVBD 4H9OB 3WA9D 3MNND 5G49B 3AYWC 3AZFC 1P3MB 1WWSA 3LJAB 1BH8A 4WNNB 3AZJB 4Z66D 4H9QA 4R8PC 5B2JA 3UTBA 1M18A 1TZYD 1F1EA 4ZUXD 3VH5T 2PYOB 3WTPD 3AZED 3KXBD 3UTAD 3AN2D 3MGSD 4QLCB 5BS7A 5BT1D 5FUGB 1P3FD 5JA4B 5DNMA 3AZLB 2IO5B 3X1VC 3AZMC 5CPJA 5DNMC 5DNNA 2NQBB 3MGRC 3AZHC 1M1AD 4Z5TA 5GXQA 1F66B 3KSYA 3AZGB 4XUJC 3R45A 5AVBA 4X23D 3NQUB 1P3LB 3LZ0D 3WA9A 3MNNA 3X1SD 1P3OC 2AROA 2YFWB 2RVQD 4Z66A 3WA9C 3MNNC 1TZYA 3WTPA 3AZEA 3AZNA 5B33B 1P3PD 3AN2A 3MGSA 4KUDB 5KDMB 5CPKD 1TZYC 4ZUXC 5B1LD 3AZEC 5BNVB 3KXBC 5BO0B 3UTAC 2BYMA 5B2ID 1KX4B 3RELC 1F66C 5AV6D 5BT1C 1P3KC 1P3FC 3WKJD 3KUYB 3X1TB 2NZDD 4XZQD 2HIOC 1JFIB 3B6GA 1M1AA 4HGAB 4AWLC 1M19B 4H9PA 4G92B 4X23A 3MVDC 1B6WA 1KX3D 3X1UC 3REIA 3REJB 3W96D 2CV5D 4G91B 4YM6D 3B6FD 3LZ0C 3KWQB 3TU4B 5E5AB 4KHAB 3X1SC 3AZID 5JRGB 2RVQC 1P3PA 5B0ZD 1B67A 4WU8B 3MGQB 5CPKA 1P3AB 1KX5D 3C1BB 5B1LA 3REHA 4NE5A 1P3PC 4H9NB 5F99A 4J8XD 3A6ND 5AV6A 1HQ3B 5B1LC 3MGPD 3C1CD 5B31B 4LD9D 3W97D 5B2IC 3W98D 4J8UD 3WKJA 1TAFB 2NZDA 4XZQA 4JJNA 4UUZB 5CPIB 1S32B 5CP6B 4KGCB 3WAAD 4WU9A 1P34C 2F8NB 4NFTA 5GT3D 4J8WB 1KX3A 3W96A 3O62B 1U35A 3W99B 2CV5A 1M18D 4WV4B 3AYWB 3AZFB 5B32G 4YM6C 3V9RB 3B6FC 3REKA 3AZIA 4YS3D 3LELD 5B40D 1KX5A 3UTBB 5B2JB 1AOID 1ID3D 4WZSB 5B0YD 5B0ZC 1ZLAD 3UT9D 5CPJD 3MGPA 3C1CA 5AV9D 4H9SC 3W97A 5GXQD 4Z5TD 3W98A 4J8UA 4J8XC 1P3IA 3A6NC 3X1VB 3AZMB 3LZ1D 3MGPC 3C1CC 5DNMB 1H3OA 5AVCD 4LD9C 3WAAA 1EQZC 3MGRB 3AZHB 5GT3A 2AROD 4Z2MG 4XUJB 5B1MD 1P3MD 3AZND 1P3OB 5B31G 3AV2A 3UTBC 5AVBB 4NE3A 5B2JC 2F8NH 1M18C 3WA9B 3MNNB 4YS3A 3LELA 1N1JB 5BS7C 5B40A 4Z66B 4J8VD 1AOIA 5GT0A 1TZYB 4ZUXB 5B0YA 3LELC 1ID3A 3NQJB 1ZLAA 3UT9A 3AZEB 5B40C 3KXBB 3UTAB 2BYKA 3MGSB 3AN2B 5AV9A 3RELB 3B6GD 4M6BA 5B0YC 5CPJC 1P3KB 3AFAA 4E44A 5DNNC 1P3FB 2L5AA 3LZ1A 3REID 5AVCA 4Z5TC 5GXQC 2HIOB 4CSRB 5AVBC 3VH6T 4AWLB 3MVDB 5B1MA 3X1UB 5G49A 2AROC 1P3MA 3LJAA 4Z66C 3AZJA 4X23B 4EO5C 3LZ0B 3WTPC 3X1SB 3REHD 3AZNC 3AN2C 5F99D 3MGSC 5B33D 4KUDD 4J8VA 4E45A 3AZKD 4J8VC 1P3PB 4JJND 5CPKB 5B32D 5B1LB 4WU9D 5BNXA 5B2IB 3KUYD 3X1TD 1U35D 3AV1D 1M1AC 2NQBA 3B6GC 5AV6B 3AZGA 4X23C 3REIC 4ZBJB 3WKJB 3NQUA 3REJD 1P34B 1P3LA 5AV5D 3REKD 2YFWA 4NE6A 3KWQD 1HTAA 5GSUD 1P3GD 3W96B 4CAYA 5AV8D 2CV5B 4YM6B 3VH6W 2FJ7D 3B6FB 5B33A 5CPKC 4KUDA 5KDMA 3WTPE 3REHC 5BNVA 5F99C 3AZKA 1P3ID 1KX4A 2HUEB 5AV6C 4H9RB 5B0ZB 1P3AA 1HQ3D 5B31D 5B32A 4ZBJC 3AZKC 3WKJC 2NZDC 4XZQC 3KUYA 3X1TA 4JJNC 3AV1A 4J8XB 3A6NB 3MGPB 3C1CB 4WU9C 4LD9B 1KX3C 3W96C 3AV1C 1U35C 1EQZB 3REJA 3AV2D 2CV5C 1S32D 3W99D 5AV5A 5AY8D 1P3BD 1H3OB 2YFVA 3WAAB 2F8NK 3KWQA 3TU4A 3VH5A 5AV5C 1BH8B 5GSUA 3AZFD 1P3GA 5E5AA 4KHAA 5AV8A 1BH9A 4H9QB 3REKC 3AZIC 5GT0D 4R8PD 1M18B 2HUEC 2FJ7A 5JRGA 5GSUC 1KX5C 3C1BA 4H9NA 3AFAD 3LELB 1HQ3A 1ULYA 1R4VA 5B40B 5B31A 3W97C 3W98C 4J8UC 5B24D 1P3IC 5B0YB 1TAFA 3UT9B 3AZMD 5CPJB 5DNNB 2BYKB 5CPIA 3WAAC 5CP6A 5GXQB 4Z5TB 5GT3C 3MGRD 3AZHD 3LJAD 1S32A 3AZJD 3R45B 4XUJD 3W99A 5AY8A 1P3BA 2PYOD 3AV2C 1S32C 3AYWA 2AROB 3AZFA 1P3OD 5AY8C 1P3BC 4QLCD 3V9RA 2F8NG 5B1MB 4EO5B 4YS3C 4R8PA 1BFMA 2CWEA 3WTPB 3AZNB 1AOIC 5GT0C 3AZLD 1ID3C 1ZLAC 3UT9C 4DRAA 2BYMB 5AV9C 2NQBD 3RELD 4J8VB 5B24A 1Q9CA 1F66D 3AFAC 3AZGD 1P3KD 3LZ1C 3AZMA 3X1VA 5AVCC 4H9OA 1P3LD 5B24C 3B0CT 3B0DC 2HIOD 1M1AB 3B6GB 3MGRA 3AZHA 4WNNA 4H9PB 4XUJA 5BNXB 5B1MC 3REIB 3MVDD 3X1UD 1P3MC 2PYOA 3LJAC 3AZJC 1P3OA 4QLCA 2PYOC 5FUGA 1N1JA 5JA4A 1KX4D 4QLCC 3AZLA 4ZUXA 4CAYB 3NQJA 3REHB 5F99B 3KXBA 3UTAA 3AZLC 3RELA 2IO5C 1F66A 1P3KA 1M19D 3AZKB 1P3FA 2NQBC 2NZDB 4XZQB 4JJNB 2HIOA 4CSRA 3VH5W 3AZGC 5B32B 4WU9B 1P3LC 3TU4D 1KX3B 1P34D 3MVDA 1U35B 3AV1B 5E5AD 3X1UA 5JRGD 4WU8D 4DRBA 3MGQD 1P3AD 3LZ0A 3B0CW 3C1BD 5AV5B 3X1SA 5BO0A 5B33C 3REKB 3AZIB 4KUDC 2YFVB 1P3GB 5GSUB 1KX5B 5AV8B 1BH9B 1KX4C 2FJ7B 2JSSA 1JFIA 5C3IB 5B32C 5CPID 5CHLB 5CP6D 4KGCD 3W97B 3B0BA 1M19A 3KUYC 4J8UB 3X1TC 2F8ND 4J8WD 5B2IA 3W98B 1P3IB 3O62D 4HGAC 1M19C 1KU5A 4G92C 3REJC 1EQZD 5GT3B 3AYWD 1P34A 2LY8A 4G91C 1WWIA 3KWQC 3TU4C 1P3GC 4WU8A 3MGQA 5E5AC 5AV8C 3AV2B
chains in the Genus database with same CATH superfamily
5AY8B 3UTBD 1P3BB 5B2JD 4YM6A 2FJ7C 5JRGC 2W8SA 3B6FA 4WU8C 3MGQC 4YS3B 1P3AC 5C3IC 3C1BC 1AOIB 5GT0B 4R8PB 1ID3B 1ZLAB 3X1VD 1HQ3C 4H9RA 5B0ZA 5B31C 5DNMD 4UUZA 5AV9B 4KGCA 2Y2OA 4H9SA 2F8NA 4J8WA 1A7WA 3O62A 3AFAB 4J8XA 4UPKA 2Y2LA 3A6NA 5CPIC 3LZ1B 5DNND 5CP6C 3VH6A 4KGCC 5AVCB 4LD9A 5B24B 4J8WC 3B0DB 3O62C 1EQZA 4Z2MH 3W99C 1Z2CB 5AVBD 4H9OB 3WA9D 3MNND 5G49B 3AYWC 3AZFC 1P3MB 1WWSA 3LJAB 1BH8A 4WNNB 3AZJB 4Z66D 4H9QA 4R8PC 5B2JA 3UTBA 1M18A 1TZYD 1F1EA 4ZUXD 3VH5T 2PYOB 3WTPD 3AZED 3KXBD 3UTAD 3AN2D 3MGSD 4QLCB 5BS7A 5BT1D 5FUGB 1P3FD 5JA4B 5DNMA 3AZLB 2IO5B 3X1VC 3AZMC 5CPJA 5DNMC 5DNNA 2NQBB 3MGRC 3AZHC 1M1AD 4Z5TA 5GXQA 1F66B 3KSYA 3AZGB 4XUJC 2ZM5A 3R45A 5AVBA 4X23D 3NQUB 1P3LB 3LZ0D 3WA9A 3MNNA 3X1SD 1P3OC 2AROA 2YFWB 2RVQD 4Z66A 3WA9C 3MNNC 2F2AC 1TZYA 3WTPA 3AZEA 3AZNA 5B33B 1P3PD 3AN2A 3MGSA 4KUDB 5KDMB 5CPKD 1TZYC 4ZUXC 5B1LD 3AZEC 5BNVB 3KXBC 5BO0B 3UTAC 2BYMA 5B2ID 1KX4B 3RELC 1F66C 5AV6D 5BT1C 1P3KC 3AL0C 1P3FC 3WKJD 3KUYB 2Y2KA 3X1TB 4XZQD 2NZDD 2HIOC 1JFIB 3B6GA 1M1AA 4HGAB 2Y2HA 4AWLC 1M19B 4H9PA 4G92B 4X23A 3MVDC 1B6WA 1KX3D 3X1UC 3REIA 3REJB 3W96D 2CV5D 3EPLA 4G91B 4YM6D 3B6FD 3P5JB 3LZ0C 3KWQB 3TU4B 2Y2PA 5E5AB 4KHAB 3X1SC 3EPJA 2Y2NA 3AZID 5JRGB 2RVQC 1P3PA 5B0ZD 1B67A 4WU8B 3MGQB 5CPKA 1P3AB 1KX5D 3C1BB 5B1LA 3REHA 4NE5A 1P3PC 4H9NB 5F99A 4J8XD 3A6ND 5AV6A 1HQ3B 5B1LC 3MGPD 3C1CD 5B31B 4LD9D 3W97D 5B2IC 3W98D 4J8UD 3WKJA 1TAFB 2NZDA 4XZQA 4JJNA 4UUZB 5CPIB 1S32B 5CP6B 4KGCB 3WAAD 4WU9A 1P34C 2F8NB 4NFTA 5GT3D 4J8WB 1KX3A 3W96A 3O62B 1U35A 3W99B 2CV5A 1M18D 4WV4B 3AYWB 3AZFB 5B32G 4YM6C 3V9RB 3B6FC 3REKA 3AZIA 4YS3D 3LELD 5B40D 1KX5A 3UTBB 5B2JB 1AOID 1ID3D 4WZSB 5B0YD 5B0ZC 1ZLAD 3UT9D 5CPJD 2JE5A 3MGPA 3C1CA 5AV9D 4H9SC 3W97A 5GXQD 4Z5TD 3W98A 4J8UA 4J8XC 1P3IA 3A6NC 3X1VB 3AZMB 3LZ1D 3MGPC 3C1CC 5DNMB 1H3OA 5AVCD 4LD9C 3WAAA 1EQZC 3MGRB 3AZHB 5GT3A 2AROD 2Y2GA 4Z2MG 2ZY3A 4XUJB 5B1MD 1P3GA 1P3MD 3AZND 1P3OB 5B31G 3AV2A 3UTBC 2JCHA 5B2JC 4NE3A 5AVBB 1M18C 2Y2QA 2F8NH 3WA9B 3H0LC 3MNNB 4YS3A 3LELA 1N1JB 3FDDA 5BS7C 5B40A 4Z66B 4J8VD 1AOIA 5GT0A 1TZYB 4ZUXB 5B0YA 3LELC 1ID3A 2J8PA 3NQJB 1ZLAA 3UT9A 3AZEB 5B40C 3KXBB 3UTAB 2BYKA 3MGSB 3AN2B 5AV9A 3RELB 3B6GD 4M6BA 5B0YC 5CPJC 1P3KB 3AFAA 4E44A 5DNNC 1P3FB 2L5AA 3LZ1A 3REID 5AVCA 4Z5TC 5GXQC 1W2EA 2HIOB 4CSRB 5AVBC 3VH6T 4AWLB 3MVDB 5B1MA 3X1UB 5G49A 2AROC 1P3MA 3LJAA 4Z66C 3AZJA 4X23B 4EO5C 3LZ0B 3WTPC 3X1SB 3REHD 3AZNC 3AN2C 5F99D 3MGSC 5B33D 4KUDD 4J8VA 4E45A 3AZKD 4J8VC 1P3PB 4JJND 5CPKB 5B32D 5B1LB 4WU9D 5BNXA 5B2IB 3KUYD 3X1TD 1U35D 3AV1D 1M1AC 2NQBA 3B6GC 5AV6B 3EPHA 3AZGA 4X23C 3REIC 4ZBJB 3WKJB 3NQUA 3REJD 1P34B 1P3LA 5AV5D 3REKD 2YFWA 4NE6A 3KWQD 1HTAA 5GSUD 1P3GD 3W96B 4CAYA 2Y2JA 5AV8D 2CV5B 4YM6B 3VH6W 2FJ7D 3B6FB 5B33A 5CPKC 4KUDA 5KDMA 3WTPE 3REHC 5BNVA 5F99C 3AZKA 1P3ID 1KX4A 2HUEB 5AV6C 4H9RB 5B0ZB 1P3AA 1HQ3D 4WJ3C 5B31D 5B32A 4ZBJC 3AZKC 3WKJC 2NZDC 4XZQC 3KUYA 3X1TA 4JJNC 3AV1A 4J8XB 3A6NB 3MGPB 3C1CB 4WU9C 4LD9B 1KX3C 3W96C 3AV1C 1U35C 1EQZB 3REJA 3AV2D 2CV5C 1S32D 3W99D 5AV5A 5AY8D 1P3BD 1H3OB 2YFVA 3WAAB 2F8NK 3KWQA 3TU4A 3VH5A 5GSUA 5AV5C 2VQRA 1BH8B 2DQNC 5E5AA 4KHAA 5AV8A 3AZFD 1BH9A 4H9QB 4DQYB 3REKC 3AZIC 5GT0D 4R8PD 1M18B 2HUEC 2FJ7A 2G5IC 5JRGA 5GSUC 1KX5C 3C1BA 1PZRA 4H9NA 3AFAD 3LELB 1HQ3A 1ULYA 1R4VA 2XD5A 5B40B 5B31A 3W97C 3KFUG 3W98C 4J8UC 5B24D 1P3IC 5B0YB 1TAFA 3UT9B 3AZMD 5CPJB 5DNNB 2BYKB 5CPIA 3WAAC 5CP6A 5GXQB 4Z5TB 5GT3C 3MGRD 3AZHD 3LJAD 1S32A 3AZJD 3R45B 4XUJD 3W99A 5AY8A 1P3BA 2PYOD 3AV2C 1S32C 3AYWA 2AROB 3AZFA 1P3OD 5AY8C 1P3BC 4QLCD 3V9RA 2F8NG 3EG5B 5B1MB 4EO5B 4YS3C 4R8PA 1BFMA 2CWEA 2G5HC 3H0RC 3WTPB 3AZNB 1AOIC 5GT0C 3AZLD 1ID3C 1ZLAC 3IP4C 3UT9C 3A1KA 4DRAA 2BYMB 5AV9C 2NQBD 3RELD 4J8VB 3H0MC 1Q9CA 5B24A 1F66D 3AFAC 3AZGD 1P3KD 3LZ1C 3AZMA 3X1VA 5AVCC 4H9OA 1P3LD 5B24C 3B0CT 3B0DC 2HIOD 1T3UA 1M1AB 3MGRA 3B6GB 3AZHA 4WNNA 4H9PB 2Y2MA 2UWXA 4XUJA 5B1MC 5BNXB 3REIB 3MVDD 3X1UD 1P3MC 2PYOA 3LJAC 3AZJC 1P3OA 4QLCA 2PYOC 2FFFB 5FUGA 1N1JA 5JA4A 1KX4D 4QLCC 2Y2IA 3AZLA 4ZUXA 4CAYB 2ZY4A 3NQJA 3REHB 2ZY2A 5F99B 3KXBA 3UTAA 3AZLC 3RELA 2IO5C 1F66A 1P3KA 1M19D 3AZKB 1P3FA 2NQBC 2NZDB 4XZQB 4JJNB 2HIOA 4CSRA 3VH5W 3AZGC 5B32B 4WU9B 1P3LC 3TU4D 1KX3B 1P34D 3MVDA 1U35B 3AV1B 5E5AD 3X1UA 2RIQA 5JRGD 4WU8D 4DRBA 3MGQD 1P3AD 3F6TA 3LZ0A 3B0CW 3C1BD 5AV5B 3X1SA 5BO0A 5B33C 3REKB 3AZIB 4KUDC 2YFVB 1P3GB 5GSUB 1KX5B 5AV8B 1BH9B 1KX4C 2FJ7B 2BG1A 2JSSA 2DF4C 1JFIA 5C3IB 5B32C 5CPID 2XD1A 5CHLB 5CP6D 4KGCD 3W97B 3B0BA 1M19A 3KUYC 4J8UB 3X1TC 2F8ND 4J8WD 5B2IA 3W98B 1P3IB 3O62D 3A1IA 3EPKA 4HGAC 1M19C 1KU5A 2ZY5A 4G92C 3REJC 1EQZD 5GT3B 3AYWD 1P34A 2LY8A 4G91C 1WWIA 3KWQC 3TU4C 1P3GC 4WU8A 3MGQA 5E5AC 5AV8C 3AV2B
chains in the Genus database with same CATH topology
5AY8B 3UTBD 1P3BB 5B2JD 4YM6A 2FJ7C 5JRGC 2W8SA 3B6FA 4WU8C 3MGQC 4YS3B 1P3AC 5C3IC 3C1BC 1AOIB 5GT0B 4R8PB 1ID3B 1ZLAB 3X1VD 1HQ3C 4H9RA 5B0ZA 5B31C 5DNMD 4UUZA 5AV9B 4KGCA 2Y2OA 4H9SA 2F8NA 4J8WA 1A7WA 3O62A 3AFAB 4J8XA 4UPKA 2Y2LA 3A6NA 5CPIC 3LZ1B 5DNND 5CP6C 3VH6A 4KGCC 5AVCB 4LD9A 5B24B 4J8WC 3B0DB 3O62C 1EQZA 4Z2MH 3W99C 1Z2CB 5AVBD 4H9OB 3WA9D 3MNND 5G49B 3AYWC 3AZFC 1P3MB 1WWSA 3LJAB 1BH8A 4WNNB 3AZJB 4Z66D 4H9QA 4R8PC 5B2JA 3UTBA 1M18A 1TZYD 1F1EA 4ZUXD 3VH5T 2PYOB 3WTPD 3AZED 3KXBD 3UTAD 3AN2D 3MGSD 4QLCB 5BS7A 5BT1D 5FUGB 1P3FD 5JA4B 5DNMA 3AZLB 2IO5B 3X1VC 3AZMC 5CPJA 5DNMC 5DNNA 2NQBB 3MGRC 3AZHC 1M1AD 4Z5TA 5GXQA 1F66B 3KSYA 3AZGB 4XUJC 2ZM5A 3R45A 5AVBA 4X23D 3NQUB 1P3LB 3LZ0D 3WA9A 3MNNA 3X1SD 1P3OC 2AROA 2YFWB 2RVQD 4Z66A 3WA9C 3MNNC 2F2AC 1TZYA 3WTPA 3AZEA 3AZNA 5B33B 1P3PD 3AN2A 3MGSA 4KUDB 5KDMB 5CPKD 1TZYC 4ZUXC 5B1LD 3AZEC 5BNVB 3KXBC 5BO0B 3UTAC 2BYMA 5B2ID 1KX4B 3RELC 1F66C 5AV6D 5BT1C 1P3KC 3AL0C 1P3FC 3WKJD 3KUYB 2Y2KA 3X1TB 4XZQD 2NZDD 2HIOC 1JFIB 3B6GA 1M1AA 4HGAB 2Y2HA 4AWLC 1M19B 4H9PA 4G92B 4X23A 3MVDC 1B6WA 1KX3D 3X1UC 3REIA 3REJB 3W96D 2CV5D 3EPLA 4G91B 4YM6D 3B6FD 3P5JB 3LZ0C 3KWQB 3TU4B 2Y2PA 5E5AB 4KHAB 3X1SC 3EPJA 2Y2NA 3AZID 5JRGB 2RVQC 1P3PA 5B0ZD 1B67A 4WU8B 3MGQB 5CPKA 1P3AB 1KX5D 3C1BB 5B1LA 3REHA 4NE5A 1P3PC 4H9NB 5F99A 4J8XD 3A6ND 5AV6A 1HQ3B 5B1LC 3MGPD 3C1CD 5B31B 4LD9D 3W97D 5B2IC 3W98D 4J8UD 3WKJA 1TAFB 2NZDA 4XZQA 4JJNA 4UUZB 5CPIB 1S32B 5CP6B 4KGCB 3WAAD 4WU9A 1P34C 2F8NB 4NFTA 5GT3D 4J8WB 1KX3A 3W96A 3O62B 1U35A 3W99B 2CV5A 1M18D 4WV4B 3AYWB 3AZFB 5B32G 4YM6C 3V9RB 3B6FC 3REKA 3AZIA 4YS3D 3LELD 5B40D 1KX5A 3UTBB 5B2JB 1AOID 1ID3D 4WZSB 5B0YD 5B0ZC 1ZLAD 3UT9D 5CPJD 2JE5A 3MGPA 3C1CA 5AV9D 4H9SC 3W97A 5GXQD 4Z5TD 3W98A 4J8UA 4J8XC 1P3IA 3A6NC 3X1VB 3AZMB 3LZ1D 3MGPC 3C1CC 5DNMB 1H3OA 5AVCD 4LD9C 3WAAA 1EQZC 3MGRB 3AZHB 5GT3A 2AROD 2Y2GA 4Z2MG 2ZY3A 4XUJB 5B1MD 1P3GA 1P3MD 3AZND 1P3OB 5B31G 3AV2A 3UTBC 2JCHA 5B2JC 4NE3A 5AVBB 1M18C 2Y2QA 2F8NH 3WA9B 3H0LC 3MNNB 4YS3A 3LELA 1N1JB 3FDDA 5BS7C 5B40A 4Z66B 4J8VD 1AOIA 5GT0A 1TZYB 4ZUXB 5B0YA 3LELC 1ID3A 2J8PA 3NQJB 1ZLAA 3UT9A 3AZEB 5B40C 3KXBB 3UTAB 2BYKA 3MGSB 3AN2B 5AV9A 3RELB 3B6GD 4M6BA 5B0YC 5CPJC 1P3KB 3AFAA 4E44A 5DNNC 1P3FB 2L5AA 3LZ1A 3REID 5AVCA 4Z5TC 5GXQC 1W2EA 2HIOB 4CSRB 5AVBC 3VH6T 4AWLB 3MVDB 5B1MA 3X1UB 5G49A 2AROC 1P3MA 3LJAA 4Z66C 3AZJA 4X23B 4EO5C 3LZ0B 3WTPC 3X1SB 3REHD 3AZNC 3AN2C 5F99D 3MGSC 5B33D 4KUDD 4J8VA 4E45A 3AZKD 4J8VC 1P3PB 4JJND 5CPKB 5B32D 5B1LB 4WU9D 5BNXA 5B2IB 3KUYD 3X1TD 1U35D 3AV1D 1M1AC 2NQBA 3B6GC 5AV6B 3EPHA 3AZGA 4X23C 3REIC 4ZBJB 3WKJB 3NQUA 3REJD 1P34B 1P3LA 5AV5D 3REKD 2YFWA 4NE6A 3KWQD 1HTAA 5GSUD 1P3GD 3W96B 4CAYA 2Y2JA 5AV8D 2CV5B 4YM6B 3VH6W 2FJ7D 3B6FB 5B33A 5CPKC 4KUDA 5KDMA 3WTPE 3REHC 5BNVA 5F99C 3AZKA 1P3ID 1KX4A 2HUEB 5AV6C 4H9RB 5B0ZB 1P3AA 1HQ3D 4WJ3C 5B31D 5B32A 4ZBJC 3AZKC 3WKJC 2NZDC 4XZQC 3KUYA 3X1TA 4JJNC 3AV1A 4J8XB 3A6NB 3MGPB 3C1CB 4WU9C 4LD9B 1KX3C 3W96C 3AV1C 1U35C 1EQZB 3REJA 3AV2D 2CV5C 1S32D 3W99D 5AV5A 5AY8D 1P3BD 1H3OB 2YFVA 3WAAB 2F8NK 3KWQA 3TU4A 3VH5A 5GSUA 5AV5C 2VQRA 1BH8B 2DQNC 5E5AA 4KHAA 5AV8A 3AZFD 1BH9A 4H9QB 4DQYB 3REKC 3AZIC 5GT0D 4R8PD 1M18B 2HUEC 2FJ7A 2G5IC 5JRGA 5GSUC 1KX5C 3C1BA 1PZRA 4H9NA 3AFAD 3LELB 1HQ3A 1ULYA 1R4VA 2XD5A 5B40B 5B31A 3W97C 3KFUG 3W98C 4J8UC 5B24D 1P3IC 5B0YB 1TAFA 3UT9B 3AZMD 5CPJB 5DNNB 2BYKB 5CPIA 3WAAC 5CP6A 5GXQB 4Z5TB 5GT3C 3MGRD 3AZHD 3LJAD 1S32A 3AZJD 3R45B 4XUJD 3W99A 5AY8A 1P3BA 2PYOD 3AV2C 1S32C 3AYWA 2AROB 3AZFA 1P3OD 5AY8C 1P3BC 4QLCD 3V9RA 2F8NG 3EG5B 5B1MB 4EO5B 4YS3C 4R8PA 1BFMA 2CWEA 2G5HC 3H0RC 3WTPB 3AZNB 1AOIC 5GT0C 3AZLD 1ID3C 1ZLAC 3IP4C 3UT9C 3A1KA 4DRAA 2BYMB 5AV9C 2NQBD 3RELD 4J8VB 3H0MC 1Q9CA 5B24A 1F66D 3AFAC 3AZGD 1P3KD 3LZ1C 3AZMA 3X1VA 5AVCC 4H9OA 1P3LD 5B24C 3B0CT 3B0DC 2HIOD 1T3UA 1M1AB 3MGRA 3B6GB 3AZHA 4WNNA 4H9PB 2Y2MA 2UWXA 4XUJA 5B1MC 5BNXB 3REIB 3MVDD 3X1UD 1P3MC 2PYOA 3LJAC 3AZJC 1P3OA 4QLCA 2PYOC 2FFFB 5FUGA 1N1JA 5JA4A 1KX4D 4QLCC 2Y2IA 3AZLA 4ZUXA 4CAYB 2ZY4A 3NQJA 3REHB 2ZY2A 5F99B 3KXBA 3UTAA 3AZLC 3RELA 2IO5C 1F66A 1P3KA 1M19D 3AZKB 1P3FA 2NQBC 2NZDB 4XZQB 4JJNB 2HIOA 4CSRA 3VH5W 3AZGC 5B32B 4WU9B 1P3LC 3TU4D 1KX3B 1P34D 3MVDA 1U35B 3AV1B 5E5AD 3X1UA 2RIQA 5JRGD 4WU8D 4DRBA 3MGQD 1P3AD 3F6TA 3LZ0A 3B0CW 3C1BD 5AV5B 3X1SA 5BO0A 5B33C 3REKB 3AZIB 4KUDC 2YFVB 1P3GB 5GSUB 1KX5B 5AV8B 1BH9B 1KX4C 2FJ7B 2BG1A 2JSSA 2DF4C 1JFIA 5C3IB 5B32C 5CPID 2XD1A 5CHLB 5CP6D 4KGCD 3W97B 3B0BA 1M19A 3KUYC 4J8UB 3X1TC 2F8ND 4J8WD 5B2IA 3W98B 1P3IB 3O62D 3A1IA 3EPKA 4HGAC 1M19C 1KU5A 2ZY5A 4G92C 3REJC 1EQZD 5GT3B 3AYWD 1P34A 2LY8A 4G91C 1WWIA 3KWQC 3TU4C 1P3GC 4WU8A 3MGQA 5E5AC 5AV8C 3AV2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AY8 B;  3UTB D;  1P3B B;  5B2J D;  4YM6 A;  2FJ7 C;  5JRG C;  3B6F A;  4WU8 C;  3MGQ C;  4YS3 B;  1P3A C;  5C3I C;  3C1B C;  1AOI B;  5GT0 B;  4R8P B;  1ID3 B;  1ZLA B;  3X1V D;  1HQ3 C;  4H9R A;  5B0Z A;  5B31 C;  5DNM D;  4UUZ A;  5AV9 B;  4KGC A;  4H9S A;  2F8N A;  4J8W A;  1A7W A;  3O62 A;  3AFA B;  4J8X A;  3A6N A;  5CPI C;  3LZ1 B;  5DNN D;  5CP6 C;  3VH6 A;  4KGC C;  5AVC B;  4LD9 A;  5B24 B;  4J8W C;  3B0D B;  3O62 C;  1EQZ A;  4Z2M H;  3W99 C;  5AVB D;  4H9O B;  3WA9 D;  3MNN D;  5G49 B;  3AYW C;  3AZF C;  1P3M B;  1WWS A;  3LJA B;  1BH8 A;  4WNN B;  3AZJ B;  4Z66 D;  4H9Q A;  4R8P C;  5B2J A;  3UTB A;  1M18 A;  1TZY D;  1F1E A;  4ZUX D;  3VH5 T;  2PYO B;  3WTP D;  3AZE D;  3KXB D;  3UTA D;  3AN2 D;  3MGS D;  4QLC B;  5BS7 A;  5BT1 D;  5FUG B;  1P3F D;  5JA4 B;  5DNM A;  3AZL B;  2IO5 B;  3X1V C;  3AZM C;  5CPJ A;  5DNM C;  5DNN A;  2NQB B;  3MGR C;  3AZH C;  1M1A D;  4Z5T A;  5GXQ A;  1F66 B;  3KSY A;  3AZG B;  4XUJ C;  3R45 A;  5AVB A;  4X23 D;  3NQU B;  1P3L B;  3LZ0 D;  3WA9 A;  3MNN A;  3X1S D;  1P3O C;  2ARO A;  2YFW B;  2RVQ D;  4Z66 A;  3WA9 C;  3MNN C;  1TZY A;  3WTP A;  3AZE A;  3AZN A;  5B33 B;  1P3P D;  3AN2 A;  3MGS A;  4KUD B;  5KDM B;  5CPK D;  1TZY C;  4ZUX C;  5B1L D;  3AZE C;  5BNV B;  3KXB C;  5BO0 B;  3UTA C;  2BYM A;  5B2I D;  1KX4 B;  3REL C;  1F66 C;  5AV6 D;  5BT1 C;  1P3K C;  1P3F C;  3WKJ D;  3KUY B;  3X1T B;  2NZD D;  4XZQ D;  2HIO C;  1JFI B;  3B6G A;  1M1A A;  4HGA B;  4AWL C;  1M19 B;  4H9P A;  4G92 B;  4X23 A;  3MVD C;  1B6W A;  1KX3 D;  3X1U C;  3REI A;  3REJ B;  3W96 D;  2CV5 D;  4G91 B;  4YM6 D;  3B6F D;  3LZ0 C;  3KWQ B;  3TU4 B;  5E5A B;  4KHA B;  3X1S C;  3AZI D;  5JRG B;  2RVQ C;  1P3P A;  5B0Z D;  1B67 A;  4WU8 B;  3MGQ B;  5CPK A;  1P3A B;  1KX5 D;  3C1B B;  5B1L A;  3REH A;  4NE5 A;  1P3P C;  4H9N B;  5F99 A;  4J8X D;  3A6N D;  5AV6 A;  1HQ3 B;  5B1L C;  3MGP D;  3C1C D;  5B31 B;  4LD9 D;  3W97 D;  5B2I C;  3W98 D;  4J8U D;  3WKJ A;  1TAF B;  2NZD A;  4XZQ A;  4JJN A;  4UUZ B;  5CPI B;  1S32 B;  5CP6 B;  4KGC B;  3WAA D;  4WU9 A;  1P34 C;  2F8N B;  4NFT A;  5GT3 D;  4J8W B;  1KX3 A;  3W96 A;  3O62 B;  1U35 A;  3W99 B;  2CV5 A;  1M18 D;  4WV4 B;  3AYW B;  3AZF B;  5B32 G;  4YM6 C;  3V9R B;  3B6F C;  3REK A;  3AZI A;  4YS3 D;  3LEL D;  5B40 D;  1KX5 A;  3UTB B;  5B2J B;  1AOI D;  1ID3 D;  4WZS B;  5B0Y D;  5B0Z C;  1ZLA D;  3UT9 D;  5CPJ D;  3MGP A;  3C1C A;  5AV9 D;  4H9S C;  3W97 A;  5GXQ D;  4Z5T D;  3W98 A;  4J8U A;  4J8X C;  1P3I A;  3A6N C;  3X1V B;  3AZM B;  3LZ1 D;  3MGP C;  3C1C C;  5DNM B;  1H3O A;  5AVC D;  4LD9 C;  3WAA A;  1EQZ C;  3MGR B;  3AZH B;  5GT3 A;  2ARO D;  4Z2M G;  4XUJ B;  5B1M D;  1P3M D;  3AZN D;  1P3O B;  5B31 G;  3AV2 A;  3UTB C;  5AVB B;  4NE3 A;  5B2J C;  2F8N H;  1M18 C;  3WA9 B;  3MNN B;  4YS3 A;  3LEL A;  1N1J B;  5BS7 C;  5B40 A;  4Z66 B;  4J8V D;  1AOI A;  5GT0 A;  1TZY B;  4ZUX B;  5B0Y A;  3LEL C;  1ID3 A;  3NQJ B;  1ZLA A;  3UT9 A;  3AZE B;  5B40 C;  3KXB B;  3UTA B;  2BYK A;  3MGS B;  3AN2 B;  5AV9 A;  3REL B;  3B6G D;  4M6B A;  5B0Y C;  5CPJ C;  1P3K B;  3AFA A;  4E44 A;  5DNN C;  1P3F B;  2L5A A;  3LZ1 A;  3REI D;  5AVC A;  4Z5T C;  5GXQ C;  2HIO B;  4CSR B;  5AVB C;  3VH6 T;  4AWL B;  3MVD B;  5B1M A;  3X1U B;  5G49 A;  2ARO C;  1P3M A;  3LJA A;  4Z66 C;  3AZJ A;  4X23 B;  4EO5 C;  3LZ0 B;  3WTP C;  3X1S B;  3REH D;  3AZN C;  3AN2 C;  5F99 D;  3MGS C;  5B33 D;  4KUD D;  4J8V A;  4E45 A;  3AZK D;  4J8V C;  1P3P B;  4JJN D;  5CPK B;  5B32 D;  5B1L B;  4WU9 D;  5BNX A;  5B2I B;  3KUY D;  3X1T D;  1U35 D;  3AV1 D;  1M1A C;  2NQB A;  3B6G C;  5AV6 B;  3AZG A;  4X23 C;  3REI C;  4ZBJ B;  3WKJ B;  3NQU A;  3REJ D;  1P34 B;  1P3L A;  5AV5 D;  3REK D;  2YFW A;  4NE6 A;  3KWQ D;  1HTA A;  5GSU D;  1P3G D;  3W96 B;  4CAY A;  5AV8 D;  2CV5 B;  4YM6 B;  3VH6 W;  2FJ7 D;  3B6F B;  5B33 A;  5CPK C;  4KUD A;  5KDM A;  3WTP E;  3REH C;  5BNV A;  5F99 C;  3AZK A;  1P3I D;  1KX4 A;  2HUE B;  5AV6 C;  4H9R B;  5B0Z B;  1P3A A;  1HQ3 D;  5B31 D;  5B32 A;  4ZBJ C;  3AZK C;  3WKJ C;  2NZD C;  4XZQ C;  3KUY A;  3X1T A;  4JJN C;  3AV1 A;  4J8X B;  3A6N B;  3MGP B;  3C1C B;  4WU9 C;  4LD9 B;  1KX3 C;  3W96 C;  3AV1 C;  1U35 C;  1EQZ B;  3REJ A;  3AV2 D;  2CV5 C;  1S32 D;  3W99 D;  5AV5 A;  5AY8 D;  1P3B D;  1H3O B;  2YFV A;  3WAA B;  2F8N K;  3KWQ A;  3TU4 A;  3VH5 A;  5AV5 C;  1BH8 B;  5GSU A;  3AZF D;  1P3G A;  5E5A A;  4KHA A;  5AV8 A;  1BH9 A;  4H9Q B;  3REK C;  3AZI C;  5GT0 D;  4R8P D;  1M18 B;  2HUE C;  2FJ7 A;  5JRG A;  5GSU C;  1KX5 C;  3C1B A;  4H9N A;  3AFA D;  3LEL B;  1HQ3 A;  1ULY A;  1R4V A;  5B40 B;  5B31 A;  3W97 C;  3W98 C;  4J8U C;  5B24 D;  1P3I C;  5B0Y B;  1TAF A;  3UT9 B;  3AZM D;  5CPJ B;  5DNN B;  2BYK B;  5CPI A;  3WAA C;  5CP6 A;  5GXQ B;  4Z5T B;  5GT3 C;  3MGR D;  3AZH D;  3LJA D;  1S32 A;  3AZJ D;  3R45 B;  4XUJ D;  3W99 A;  5AY8 A;  1P3B A;  2PYO D;  3AV2 C;  1S32 C;  3AYW A;  2ARO B;  3AZF A;  1P3O D;  5AY8 C;  1P3B C;  4QLC D;  3V9R A;  2F8N G;  5B1M B;  4EO5 B;  4YS3 C;  4R8P A;  1BFM A;  2CWE A;  3WTP B;  3AZN B;  1AOI C;  5GT0 C;  3AZL D;  1ID3 C;  1ZLA C;  3UT9 C;  4DRA A;  2BYM B;  5AV9 C;  2NQB D;  3REL D;  4J8V B;  5B24 A;  1Q9C A;  1F66 D;  3AFA C;  3AZG D;  1P3K D;  3LZ1 C;  3AZM A;  3X1V A;  5AVC C;  4H9O A;  1P3L D;  5B24 C;  3B0C T;  3B0D C;  2HIO D;  1M1A B;  3B6G B;  3MGR A;  3AZH A;  4WNN A;  4H9P B;  4XUJ A;  5BNX B;  5B1M C;  3REI B;  3MVD D;  3X1U D;  1P3M C;  2PYO A;  3LJA C;  3AZJ C;  1P3O A;  4QLC A;  2PYO C;  5FUG A;  1N1J A;  5JA4 A;  1KX4 D;  4QLC C;  3AZL A;  4ZUX A;  4CAY B;  3NQJ A;  3REH B;  5F99 B;  3KXB A;  3UTA A;  3AZL C;  3REL A;  2IO5 C;  1F66 A;  1P3K A;  1M19 D;  3AZK B;  1P3F A;  2NQB C;  2NZD B;  4XZQ B;  4JJN B;  2HIO A;  4CSR A;  3VH5 W;  3AZG C;  5B32 B;  4WU9 B;  1P3L C;  3TU4 D;  1KX3 B;  1P34 D;  3MVD A;  1U35 B;  3AV1 B;  5E5A D;  3X1U A;  5JRG D;  4WU8 D;  4DRB A;  3MGQ D;  1P3A D;  3LZ0 A;  3B0C W;  3C1B D;  5AV5 B;  3X1S A;  5BO0 A;  5B33 C;  3REK B;  3AZI B;  4KUD C;  2YFV B;  1P3G B;  5GSU B;  1KX5 B;  5AV8 B;  1BH9 B;  1KX4 C;  2FJ7 B;  2JSS A;  1JFI A;  5C3I B;  5B32 C;  5CPI D;  5CHL B;  5CP6 D;  4KGC D;  3W97 B;  3B0B A;  1M19 A;  3KUY C;  4J8U B;  3X1T C;  2F8N D;  4J8W D;  5B2I A;  3W98 B;  1P3I B;  3O62 D;  4HGA C;  1M19 C;  1KU5 A;  4G92 C;  3REJ C;  1EQZ D;  5GT3 B;  3AYW D;  1P34 A;  2LY8 A;  4G91 C;  1WWI A;  3KWQ C;  3TU4 C;  1P3G C;  4WU8 A;  3MGQ A;  5E5A C;  5AV8 C;  3AV2 B; 
#chains in the Genus database with same CATH topology
 5AY8 B;  3UTB D;  1P3B B;  5B2J D;  4YM6 A;  2FJ7 C;  5JRG C;  2W8S A;  3B6F A;  4WU8 C;  3MGQ C;  4YS3 B;  1P3A C;  5C3I C;  3C1B C;  1AOI B;  5GT0 B;  4R8P B;  1ID3 B;  1ZLA B;  3X1V D;  1HQ3 C;  4H9R A;  5B0Z A;  5B31 C;  5DNM D;  4UUZ A;  5AV9 B;  4KGC A;  2Y2O A;  4H9S A;  2F8N A;  4J8W A;  1A7W A;  3O62 A;  3AFA B;  4J8X A;  4UPK A;  2Y2L A;  3A6N A;  5CPI C;  3LZ1 B;  5DNN D;  5CP6 C;  3VH6 A;  4KGC C;  5AVC B;  4LD9 A;  5B24 B;  4J8W C;  3B0D B;  3O62 C;  1EQZ A;  4Z2M H;  3W99 C;  1Z2C B;  5AVB D;  4H9O B;  3WA9 D;  3MNN D;  5G49 B;  3AYW C;  3AZF C;  1P3M B;  1WWS A;  3LJA B;  1BH8 A;  4WNN B;  3AZJ B;  4Z66 D;  4H9Q A;  4R8P C;  5B2J A;  3UTB A;  1M18 A;  1TZY D;  1F1E A;  4ZUX D;  3VH5 T;  2PYO B;  3WTP D;  3AZE D;  3KXB D;  3UTA D;  3AN2 D;  3MGS D;  4QLC B;  5BS7 A;  5BT1 D;  5FUG B;  1P3F D;  5JA4 B;  5DNM A;  3AZL B;  2IO5 B;  3X1V C;  3AZM C;  5CPJ A;  5DNM C;  5DNN A;  2NQB B;  3MGR C;  3AZH C;  1M1A D;  4Z5T A;  5GXQ A;  1F66 B;  3KSY A;  3AZG B;  4XUJ C;  2ZM5 A;  3R45 A;  5AVB A;  4X23 D;  3NQU B;  1P3L B;  3LZ0 D;  3WA9 A;  3MNN A;  3X1S D;  1P3O C;  2ARO A;  2YFW B;  2RVQ D;  4Z66 A;  3WA9 C;  3MNN C;  2F2A C;  1TZY A;  3WTP A;  3AZE A;  3AZN A;  5B33 B;  1P3P D;  3AN2 A;  3MGS A;  4KUD B;  5KDM B;  5CPK D;  1TZY C;  4ZUX C;  5B1L D;  3AZE C;  5BNV B;  3KXB C;  5BO0 B;  3UTA C;  2BYM A;  5B2I D;  1KX4 B;  3REL C;  1F66 C;  5AV6 D;  5BT1 C;  1P3K C;  3AL0 C;  1P3F C;  3WKJ D;  3KUY B;  2Y2K A;  3X1T B;  4XZQ D;  2NZD D;  2HIO C;  1JFI B;  3B6G A;  1M1A A;  4HGA B;  2Y2H A;  4AWL C;  1M19 B;  4H9P A;  4G92 B;  4X23 A;  3MVD C;  1B6W A;  1KX3 D;  3X1U C;  3REI A;  3REJ B;  3W96 D;  2CV5 D;  3EPL A;  4G91 B;  4YM6 D;  3B6F D;  3P5J B;  3LZ0 C;  3KWQ B;  3TU4 B;  2Y2P A;  5E5A B;  4KHA B;  3X1S C;  3EPJ A;  2Y2N A;  3AZI D;  5JRG B;  2RVQ C;  1P3P A;  5B0Z D;  1B67 A;  4WU8 B;  3MGQ B;  5CPK A;  1P3A B;  1KX5 D;  3C1B B;  5B1L A;  3REH A;  4NE5 A;  1P3P C;  4H9N B;  5F99 A;  4J8X D;  3A6N D;  5AV6 A;  1HQ3 B;  5B1L C;  3MGP D;  3C1C D;  5B31 B;  4LD9 D;  3W97 D;  5B2I C;  3W98 D;  4J8U D;  3WKJ A;  1TAF B;  2NZD A;  4XZQ A;  4JJN A;  4UUZ B;  5CPI B;  1S32 B;  5CP6 B;  4KGC B;  3WAA D;  4WU9 A;  1P34 C;  2F8N B;  4NFT A;  5GT3 D;  4J8W B;  1KX3 A;  3W96 A;  3O62 B;  1U35 A;  3W99 B;  2CV5 A;  1M18 D;  4WV4 B;  3AYW B;  3AZF B;  5B32 G;  4YM6 C;  3V9R B;  3B6F C;  3REK A;  3AZI A;  4YS3 D;  3LEL D;  5B40 D;  1KX5 A;  3UTB B;  5B2J B;  1AOI D;  1ID3 D;  4WZS B;  5B0Y D;  5B0Z C;  1ZLA D;  3UT9 D;  5CPJ D;  2JE5 A;  3MGP A;  3C1C A;  5AV9 D;  4H9S C;  3W97 A;  5GXQ D;  4Z5T D;  3W98 A;  4J8U A;  4J8X C;  1P3I A;  3A6N C;  3X1V B;  3AZM B;  3LZ1 D;  3MGP C;  3C1C C;  5DNM B;  1H3O A;  5AVC D;  4LD9 C;  3WAA A;  1EQZ C;  3MGR B;  3AZH B;  5GT3 A;  2ARO D;  2Y2G A;  4Z2M G;  2ZY3 A;  4XUJ B;  5B1M D;  1P3G A;  1P3M D;  3AZN D;  1P3O B;  5B31 G;  3AV2 A;  3UTB C;  2JCH A;  5B2J C;  4NE3 A;  5AVB B;  1M18 C;  2Y2Q A;  2F8N H;  3WA9 B;  3H0L C;  3MNN B;  4YS3 A;  3LEL A;  1N1J B;  3FDD A;  5BS7 C;  5B40 A;  4Z66 B;  4J8V D;  1AOI A;  5GT0 A;  1TZY B;  4ZUX B;  5B0Y A;  3LEL C;  1ID3 A;  2J8P A;  3NQJ B;  1ZLA A;  3UT9 A;  3AZE B;  5B40 C;  3KXB B;  3UTA B;  2BYK A;  3MGS B;  3AN2 B;  5AV9 A;  3REL B;  3B6G D;  4M6B A;  5B0Y C;  5CPJ C;  1P3K B;  3AFA A;  4E44 A;  5DNN C;  1P3F B;  2L5A A;  3LZ1 A;  3REI D;  5AVC A;  4Z5T C;  5GXQ C;  1W2E A;  2HIO B;  4CSR B;  5AVB C;  3VH6 T;  4AWL B;  3MVD B;  5B1M A;  3X1U B;  5G49 A;  2ARO C;  1P3M A;  3LJA A;  4Z66 C;  3AZJ A;  4X23 B;  4EO5 C;  3LZ0 B;  3WTP C;  3X1S B;  3REH D;  3AZN C;  3AN2 C;  5F99 D;  3MGS C;  5B33 D;  4KUD D;  4J8V A;  4E45 A;  3AZK D;  4J8V C;  1P3P B;  4JJN D;  5CPK B;  5B32 D;  5B1L B;  4WU9 D;  5BNX A;  5B2I B;  3KUY D;  3X1T D;  1U35 D;  3AV1 D;  1M1A C;  2NQB A;  3B6G C;  5AV6 B;  3EPH A;  3AZG A;  4X23 C;  3REI C;  4ZBJ B;  3WKJ B;  3NQU A;  3REJ D;  1P34 B;  1P3L A;  5AV5 D;  3REK D;  2YFW A;  4NE6 A;  3KWQ D;  1HTA A;  5GSU D;  1P3G D;  3W96 B;  4CAY A;  2Y2J A;  5AV8 D;  2CV5 B;  4YM6 B;  3VH6 W;  2FJ7 D;  3B6F B;  5B33 A;  5CPK C;  4KUD A;  5KDM A;  3WTP E;  3REH C;  5BNV A;  5F99 C;  3AZK A;  1P3I D;  1KX4 A;  2HUE B;  5AV6 C;  4H9R B;  5B0Z B;  1P3A A;  1HQ3 D;  4WJ3 C;  5B31 D;  5B32 A;  4ZBJ C;  3AZK C;  3WKJ C;  2NZD C;  4XZQ C;  3KUY A;  3X1T A;  4JJN C;  3AV1 A;  4J8X B;  3A6N B;  3MGP B;  3C1C B;  4WU9 C;  4LD9 B;  1KX3 C;  3W96 C;  3AV1 C;  1U35 C;  1EQZ B;  3REJ A;  3AV2 D;  2CV5 C;  1S32 D;  3W99 D;  5AV5 A;  5AY8 D;  1P3B D;  1H3O B;  2YFV A;  3WAA B;  2F8N K;  3KWQ A;  3TU4 A;  3VH5 A;  5GSU A;  5AV5 C;  2VQR A;  1BH8 B;  2DQN C;  5E5A A;  4KHA A;  5AV8 A;  3AZF D;  1BH9 A;  4H9Q B;  4DQY B;  3REK C;  3AZI C;  5GT0 D;  4R8P D;  1M18 B;  2HUE C;  2FJ7 A;  2G5I C;  5JRG A;  5GSU C;  1KX5 C;  3C1B A;  1PZR A;  4H9N A;  3AFA D;  3LEL B;  1HQ3 A;  1ULY A;  1R4V A;  2XD5 A;  5B40 B;  5B31 A;  3W97 C;  3KFU G;  3W98 C;  4J8U C;  5B24 D;  1P3I C;  5B0Y B;  1TAF A;  3UT9 B;  3AZM D;  5CPJ B;  5DNN B;  2BYK B;  5CPI A;  3WAA C;  5CP6 A;  5GXQ B;  4Z5T B;  5GT3 C;  3MGR D;  3AZH D;  3LJA D;  1S32 A;  3AZJ D;  3R45 B;  4XUJ D;  3W99 A;  5AY8 A;  1P3B A;  2PYO D;  3AV2 C;  1S32 C;  3AYW A;  2ARO B;  3AZF A;  1P3O D;  5AY8 C;  1P3B C;  4QLC D;  3V9R A;  2F8N G;  3EG5 B;  5B1M B;  4EO5 B;  4YS3 C;  4R8P A;  1BFM A;  2CWE A;  2G5H C;  3H0R C;  3WTP B;  3AZN B;  1AOI C;  5GT0 C;  3AZL D;  1ID3 C;  1ZLA C;  3IP4 C;  3UT9 C;  3A1K A;  4DRA A;  2BYM B;  5AV9 C;  2NQB D;  3REL D;  4J8V B;  3H0M C;  1Q9C A;  5B24 A;  1F66 D;  3AFA C;  3AZG D;  1P3K D;  3LZ1 C;  3AZM A;  3X1V A;  5AVC C;  4H9O A;  1P3L D;  5B24 C;  3B0C T;  3B0D C;  2HIO D;  1T3U A;  1M1A B;  3MGR A;  3B6G B;  3AZH A;  4WNN A;  4H9P B;  2Y2M A;  2UWX A;  4XUJ A;  5B1M C;  5BNX B;  3REI B;  3MVD D;  3X1U D;  1P3M C;  2PYO A;  3LJA C;  3AZJ C;  1P3O A;  4QLC A;  2PYO C;  2FFF B;  5FUG A;  1N1J A;  5JA4 A;  1KX4 D;  4QLC C;  2Y2I A;  3AZL A;  4ZUX A;  4CAY B;  2ZY4 A;  3NQJ A;  3REH B;  2ZY2 A;  5F99 B;  3KXB A;  3UTA A;  3AZL C;  3REL A;  2IO5 C;  1F66 A;  1P3K A;  1M19 D;  3AZK B;  1P3F A;  2NQB C;  2NZD B;  4XZQ B;  4JJN B;  2HIO A;  4CSR A;  3VH5 W;  3AZG C;  5B32 B;  4WU9 B;  1P3L C;  3TU4 D;  1KX3 B;  1P34 D;  3MVD A;  1U35 B;  3AV1 B;  5E5A D;  3X1U A;  2RIQ A;  5JRG D;  4WU8 D;  4DRB A;  3MGQ D;  1P3A D;  3F6T A;  3LZ0 A;  3B0C W;  3C1B D;  5AV5 B;  3X1S A;  5BO0 A;  5B33 C;  3REK B;  3AZI B;  4KUD C;  2YFV B;  1P3G B;  5GSU B;  1KX5 B;  5AV8 B;  1BH9 B;  1KX4 C;  2FJ7 B;  2BG1 A;  2JSS A;  2DF4 C;  1JFI A;  5C3I B;  5B32 C;  5CPI D;  2XD1 A;  5CHL B;  5CP6 D;  4KGC D;  3W97 B;  3B0B A;  1M19 A;  3KUY C;  4J8U B;  3X1T C;  2F8N D;  4J8W D;  5B2I A;  3W98 B;  1P3I B;  3O62 D;  3A1I A;  3EPK A;  4HGA C;  1M19 C;  1KU5 A;  2ZY5 A;  4G92 C;  3REJ C;  1EQZ D;  5GT3 B;  3AYW D;  1P34 A;  2LY8 A;  4G91 C;  1WWI A;  3KWQ C;  3TU4 C;  1P3G C;  4WU8 A;  3MGQ A;  5E5A C;  5AV8 C;  3AV2 B; 
#chains in the Genus database with same CATH homology
 5AY8 B;  3UTB D;  1P3B B;  5B2J D;  4YM6 A;  2FJ7 C;  5JRG C;  2W8S A;  3B6F A;  4WU8 C;  3MGQ C;  4YS3 B;  1P3A C;  5C3I C;  3C1B C;  1AOI B;  5GT0 B;  4R8P B;  1ID3 B;  1ZLA B;  3X1V D;  1HQ3 C;  4H9R A;  5B0Z A;  5B31 C;  5DNM D;  4UUZ A;  5AV9 B;  4KGC A;  2Y2O A;  4H9S A;  2F8N A;  4J8W A;  1A7W A;  3O62 A;  3AFA B;  4J8X A;  4UPK A;  2Y2L A;  3A6N A;  5CPI C;  3LZ1 B;  5DNN D;  5CP6 C;  3VH6 A;  4KGC C;  5AVC B;  4LD9 A;  5B24 B;  4J8W C;  3B0D B;  3O62 C;  1EQZ A;  4Z2M H;  3W99 C;  1Z2C B;  5AVB D;  4H9O B;  3WA9 D;  3MNN D;  5G49 B;  3AYW C;  3AZF C;  1P3M B;  1WWS A;  3LJA B;  1BH8 A;  4WNN B;  3AZJ B;  4Z66 D;  4H9Q A;  4R8P C;  5B2J A;  3UTB A;  1M18 A;  1TZY D;  1F1E A;  4ZUX D;  3VH5 T;  2PYO B;  3WTP D;  3AZE D;  3KXB D;  3UTA D;  3AN2 D;  3MGS D;  4QLC B;  5BS7 A;  5BT1 D;  5FUG B;  1P3F D;  5JA4 B;  5DNM A;  3AZL B;  2IO5 B;  3X1V C;  3AZM C;  5CPJ A;  5DNM C;  5DNN A;  2NQB B;  3MGR C;  3AZH C;  1M1A D;  4Z5T A;  5GXQ A;  1F66 B;  3KSY A;  3AZG B;  4XUJ C;  2ZM5 A;  3R45 A;  5AVB A;  4X23 D;  3NQU B;  1P3L B;  3LZ0 D;  3WA9 A;  3MNN A;  3X1S D;  1P3O C;  2ARO A;  2YFW B;  2RVQ D;  4Z66 A;  3WA9 C;  3MNN C;  2F2A C;  1TZY A;  3WTP A;  3AZE A;  3AZN A;  5B33 B;  1P3P D;  3AN2 A;  3MGS A;  4KUD B;  5KDM B;  5CPK D;  1TZY C;  4ZUX C;  5B1L D;  3AZE C;  5BNV B;  3KXB C;  5BO0 B;  3UTA C;  2BYM A;  5B2I D;  1KX4 B;  3REL C;  1F66 C;  5AV6 D;  5BT1 C;  1P3K C;  3AL0 C;  1P3F C;  3WKJ D;  3KUY B;  2Y2K A;  3X1T B;  4XZQ D;  2NZD D;  2HIO C;  1JFI B;  3B6G A;  1M1A A;  4HGA B;  2Y2H A;  4AWL C;  1M19 B;  4H9P A;  4G92 B;  4X23 A;  3MVD C;  1B6W A;  1KX3 D;  3X1U C;  3REI A;  3REJ B;  3W96 D;  2CV5 D;  3EPL A;  4G91 B;  4YM6 D;  3B6F D;  3P5J B;  3LZ0 C;  3KWQ B;  3TU4 B;  2Y2P A;  5E5A B;  4KHA B;  3X1S C;  3EPJ A;  2Y2N A;  3AZI D;  5JRG B;  2RVQ C;  1P3P A;  5B0Z D;  1B67 A;  4WU8 B;  3MGQ B;  5CPK A;  1P3A B;  1KX5 D;  3C1B B;  5B1L A;  3REH A;  4NE5 A;  1P3P C;  4H9N B;  5F99 A;  4J8X D;  3A6N D;  5AV6 A;  1HQ3 B;  5B1L C;  3MGP D;  3C1C D;  5B31 B;  4LD9 D;  3W97 D;  5B2I C;  3W98 D;  4J8U D;  3WKJ A;  1TAF B;  2NZD A;  4XZQ A;  4JJN A;  4UUZ B;  5CPI B;  1S32 B;  5CP6 B;  4KGC B;  3WAA D;  4WU9 A;  1P34 C;  2F8N B;  4NFT A;  5GT3 D;  4J8W B;  1KX3 A;  3W96 A;  3O62 B;  1U35 A;  3W99 B;  2CV5 A;  1M18 D;  4WV4 B;  3AYW B;  3AZF B;  5B32 G;  4YM6 C;  3V9R B;  3B6F C;  3REK A;  3AZI A;  4YS3 D;  3LEL D;  5B40 D;  1KX5 A;  3UTB B;  5B2J B;  1AOI D;  1ID3 D;  4WZS B;  5B0Y D;  5B0Z C;  1ZLA D;  3UT9 D;  5CPJ D;  2JE5 A;  3MGP A;  3C1C A;  5AV9 D;  4H9S C;  3W97 A;  5GXQ D;  4Z5T D;  3W98 A;  4J8U A;  4J8X C;  1P3I A;  3A6N C;  3X1V B;  3AZM B;  3LZ1 D;  3MGP C;  3C1C C;  5DNM B;  1H3O A;  5AVC D;  4LD9 C;  3WAA A;  1EQZ C;  3MGR B;  3AZH B;  5GT3 A;  2ARO D;  2Y2G A;  4Z2M G;  2ZY3 A;  4XUJ B;  5B1M D;  1P3G A;  1P3M D;  3AZN D;  1P3O B;  5B31 G;  3AV2 A;  3UTB C;  2JCH A;  5B2J C;  4NE3 A;  5AVB B;  1M18 C;  2Y2Q A;  2F8N H;  3WA9 B;  3H0L C;  3MNN B;  4YS3 A;  3LEL A;  1N1J B;  3FDD A;  5BS7 C;  5B40 A;  4Z66 B;  4J8V D;  1AOI A;  5GT0 A;  1TZY B;  4ZUX B;  5B0Y A;  3LEL C;  1ID3 A;  2J8P A;  3NQJ B;  1ZLA A;  3UT9 A;  3AZE B;  5B40 C;  3KXB B;  3UTA B;  2BYK A;  3MGS B;  3AN2 B;  5AV9 A;  3REL B;  3B6G D;  4M6B A;  5B0Y C;  5CPJ C;  1P3K B;  3AFA A;  4E44 A;  5DNN C;  1P3F B;  2L5A A;  3LZ1 A;  3REI D;  5AVC A;  4Z5T C;  5GXQ C;  1W2E A;  2HIO B;  4CSR B;  5AVB C;  3VH6 T;  4AWL B;  3MVD B;  5B1M A;  3X1U B;  5G49 A;  2ARO C;  1P3M A;  3LJA A;  4Z66 C;  3AZJ A;  4X23 B;  4EO5 C;  3LZ0 B;  3WTP C;  3X1S B;  3REH D;  3AZN C;  3AN2 C;  5F99 D;  3MGS C;  5B33 D;  4KUD D;  4J8V A;  4E45 A;  3AZK D;  4J8V C;  1P3P B;  4JJN D;  5CPK B;  5B32 D;  5B1L B;  4WU9 D;  5BNX A;  5B2I B;  3KUY D;  3X1T D;  1U35 D;  3AV1 D;  1M1A C;  2NQB A;  3B6G C;  5AV6 B;  3EPH A;  3AZG A;  4X23 C;  3REI C;  4ZBJ B;  3WKJ B;  3NQU A;  3REJ D;  1P34 B;  1P3L A;  5AV5 D;  3REK D;  2YFW A;  4NE6 A;  3KWQ D;  1HTA A;  5GSU D;  1P3G D;  3W96 B;  4CAY A;  2Y2J A;  5AV8 D;  2CV5 B;  4YM6 B;  3VH6 W;  2FJ7 D;  3B6F B;  5B33 A;  5CPK C;  4KUD A;  5KDM A;  3WTP E;  3REH C;  5BNV A;  5F99 C;  3AZK A;  1P3I D;  1KX4 A;  2HUE B;  5AV6 C;  4H9R B;  5B0Z B;  1P3A A;  1HQ3 D;  4WJ3 C;  5B31 D;  5B32 A;  4ZBJ C;  3AZK C;  3WKJ C;  2NZD C;  4XZQ C;  3KUY A;  3X1T A;  4JJN C;  3AV1 A;  4J8X B;  3A6N B;  3MGP B;  3C1C B;  4WU9 C;  4LD9 B;  1KX3 C;  3W96 C;  3AV1 C;  1U35 C;  1EQZ B;  3REJ A;  3AV2 D;  2CV5 C;  1S32 D;  3W99 D;  5AV5 A;  5AY8 D;  1P3B D;  1H3O B;  2YFV A;  3WAA B;  2F8N K;  3KWQ A;  3TU4 A;  3VH5 A;  5GSU A;  5AV5 C;  2VQR A;  1BH8 B;  2DQN C;  5E5A A;  4KHA A;  5AV8 A;  3AZF D;  1BH9 A;  4H9Q B;  4DQY B;  3REK C;  3AZI C;  5GT0 D;  4R8P D;  1M18 B;  2HUE C;  2FJ7 A;  2G5I C;  5JRG A;  5GSU C;  1KX5 C;  3C1B A;  1PZR A;  4H9N A;  3AFA D;  3LEL B;  1HQ3 A;  1ULY A;  1R4V A;  2XD5 A;  5B40 B;  5B31 A;  3W97 C;  3KFU G;  3W98 C;  4J8U C;  5B24 D;  1P3I C;  5B0Y B;  1TAF A;  3UT9 B;  3AZM D;  5CPJ B;  5DNN B;  2BYK B;  5CPI A;  3WAA C;  5CP6 A;  5GXQ B;  4Z5T B;  5GT3 C;  3MGR D;  3AZH D;  3LJA D;  1S32 A;  3AZJ D;  3R45 B;  4XUJ D;  3W99 A;  5AY8 A;  1P3B A;  2PYO D;  3AV2 C;  1S32 C;  3AYW A;  2ARO B;  3AZF A;  1P3O D;  5AY8 C;  1P3B C;  4QLC D;  3V9R A;  2F8N G;  3EG5 B;  5B1M B;  4EO5 B;  4YS3 C;  4R8P A;  1BFM A;  2CWE A;  2G5H C;  3H0R C;  3WTP B;  3AZN B;  1AOI C;  5GT0 C;  3AZL D;  1ID3 C;  1ZLA C;  3IP4 C;  3UT9 C;  3A1K A;  4DRA A;  2BYM B;  5AV9 C;  2NQB D;  3REL D;  4J8V B;  3H0M C;  1Q9C A;  5B24 A;  1F66 D;  3AFA C;  3AZG D;  1P3K D;  3LZ1 C;  3AZM A;  3X1V A;  5AVC C;  4H9O A;  1P3L D;  5B24 C;  3B0C T;  3B0D C;  2HIO D;  1T3U A;  1M1A B;  3MGR A;  3B6G B;  3AZH A;  4WNN A;  4H9P B;  2Y2M A;  2UWX A;  4XUJ A;  5B1M C;  5BNX B;  3REI B;  3MVD D;  3X1U D;  1P3M C;  2PYO A;  3LJA C;  3AZJ C;  1P3O A;  4QLC A;  2PYO C;  2FFF B;  5FUG A;  1N1J A;  5JA4 A;  1KX4 D;  4QLC C;  2Y2I A;  3AZL A;  4ZUX A;  4CAY B;  2ZY4 A;  3NQJ A;  3REH B;  2ZY2 A;  5F99 B;  3KXB A;  3UTA A;  3AZL C;  3REL A;  2IO5 C;  1F66 A;  1P3K A;  1M19 D;  3AZK B;  1P3F A;  2NQB C;  2NZD B;  4XZQ B;  4JJN B;  2HIO A;  4CSR A;  3VH5 W;  3AZG C;  5B32 B;  4WU9 B;  1P3L C;  3TU4 D;  1KX3 B;  1P34 D;  3MVD A;  1U35 B;  3AV1 B;  5E5A D;  3X1U A;  2RIQ A;  5JRG D;  4WU8 D;  4DRB A;  3MGQ D;  1P3A D;  3F6T A;  3LZ0 A;  3B0C W;  3C1B D;  5AV5 B;  3X1S A;  5BO0 A;  5B33 C;  3REK B;  3AZI B;  4KUD C;  2YFV B;  1P3G B;  5GSU B;  1KX5 B;  5AV8 B;  1BH9 B;  1KX4 C;  2FJ7 B;  2BG1 A;  2JSS A;  2DF4 C;  1JFI A;  5C3I B;  5B32 C;  5CPI D;  2XD1 A;  5CHL B;  5CP6 D;  4KGC D;  3W97 B;  3B0B A;  1M19 A;  3KUY C;  4J8U B;  3X1T C;  2F8N D;  4J8W D;  5B2I A;  3W98 B;  1P3I B;  3O62 D;  3A1I A;  3EPK A;  4HGA C;  1M19 C;  1KU5 A;  2ZY5 A;  4G92 C;  3REJ C;  1EQZ D;  5GT3 B;  3AYW D;  1P34 A;  2LY8 A;  4G91 C;  1WWI A;  3KWQ C;  3TU4 C;  1P3G C;  4WU8 A;  3MGQ A;  5E5A C;  5AV8 C;  3AV2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...