5E5AA

Crystal structure of the chromatin-tethering domain of human cytomegalovirus ie1 protein bound to the nucleosome core particle
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
99
structure length
99
Chain Sequence
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human cytomegalovirus IE1 protein alters the higher-order chromatin structure by targeting the acidic patch of the nucleosome
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/viral protein/dna
molecule keywords DNA (146-MER)
total genus 30
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5e5aA00
4G92B 3R45B 4WU9C 3X1TC 3REJA 3W96C 5CPJD 5GT0D 4R8PD 3W98A 5B31G 1AOIB 5E5AB 3B6FA 1P3KD 4HGAB 3TU4D 3AV2D 3KUYD 4WU9D 2CV5B 5CPIA 2PYOB 4WU9B 3C1CA 3AN2D 5B0YB 4J8UD 4EO5C 5JA4B 3AZNA 3REJD 1KX4C 4J8XD 3NQUA 3AV1C 5F99C 1KX5C 4H9OA 1P3FB 3WKJD 4ZUXB 3X1SA 4WU9A 1F66D 4XUJC 5DNNB 3WA9C 5AV8A 4JJNC 1TAFB 3X1VA 5CPKA 3AZMD 3REHA 1M19B 3AZKA 4M6BA 2FJ7B 5AV6C 1BH8A 3RELD 4KGCC 3UTAD 4G91C 4H9QA 3X1SD 2NZDA 1AOIA 3AZJC 5B32B 3AZLD 3RELC 1M18A 1P3GB 5GXQA 4ZUXC 3MVDD 1U35B 3AYWC 5GT0A 5B2IB 4R8PA 3MVDB 1P3AA 2PYOA 4KGCA 3AFAC 5B33D 3WTPD 3W97D 3UTBD 3MGPC 3KWQC 3AFAA 3C1CB 3KSYA 3AV1B 5AVBB 3C1BC 5KDMA 4WU8C 3B6FD 3AZGA 5JRGC 3RELA 1M18C 5B0ZB 1EQZC 5B0ZD 3LZ1C 4Z66A 3MGSC 4ZBJC 3KXBD 4J8UA 1BH9A 3AZKB 5BO0A 3A6NC 2CV5D 5BT1D 3RELB 2BYMA 3WAAC 5B31C 1P34B 3A6NA 3MGQD 1WWSA 3W98D 3X1UB 4XZQC 5B32D 4J8WA 2F8NG 4DRBA 3MGPB 1P3LD 3X1TD 3LZ0C 5CHLB 4LD9B 3AYWB 3AZGD 2PYOC 3WAAD 5B1MA 1P3MC 1P3GC 1U35C 4Z5TB 5B2IA 1P3AB 2RVQC 1ID3D 3MGRD 5AVCC 4XZQB 2RVQD 5AV8C 5DNMD 5B40D 2IO5C 3MNNC 3UT9C 1P3FC 3VH6T 3MNND 5AV9D 5AV5A 1KX3B 3AZFA 1BFMA 1P34C 3REKA 1KX4D 3WTPC 1BH9B 4NE5A 3X1TA 1M19C 3UTBA 2HUEC 5B1LD 4Z66B 3TU4A 2NQBC 3AZKC 5C3IB 4J8UB 5DNNC 2HIOA 3AN2B 1KX3A 3WA9A 2YFVA 5CP6D 3AZFC 3AZJD 5GT3D 3KXBC 5AVBD 4YS3D 3B6FB 3X1TB 4QLCD 1HQ3C 3V9RB 4YS3C 1EQZD 5AV9C 5B2IC 4E44A 1F66B 5AVCA 5GXQD 5CP6C 4WU8A 2JSSA 2HIOD 4LD9A 4AWLC 3AZND 3AZKD 1ID3C 3O62D 1TZYD 3AFAD 3LZ1D 2HUEB 5B0ZC 5B1MD 2NQBB 5DNNA 3NQJA 5GXQC 3X1SB 5AV5D 4WU8B 2PYOD 4KUDC 5GSUD 5AV5B 5CP6A 4WU8D 5F99D 4H9RB 5FUGB 3KXBA 3X1VB 5GT3B 3REHB 3X1VD 4J8UC 3AZLA 3AN2C 5B31B 4Z5TD 5G49A 5DNND 5CPID 2F8NB 5CPIB 4X23D 3WA9B 3C1BA 3X1VC 5GT3A 5B32A 4J8WD 4XUJD 1F66C 4KGCB 4CAYA 5JA4A 3W99B 4KUDD 1M1AC 5AV9B 1KX3D 1M18D 5GXQB 1F66A 5AVCB 5AV6D 1ZLAD 5AV8D 1P3AC 4H9OB 1P3FA 4J8XC 2L5AA 3AZJA 4Z5TC 4J8VC 1S32A 3AFAB 5BNVB 3B6GA 4J8VD 4NE3A 3KUYC 3B0DC 4HGAC 1P34D 1B67A 5B2ID 5GSUC 3W96B 5AV5C 4H9NB 3KWQB 2NZDD 5BO0B 3C1CD 1P3FD 1KX3C 3MGSA 1S32B 3W98C 3REIA 3VH5T 2YFWA 3O62C 5CPJB 3UTBC 3UTAC 5B33C 3W97C 5BS7A 5C3IC 5B2JB 3VH6A 5B32G 4CSRA 3LELD 1P3AD 4NE6A 1N1JB 1ZLAB 1P34A 5B31A 3MGPA 5CPIC 3LELC 5GSUA 1P3GA 3X1UA 3LZ1B 4XUJB 3MGSD 3O62B 3R45A 3VH5A 4WZSB 5CPJC 1EQZA 1P3PA 3WAAA 5AV9A 1ZLAA 5B0ZA 1P3BC 5AY8C 4LD9D 4Z2MH 5BT1C 3MGPD 1P3LB 1S32D 4H9PB 4QLCB 3B6GB 5B1LC 5BNXB 1ID3B 2F8ND 3AZJB 1P3PD 5AV6A 1H3OA 4AWLB 1P3BD 3TU4C 4LD9C 1P3BB 1ZLAC 3LZ0D 1P3KC 2F8NK 4KUDB 2FJ7D 4YM6A 1JFIB 1TZYB 4J8WB 1R4VA 3X1SC 5B1LA 5JRGB 5AV6B 5AVCD 1KX5A 4CSRB 1P3BA 2BYKA 1M1AA 3AYWA 3V9RA 1P3GD 3AZMC 3WTPA 1TZYA 4XUJA 4H9SA 4QLCC 3AZMA 5B0YD 2NZDC 3VH5W 1M1AB 3C1BD 3AZFB 1KX5D 3AZHC 3B6FC 3B0CT 3WAAB 4YS3B 3W99C 4H9PA 5DNMC 1TZYC 1P3LA 4Z2MG 3AZNC 3WKJA 3WA9D 2HIOB 3AZLC 3AN2A 3TU4B 5B24C 1P3IC 5F99A 3MGRA 3LJAC 4J8WC 5GT3C 3UT9B 4KHAB 2F8NA 5BS7C 4G91B 5B31D 5JRGA 4YM6D 3LJAD 3W99A 3REIC 4JJNB 3REHD 4WNNA 3AZGB 2FJ7C 4JJND 4Z66C 2AROB 4UUZA 5B24D 5B32C 1P3ID 3LZ0B 3WTPB 3LELB 4R8PC 5GT0C 3AZED 2CV5A 3W96D 1AOIC 4KGCD 3AV1D 5JRGD 5B40B 1P3OD 5BNVA 5B1MC 1P3OB 3NQUB 5AY8D 3KXBB 3A6NB 3AZEC 3LELA 4XZQA 5G49B 5B0YC 2HIOC 3W96A 3AZLB 3MVDC 5E5AC 3W97A 5B33A 3KUYB 3MGSB 1HTAA 5B1MB 3REIB 3AZGC 1M19A 5E5AA 1HQ3B 5F99B 4H9QB 5AVBC 3C1BB 3W98B 3B0BA 5GSUB 3MGQB 3AZEA 1N1JA 1A7WA 4KHAA 1P3MA 4X23C 3AYWD 4ZUXD 3UT9A 3B0DB 1KX4A 2AROC 1F1EA 3B6GD 3VH6W 4JJNA 3O62A 1HQ3A 5AY8A 4NFTA 5GT0B 2AROA 4UUZB 4R8PB 3REKC 4WNNB 3AZEB 1P3PC 1U35A 1P3MB 3MVDA 3UTAB 3AV1A 5DNMB 1ULYA 4ZUXA 3UT9D 5CPKD 1ID3A 3REID 4H9SC 2LY8A 1TAFA 4QLCA 5AY8B 5B24A 5CPKB 1P3IA 5AVBA 3AZHD 2YFWB 5AV8B 2YFVB 5B40A 3AZIC 1BH8B 4KUDA 1U35D 5B1LB 3NQJB 4Z66D 4E45A 4J8VB 5B24B 1P3IB 1HQ3D 3LZ1A 4J8XB 2BYKB 5FUGA 4XZQD 4X23B 2BYMB 3MGQC 3AV2A 3AZFD 1KX5B 1EQZB 2NQBA 1M18B 3MGQA 3AV2C 3A6ND 3W99D 3LJAA 2CV5C 1KU5A 1P3KB 3AZHA 3AZMB 1M19D 1AOID 1KX4B 4H9RA 4ZBJB 1H3OB 2CWEA 1Q9CA 5KDMB 3UTAA 5BNXA 3WKJC 4YS3A 1S32C 3REHC 5B40C 3AZIA 3X1UD 3AZHB 2AROD 1JFIA 3KWQD 5DNMA 3X1UC 3REJB 1P3OC 4YM6B 3MGRC 4WV4B 4G92C 1M1AD 2F8NH 3MNNA 3B0CW 5B2JD 4CAYB 3REKD 1P3LC 5E5AD 4J8XA 4H9NA 3KWQA 5B0YA 3AZNB 4J8VA 3B6GC 5B2JC 3AV2B 2IO5B 3MNNB 4X23A 2NQBD 3LZ0A 5B2JA 3C1CC 4Z5TA 4EO5B 1P3KA 1B6WA 3LJAB 3WKJB 5CPJA 1P3PB 2FJ7A 3AZID 1P3OA 3REKB 3AZIB 4YM6C 3MGRB 3UTBB 1WWIA 5CP6B 4DRAA 5B33B 3KUYA 5CPKC 3W97B 3REJC 2NZDB 3WTPE 1P3MD
chains in the Genus database with same CATH superfamily
4G92B 3R45B 4WU9C 3X1TC 3REJA 3W96C 5CPJD 5GT0D 4R8PD 3W98A 5B31G 1AOIB 5E5AB 3B6FA 2XD5A 1P3KD 4HGAB 3TU4D 3AV2D 3KUYD 2DQNC 4WU9D 2CV5B 5CPIA 2PYOB 4WU9B 3C1CA 3AN2D 5B0YB 4J8UD 4EO5C 5JA4B 3AZNA 3REJD 1KX4C 4J8XD 3EPLA 2Y2JA 3NQUA 3AV1C 5F99C 2W8SA 1KX5C 4H9OA 1P3FB 3WKJD 4ZUXB 3X1SA 4WU9A 1F66D 4XUJC 5DNNB 3WA9C 5AV8A 4JJNC 1TAFB 3X1VA 5CPKA 3P5JB 3AZMD 3REHA 1M19B 3AZKA 4M6BA 2FJ7B 5AV6C 1BH8A 3RELD 4KGCC 3UTAD 4G91C 4H9QA 3X1SD 2NZDA 1AOIA 3AZJC 5B32B 3AZLD 3RELC 1M18A 1P3GB 5GXQA 4ZUXC 3MVDD 1U35B 3AYWC 5GT0A 5B2IB 4R8PA 3MVDB 1P3AA 2PYOA 4KGCA 3AFAC 5B33D 3WTPD 3W97D 2RIQA 3UTBD 3MGPC 3KWQC 3AFAA 3C1CB 3KSYA 3AV1B 5AVBB 3C1BC 5KDMA 4WU8C 3B6FD 3AZGA 5JRGC 3RELA 1M18C 5B0ZB 1EQZC 5B0ZD 3LZ1C 4Z66A 3MGSC 4ZBJC 3KXBD 4J8UA 1BH9A 3AZKB 5BO0A 3A6NC 2CV5D 5BT1D 3RELB 2BYMA 3WAAC 5B31C 1P34B 3A6NA 4WJ3C 3MGQD 1WWSA 3W98D 3X1UB 4XZQC 5B32D 4J8WA 2F8NG 4DRBA 3MGPB 1P3LD 3X1TD 3LZ0C 5CHLB 4LD9B 3AYWB 3AZGD 2PYOC 3WAAD 5B1MA 1P3MC 2Y2LA 1P3GC 1U35C 4Z5TB 5B2IA 1P3AB 2RVQC 1ID3D 3MGRD 5AVCC 4XZQB 2RVQD 5AV8C 5DNMD 1W2EA 5B40D 2IO5C 3MNNC 3UT9C 1P3FC 3VH6T 3MNND 5AV9D 5AV5A 1KX3B 3AZFA 1BFMA 1P34C 3EPJA 3REKA 1KX4D 3WTPC 1BH9B 4NE5A 3X1TA 1M19C 3UTBA 2HUEC 5B1LD 4Z66B 3TU4A 2NQBC 3AZKC 5C3IB 4J8UB 5DNNC 2HIOA 3AN2B 1KX3A 3WA9A 2YFVA 5CP6D 3AZFC 3AZJD 3H0RC 5GT3D 3KXBC 5AVBD 4YS3D 3B6FB 3X1TB 4QLCD 4DQYB 1HQ3C 3V9RB 4YS3C 1EQZD 5AV9C 5B2IC 4E44A 2ZM5A 5AVCA 5GXQD 5CP6C 1F66B 2UWXA 4WU8A 2JSSA 2HIOD 4LD9A 4AWLC 3AZND 3AZKD 1ID3C 3O62D 1TZYD 3AFAD 3LZ1D 2HUEB 5B0ZC 5B1MD 2NQBB 5DNNA 3NQJA 5GXQC 3X1SB 5AV5D 4WU8B 2PYOD 4KUDC 5GSUD 5AV5B 5CP6A 4WU8D 5F99D 4H9RB 3H0MC 5FUGB 3KXBA 3X1VB 5GT3B 3REHB 3X1VD 4J8UC 3EPHA 3AZLA 3AN2C 5B31B 4Z5TD 5G49A 5DNND 2Y2HA 5CPID 2F8NB 5CPIB 4X23D 3WA9B 2VQRA 2ZY5A 3X1VC 3C1BA 5GT3A 2JE5A 5B32A 4J8WD 4XUJD 1F66C 4KGCB 4CAYA 5JA4A 3W99B 4KUDD 1M1AC 2F2AC 5AV9B 1KX3D 1M18D 5GXQB 1F66A 5AVCB 5AV6D 1ZLAD 5AV8D 1P3AC 4H9OB 1P3FA 4J8XC 2L5AA 3AZJA 4Z5TC 4J8VC 1S32A 3AFAB 5BNVB 3B6GA 4J8VD 3A1IA 4NE3A 3KUYC 3B0DC 4HGAC 1P34D 1B67A 5B2ID 5GSUC 3W96B 5AV5C 4H9NB 3KWQB 2NZDD 5BO0B 3C1CD 1P3FD 1KX3C 3MGSA 1S32B 3W98C 3REIA 2Y2KA 4UPKA 3VH5T 2YFWA 3O62C 5CPJB 2Y2IA 3UTBC 3UTAC 5B33C 3W97C 5BS7A 5C3IC 5B2JB 3VH6A 5B32G 4CSRA 3LELD 1P3AD 4NE6A 1N1JB 1ZLAB 1P34A 5B31A 3MGPA 5CPIC 3LELC 5GSUA 3A1KA 1P3GA 3X1UA 2XD1A 3LZ1B 4XUJB 3MGSD 3O62B 3R45A 4WZSB 3VH5A 2ZY3A 5CPJC 1EQZA 1P3PA 3WAAA 5AV9A 1ZLAA 5B0ZA 1P3BC 5AY8C 3F6TA 4LD9D 4Z2MH 5BT1C 3MGPD 1P3LB 3H0LC 1S32D 4H9PB 4QLCB 3B6GB 5B1LC 5BNXB 1ID3B 2F8ND 3AZJB 1P3PD 5AV6A 1H3OA 4AWLB 1P3BD 3TU4C 4LD9C 1P3BB 1ZLAC 3LZ0D 1P3KC 3KFUG 2F8NK 2JCHA 2FJ7D 2Y2QA 4KUDB 4YM6A 1JFIB 2Y2PA 1TZYB 4J8WB 1R4VA 3X1SC 5B1LA 5JRGB 5AV6B 5AVCD 2FFFB 1KX5A 4CSRB 1P3BA 2BYKA 1M1AA 3AYWA 3V9RA 1P3GD 3AZMC 3WTPA 1TZYA 4XUJA 4H9SA 4QLCC 3AZMA 5B0YD 2NZDC 3VH5W 1M1AB 3C1BD 2Y2NA 3AZFB 3AZHC 1KX5D 3B0CT 3B6FC 3WAAB 4YS3B 3W99C 4H9PA 5DNMC 1TZYC 2G5IC 2J8PA 4Z2MG 1P3LA 3AZNC 3WKJA 3WA9D 2HIOB 3AZLC 3AN2A 3TU4B 5B24C 1P3IC 5F99A 3MGRA 3LJAC 4J8WC 1Z2CB 5GT3C 3UT9B 1T3UA 4KHAB 5BS7C 2F8NA 4G91B 1PZRA 5B31D 5JRGA 4YM6D 3LJAD 3W99A 3REIC 4JJNB 3REHD 4WNNA 3EPKA 3AZGB 2FJ7C 4JJND 4Z66C 2AROB 4UUZA 5B24D 5B32C 1P3ID 3LZ0B 3WTPB 3LELB 2DF4C 4R8PC 5GT0C 3AZED 2CV5A 3W96D 1AOIC 4KGCD 3AV1D 5JRGD 5B40B 1P3OD 2Y2GA 2Y2MA 5BNVA 5B1MC 1P3OB 3IP4C 3NQUB 5AY8D 3KXBB 3A6NB 3AZEC 3LELA 4XZQA 5G49B 5B0YC 2HIOC 3W96A 3AZLB 3MVDC 5E5AC 3W97A 5B33A 3KUYB 3MGSB 1HTAA 5B1MB 3REIB 3AZGC 1M19A 5E5AA 1HQ3B 5F99B 4H9QB 5AVBC 3C1BB 3W98B 3B0BA 5GSUB 3MGQB 3AZEA 2ZY4A 1N1JA 1A7WA 4KHAA 1P3MA 4X23C 3AYWD 4ZUXD 3UT9A 3B0DB 1KX4A 2AROC 1F1EA 2G5HC 3B6GD 3VH6W 4JJNA 3O62A 1HQ3A 5AY8A 4NFTA 5GT0B 2AROA 4UUZB 4R8PB 3REKC 4WNNB 3AZEB 1P3PC 1U35A 1P3MB 3MVDA 3UTAB 3AV1A 5DNMB 1ULYA 4ZUXA 3UT9D 5CPKD 1ID3A 3REID 4H9SC 2LY8A 1TAFA 4QLCA 5AY8B 5B24A 5CPKB 1P3IA 5AVBA 3AZHD 2YFWB 3FDDA 5AV8B 2YFVB 5B40A 3AZIC 1BH8B 4KUDA 1U35D 5B1LB 3NQJB 4Z66D 4E45A 4J8VB 5B24B 1P3IB 1HQ3D 3LZ1A 4J8XB 2Y2OA 2BYKB 5FUGA 4XZQD 4X23B 2BYMB 3MGQC 3AV2A 3AZFD 1KX5B 1EQZB 2NQBA 1M18B 3MGQA 3AV2C 3A6ND 3W99D 3LJAA 3EG5B 2CV5C 1KU5A 1P3KB 3AZHA 3AZMB 1M19D 1AOID 1KX4B 4H9RA 4ZBJB 1H3OB 2CWEA 1Q9CA 5KDMB 3UTAA 5BNXA 3WKJC 4YS3A 1S32C 3REHC 5B40C 3AZIA 3X1UD 3AZHB 2AROD 1JFIA 3KWQD 5DNMA 3X1UC 3REJB 1P3OC 4YM6B 3MGRC 4WV4B 4G92C 1M1AD 2F8NH 2BG1A 3MNNA 3B0CW 5B2JD 4CAYB 3REKD 1P3LC 5E5AD 4J8XA 4H9NA 3KWQA 5B0YA 3AZNB 4J8VA 3B6GC 3AL0C 5B2JC 3AV2B 2IO5B 3MNNB 4X23A 2NQBD 3LZ0A 5B2JA 3C1CC 4Z5TA 4EO5B 1P3KA 1B6WA 3LJAB 2ZY2A 3WKJB 5CPJA 1P3PB 2FJ7A 3AZID 1P3OA 3REKB 3AZIB 4YM6C 3MGRB 3UTBB 1WWIA 5CP6B 4DRAA 5B33B 3KUYA 5CPKC 3W97B 3REJC 2NZDB 3WTPE 1P3MD
chains in the Genus database with same CATH topology
4G92B 3R45B 4WU9C 3X1TC 3REJA 3W96C 5CPJD 5GT0D 4R8PD 3W98A 5B31G 1AOIB 5E5AB 3B6FA 2XD5A 1P3KD 4HGAB 3TU4D 3AV2D 3KUYD 2DQNC 4WU9D 2CV5B 5CPIA 2PYOB 4WU9B 3C1CA 3AN2D 5B0YB 4J8UD 4EO5C 5JA4B 3AZNA 3REJD 1KX4C 4J8XD 3EPLA 2Y2JA 3NQUA 3AV1C 5F99C 2W8SA 1KX5C 4H9OA 1P3FB 3WKJD 4ZUXB 3X1SA 4WU9A 1F66D 4XUJC 5DNNB 3WA9C 5AV8A 4JJNC 1TAFB 3X1VA 5CPKA 3P5JB 3AZMD 3REHA 1M19B 3AZKA 4M6BA 2FJ7B 5AV6C 1BH8A 3RELD 4KGCC 3UTAD 4G91C 4H9QA 3X1SD 2NZDA 1AOIA 3AZJC 5B32B 3AZLD 3RELC 1M18A 1P3GB 5GXQA 4ZUXC 3MVDD 1U35B 3AYWC 5GT0A 5B2IB 4R8PA 3MVDB 1P3AA 2PYOA 4KGCA 3AFAC 5B33D 3WTPD 3W97D 2RIQA 3UTBD 3MGPC 3KWQC 3AFAA 3C1CB 3KSYA 3AV1B 5AVBB 3C1BC 5KDMA 4WU8C 3B6FD 3AZGA 5JRGC 3RELA 1M18C 5B0ZB 1EQZC 5B0ZD 3LZ1C 4Z66A 3MGSC 4ZBJC 3KXBD 4J8UA 1BH9A 3AZKB 5BO0A 3A6NC 2CV5D 5BT1D 3RELB 2BYMA 3WAAC 5B31C 1P34B 3A6NA 4WJ3C 3MGQD 1WWSA 3W98D 3X1UB 4XZQC 5B32D 4J8WA 2F8NG 4DRBA 3MGPB 1P3LD 3X1TD 3LZ0C 5CHLB 4LD9B 3AYWB 3AZGD 2PYOC 3WAAD 5B1MA 1P3MC 2Y2LA 1P3GC 1U35C 4Z5TB 5B2IA 1P3AB 2RVQC 1ID3D 3MGRD 5AVCC 4XZQB 2RVQD 5AV8C 5DNMD 1W2EA 5B40D 2IO5C 3MNNC 3UT9C 1P3FC 3VH6T 3MNND 5AV9D 5AV5A 1KX3B 3AZFA 1BFMA 1P34C 3EPJA 3REKA 1KX4D 3WTPC 1BH9B 4NE5A 3X1TA 1M19C 3UTBA 2HUEC 5B1LD 4Z66B 3TU4A 2NQBC 3AZKC 5C3IB 4J8UB 5DNNC 2HIOA 3AN2B 1KX3A 3WA9A 2YFVA 5CP6D 3AZFC 3AZJD 3H0RC 5GT3D 3KXBC 5AVBD 4YS3D 3B6FB 3X1TB 4QLCD 4DQYB 1HQ3C 3V9RB 4YS3C 1EQZD 5AV9C 5B2IC 4E44A 2ZM5A 5AVCA 5GXQD 5CP6C 1F66B 2UWXA 4WU8A 2JSSA 2HIOD 4LD9A 4AWLC 3AZND 3AZKD 1ID3C 3O62D 1TZYD 3AFAD 3LZ1D 2HUEB 5B0ZC 5B1MD 2NQBB 5DNNA 3NQJA 5GXQC 3X1SB 5AV5D 4WU8B 2PYOD 4KUDC 5GSUD 5AV5B 5CP6A 4WU8D 5F99D 4H9RB 3H0MC 5FUGB 3KXBA 3X1VB 5GT3B 3REHB 3X1VD 4J8UC 3EPHA 3AZLA 3AN2C 5B31B 4Z5TD 5G49A 5DNND 2Y2HA 5CPID 2F8NB 5CPIB 4X23D 3WA9B 2VQRA 2ZY5A 3X1VC 3C1BA 5GT3A 2JE5A 5B32A 4J8WD 4XUJD 1F66C 4KGCB 4CAYA 5JA4A 3W99B 4KUDD 1M1AC 2F2AC 5AV9B 1KX3D 1M18D 5GXQB 1F66A 5AVCB 5AV6D 1ZLAD 5AV8D 1P3AC 4H9OB 1P3FA 4J8XC 2L5AA 3AZJA 4Z5TC 4J8VC 1S32A 3AFAB 5BNVB 3B6GA 4J8VD 3A1IA 4NE3A 3KUYC 3B0DC 4HGAC 1P34D 1B67A 5B2ID 5GSUC 3W96B 5AV5C 4H9NB 3KWQB 2NZDD 5BO0B 3C1CD 1P3FD 1KX3C 3MGSA 1S32B 3W98C 3REIA 2Y2KA 4UPKA 3VH5T 2YFWA 3O62C 5CPJB 2Y2IA 3UTBC 3UTAC 5B33C 3W97C 5BS7A 5C3IC 5B2JB 3VH6A 5B32G 4CSRA 3LELD 1P3AD 4NE6A 1N1JB 1ZLAB 1P34A 5B31A 3MGPA 5CPIC 3LELC 5GSUA 3A1KA 1P3GA 3X1UA 2XD1A 3LZ1B 4XUJB 3MGSD 3O62B 3R45A 4WZSB 3VH5A 2ZY3A 5CPJC 1EQZA 1P3PA 3WAAA 5AV9A 1ZLAA 5B0ZA 1P3BC 5AY8C 3F6TA 4LD9D 4Z2MH 5BT1C 3MGPD 1P3LB 3H0LC 1S32D 4H9PB 4QLCB 3B6GB 5B1LC 5BNXB 1ID3B 2F8ND 3AZJB 1P3PD 5AV6A 1H3OA 4AWLB 1P3BD 3TU4C 4LD9C 1P3BB 1ZLAC 3LZ0D 1P3KC 3KFUG 2F8NK 2JCHA 2FJ7D 2Y2QA 4KUDB 4YM6A 1JFIB 2Y2PA 1TZYB 4J8WB 1R4VA 3X1SC 5B1LA 5JRGB 5AV6B 5AVCD 2FFFB 1KX5A 4CSRB 1P3BA 2BYKA 1M1AA 3AYWA 3V9RA 1P3GD 3AZMC 3WTPA 1TZYA 4XUJA 4H9SA 4QLCC 3AZMA 5B0YD 2NZDC 3VH5W 1M1AB 3C1BD 2Y2NA 3AZFB 3AZHC 1KX5D 3B0CT 3B6FC 3WAAB 4YS3B 3W99C 4H9PA 5DNMC 1TZYC 2G5IC 2J8PA 4Z2MG 1P3LA 3AZNC 3WKJA 3WA9D 2HIOB 3AZLC 3AN2A 3TU4B 5B24C 1P3IC 5F99A 3MGRA 3LJAC 4J8WC 1Z2CB 5GT3C 3UT9B 1T3UA 4KHAB 5BS7C 2F8NA 4G91B 1PZRA 5B31D 5JRGA 4YM6D 3LJAD 3W99A 3REIC 4JJNB 3REHD 4WNNA 3EPKA 3AZGB 2FJ7C 4JJND 4Z66C 2AROB 4UUZA 5B24D 5B32C 1P3ID 3LZ0B 3WTPB 3LELB 2DF4C 4R8PC 5GT0C 3AZED 2CV5A 3W96D 1AOIC 4KGCD 3AV1D 5JRGD 5B40B 1P3OD 2Y2GA 2Y2MA 5BNVA 5B1MC 1P3OB 3IP4C 3NQUB 5AY8D 3KXBB 3A6NB 3AZEC 3LELA 4XZQA 5G49B 5B0YC 2HIOC 3W96A 3AZLB 3MVDC 5E5AC 3W97A 5B33A 3KUYB 3MGSB 1HTAA 5B1MB 3REIB 3AZGC 1M19A 5E5AA 1HQ3B 5F99B 4H9QB 5AVBC 3C1BB 3W98B 3B0BA 5GSUB 3MGQB 3AZEA 2ZY4A 1N1JA 1A7WA 4KHAA 1P3MA 4X23C 3AYWD 4ZUXD 3UT9A 3B0DB 1KX4A 2AROC 1F1EA 2G5HC 3B6GD 3VH6W 4JJNA 3O62A 1HQ3A 5AY8A 4NFTA 5GT0B 2AROA 4UUZB 4R8PB 3REKC 4WNNB 3AZEB 1P3PC 1U35A 1P3MB 3MVDA 3UTAB 3AV1A 5DNMB 1ULYA 4ZUXA 3UT9D 5CPKD 1ID3A 3REID 4H9SC 2LY8A 1TAFA 4QLCA 5AY8B 5B24A 5CPKB 1P3IA 5AVBA 3AZHD 2YFWB 3FDDA 5AV8B 2YFVB 5B40A 3AZIC 1BH8B 4KUDA 1U35D 5B1LB 3NQJB 4Z66D 4E45A 4J8VB 5B24B 1P3IB 1HQ3D 3LZ1A 4J8XB 2Y2OA 2BYKB 5FUGA 4XZQD 4X23B 2BYMB 3MGQC 3AV2A 3AZFD 1KX5B 1EQZB 2NQBA 1M18B 3MGQA 3AV2C 3A6ND 3W99D 3LJAA 3EG5B 2CV5C 1KU5A 1P3KB 3AZHA 3AZMB 1M19D 1AOID 1KX4B 4H9RA 4ZBJB 1H3OB 2CWEA 1Q9CA 5KDMB 3UTAA 5BNXA 3WKJC 4YS3A 1S32C 3REHC 5B40C 3AZIA 3X1UD 3AZHB 2AROD 1JFIA 3KWQD 5DNMA 3X1UC 3REJB 1P3OC 4YM6B 3MGRC 4WV4B 4G92C 1M1AD 2F8NH 2BG1A 3MNNA 3B0CW 5B2JD 4CAYB 3REKD 1P3LC 5E5AD 4J8XA 4H9NA 3KWQA 5B0YA 3AZNB 4J8VA 3B6GC 3AL0C 5B2JC 3AV2B 2IO5B 3MNNB 4X23A 2NQBD 3LZ0A 5B2JA 3C1CC 4Z5TA 4EO5B 1P3KA 1B6WA 3LJAB 2ZY2A 3WKJB 5CPJA 1P3PB 2FJ7A 3AZID 1P3OA 3REKB 3AZIB 4YM6C 3MGRB 3UTBB 1WWIA 5CP6B 4DRAA 5B33B 3KUYA 5CPKC 3W97B 3REJC 2NZDB 3WTPE 1P3MD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G92 B;  3R45 B;  4WU9 C;  3X1T C;  3REJ A;  3W96 C;  5CPJ D;  5GT0 D;  4R8P D;  3W98 A;  5B31 G;  1AOI B;  5E5A B;  3B6F A;  1P3K D;  4HGA B;  3TU4 D;  3AV2 D;  3KUY D;  4WU9 D;  2CV5 B;  5CPI A;  2PYO B;  4WU9 B;  3C1C A;  3AN2 D;  5B0Y B;  4J8U D;  4EO5 C;  5JA4 B;  3AZN A;  3REJ D;  1KX4 C;  4J8X D;  3NQU A;  3AV1 C;  5F99 C;  1KX5 C;  4H9O A;  1P3F B;  3WKJ D;  4ZUX B;  3X1S A;  4WU9 A;  1F66 D;  4XUJ C;  5DNN B;  3WA9 C;  5AV8 A;  4JJN C;  1TAF B;  3X1V A;  5CPK A;  3AZM D;  3REH A;  1M19 B;  3AZK A;  4M6B A;  2FJ7 B;  5AV6 C;  1BH8 A;  3REL D;  4KGC C;  3UTA D;  4G91 C;  4H9Q A;  3X1S D;  2NZD A;  1AOI A;  3AZJ C;  5B32 B;  3AZL D;  3REL C;  1M18 A;  1P3G B;  5GXQ A;  4ZUX C;  3MVD D;  1U35 B;  3AYW C;  5GT0 A;  5B2I B;  4R8P A;  3MVD B;  1P3A A;  2PYO A;  4KGC A;  3AFA C;  5B33 D;  3WTP D;  3W97 D;  3UTB D;  3MGP C;  3KWQ C;  3AFA A;  3C1C B;  3KSY A;  3AV1 B;  5AVB B;  3C1B C;  5KDM A;  4WU8 C;  3B6F D;  3AZG A;  5JRG C;  3REL A;  1M18 C;  5B0Z B;  1EQZ C;  5B0Z D;  3LZ1 C;  4Z66 A;  3MGS C;  4ZBJ C;  3KXB D;  4J8U A;  1BH9 A;  3AZK B;  5BO0 A;  3A6N C;  2CV5 D;  5BT1 D;  3REL B;  2BYM A;  3WAA C;  5B31 C;  1P34 B;  3A6N A;  3MGQ D;  1WWS A;  3W98 D;  3X1U B;  4XZQ C;  5B32 D;  4J8W A;  2F8N G;  4DRB A;  3MGP B;  1P3L D;  3X1T D;  3LZ0 C;  5CHL B;  4LD9 B;  3AYW B;  3AZG D;  2PYO C;  3WAA D;  5B1M A;  1P3M C;  1P3G C;  1U35 C;  4Z5T B;  5B2I A;  1P3A B;  2RVQ C;  1ID3 D;  3MGR D;  5AVC C;  4XZQ B;  2RVQ D;  5AV8 C;  5DNM D;  5B40 D;  2IO5 C;  3MNN C;  3UT9 C;  1P3F C;  3VH6 T;  3MNN D;  5AV9 D;  5AV5 A;  1KX3 B;  3AZF A;  1BFM A;  1P34 C;  3REK A;  1KX4 D;  3WTP C;  1BH9 B;  4NE5 A;  3X1T A;  1M19 C;  3UTB A;  2HUE C;  5B1L D;  4Z66 B;  3TU4 A;  2NQB C;  3AZK C;  5C3I B;  4J8U B;  5DNN C;  2HIO A;  3AN2 B;  1KX3 A;  3WA9 A;  2YFV A;  5CP6 D;  3AZF C;  3AZJ D;  5GT3 D;  3KXB C;  5AVB D;  4YS3 D;  3B6F B;  3X1T B;  4QLC D;  1HQ3 C;  3V9R B;  4YS3 C;  1EQZ D;  5AV9 C;  5B2I C;  4E44 A;  1F66 B;  5AVC A;  5GXQ D;  5CP6 C;  4WU8 A;  2JSS A;  2HIO D;  4LD9 A;  4AWL C;  3AZN D;  3AZK D;  1ID3 C;  3O62 D;  1TZY D;  3AFA D;  3LZ1 D;  2HUE B;  5B0Z C;  5B1M D;  2NQB B;  5DNN A;  3NQJ A;  5GXQ C;  3X1S B;  5AV5 D;  4WU8 B;  2PYO D;  4KUD C;  5GSU D;  5AV5 B;  5CP6 A;  4WU8 D;  5F99 D;  4H9R B;  5FUG B;  3KXB A;  3X1V B;  5GT3 B;  3REH B;  3X1V D;  4J8U C;  3AZL A;  3AN2 C;  5B31 B;  4Z5T D;  5G49 A;  5DNN D;  5CPI D;  2F8N B;  5CPI B;  4X23 D;  3WA9 B;  3C1B A;  3X1V C;  5GT3 A;  5B32 A;  4J8W D;  4XUJ D;  1F66 C;  4KGC B;  4CAY A;  5JA4 A;  3W99 B;  4KUD D;  1M1A C;  5AV9 B;  1KX3 D;  1M18 D;  5GXQ B;  1F66 A;  5AVC B;  5AV6 D;  1ZLA D;  5AV8 D;  1P3A C;  4H9O B;  1P3F A;  4J8X C;  2L5A A;  3AZJ A;  4Z5T C;  4J8V C;  1S32 A;  3AFA B;  5BNV B;  3B6G A;  4J8V D;  4NE3 A;  3KUY C;  3B0D C;  4HGA C;  1P34 D;  1B67 A;  5B2I D;  5GSU C;  3W96 B;  5AV5 C;  4H9N B;  3KWQ B;  2NZD D;  5BO0 B;  3C1C D;  1P3F D;  1KX3 C;  3MGS A;  1S32 B;  3W98 C;  3REI A;  3VH5 T;  2YFW A;  3O62 C;  5CPJ B;  3UTB C;  3UTA C;  5B33 C;  3W97 C;  5BS7 A;  5C3I C;  5B2J B;  3VH6 A;  5B32 G;  4CSR A;  3LEL D;  1P3A D;  4NE6 A;  1N1J B;  1ZLA B;  1P34 A;  5B31 A;  3MGP A;  5CPI C;  3LEL C;  5GSU A;  1P3G A;  3X1U A;  3LZ1 B;  4XUJ B;  3MGS D;  3O62 B;  3R45 A;  3VH5 A;  4WZS B;  5CPJ C;  1EQZ A;  1P3P A;  3WAA A;  5AV9 A;  1ZLA A;  5B0Z A;  1P3B C;  5AY8 C;  4LD9 D;  4Z2M H;  5BT1 C;  3MGP D;  1P3L B;  1S32 D;  4H9P B;  4QLC B;  3B6G B;  5B1L C;  5BNX B;  1ID3 B;  2F8N D;  3AZJ B;  1P3P D;  5AV6 A;  1H3O A;  4AWL B;  1P3B D;  3TU4 C;  4LD9 C;  1P3B B;  1ZLA C;  3LZ0 D;  1P3K C;  2F8N K;  4KUD B;  2FJ7 D;  4YM6 A;  1JFI B;  1TZY B;  4J8W B;  1R4V A;  3X1S C;  5B1L A;  5JRG B;  5AV6 B;  5AVC D;  1KX5 A;  4CSR B;  1P3B A;  2BYK A;  1M1A A;  3AYW A;  3V9R A;  1P3G D;  3AZM C;  3WTP A;  1TZY A;  4XUJ A;  4H9S A;  4QLC C;  3AZM A;  5B0Y D;  2NZD C;  3VH5 W;  1M1A B;  3C1B D;  3AZF B;  1KX5 D;  3AZH C;  3B6F C;  3B0C T;  3WAA B;  4YS3 B;  3W99 C;  4H9P A;  5DNM C;  1TZY C;  1P3L A;  4Z2M G;  3AZN C;  3WKJ A;  3WA9 D;  2HIO B;  3AZL C;  3AN2 A;  3TU4 B;  5B24 C;  1P3I C;  5F99 A;  3MGR A;  3LJA C;  4J8W C;  5GT3 C;  3UT9 B;  4KHA B;  2F8N A;  5BS7 C;  4G91 B;  5B31 D;  5JRG A;  4YM6 D;  3LJA D;  3W99 A;  3REI C;  4JJN B;  3REH D;  4WNN A;  3AZG B;  2FJ7 C;  4JJN D;  4Z66 C;  2ARO B;  4UUZ A;  5B24 D;  5B32 C;  1P3I D;  3LZ0 B;  3WTP B;  3LEL B;  4R8P C;  5GT0 C;  3AZE D;  2CV5 A;  3W96 D;  1AOI C;  4KGC D;  3AV1 D;  5JRG D;  5B40 B;  1P3O D;  5BNV A;  5B1M C;  1P3O B;  3NQU B;  5AY8 D;  3KXB B;  3A6N B;  3AZE C;  3LEL A;  4XZQ A;  5G49 B;  5B0Y C;  2HIO C;  3W96 A;  3AZL B;  3MVD C;  5E5A C;  3W97 A;  5B33 A;  3KUY B;  3MGS B;  1HTA A;  5B1M B;  3REI B;  3AZG C;  1M19 A;  5E5A A;  1HQ3 B;  5F99 B;  4H9Q B;  5AVB C;  3C1B B;  3W98 B;  3B0B A;  5GSU B;  3MGQ B;  3AZE A;  1N1J A;  1A7W A;  4KHA A;  1P3M A;  4X23 C;  3AYW D;  4ZUX D;  3UT9 A;  3B0D B;  1KX4 A;  2ARO C;  1F1E A;  3B6G D;  3VH6 W;  4JJN A;  3O62 A;  1HQ3 A;  5AY8 A;  4NFT A;  5GT0 B;  2ARO A;  4UUZ B;  4R8P B;  3REK C;  4WNN B;  3AZE B;  1P3P C;  1U35 A;  1P3M B;  3MVD A;  3UTA B;  3AV1 A;  5DNM B;  1ULY A;  4ZUX A;  3UT9 D;  5CPK D;  1ID3 A;  3REI D;  4H9S C;  2LY8 A;  1TAF A;  4QLC A;  5AY8 B;  5B24 A;  5CPK B;  1P3I A;  5AVB A;  3AZH D;  2YFW B;  5AV8 B;  2YFV B;  5B40 A;  3AZI C;  1BH8 B;  4KUD A;  1U35 D;  5B1L B;  3NQJ B;  4Z66 D;  4E45 A;  4J8V B;  5B24 B;  1P3I B;  1HQ3 D;  3LZ1 A;  4J8X B;  2BYK B;  5FUG A;  4XZQ D;  4X23 B;  2BYM B;  3MGQ C;  3AV2 A;  3AZF D;  1KX5 B;  1EQZ B;  2NQB A;  1M18 B;  3MGQ A;  3AV2 C;  3A6N D;  3W99 D;  3LJA A;  2CV5 C;  1KU5 A;  1P3K B;  3AZH A;  3AZM B;  1M19 D;  1AOI D;  1KX4 B;  4H9R A;  4ZBJ B;  1H3O B;  2CWE A;  1Q9C A;  5KDM B;  3UTA A;  5BNX A;  3WKJ C;  4YS3 A;  1S32 C;  3REH C;  5B40 C;  3AZI A;  3X1U D;  3AZH B;  2ARO D;  1JFI A;  3KWQ D;  5DNM A;  3X1U C;  3REJ B;  1P3O C;  4YM6 B;  3MGR C;  4WV4 B;  4G92 C;  1M1A D;  2F8N H;  3MNN A;  3B0C W;  5B2J D;  4CAY B;  3REK D;  1P3L C;  5E5A D;  4J8X A;  4H9N A;  3KWQ A;  5B0Y A;  3AZN B;  4J8V A;  3B6G C;  5B2J C;  3AV2 B;  2IO5 B;  3MNN B;  4X23 A;  2NQB D;  3LZ0 A;  5B2J A;  3C1C C;  4Z5T A;  4EO5 B;  1P3K A;  1B6W A;  3LJA B;  3WKJ B;  5CPJ A;  1P3P B;  2FJ7 A;  3AZI D;  1P3O A;  3REK B;  3AZI B;  4YM6 C;  3MGR B;  3UTB B;  1WWI A;  5CP6 B;  4DRA A;  5B33 B;  3KUY A;  5CPK C;  3W97 B;  3REJ C;  2NZD B;  3WTP E;  1P3M D; 
#chains in the Genus database with same CATH topology
 4G92 B;  3R45 B;  4WU9 C;  3X1T C;  3REJ A;  3W96 C;  5CPJ D;  5GT0 D;  4R8P D;  3W98 A;  5B31 G;  1AOI B;  5E5A B;  3B6F A;  2XD5 A;  1P3K D;  4HGA B;  3TU4 D;  3AV2 D;  3KUY D;  2DQN C;  4WU9 D;  2CV5 B;  5CPI A;  2PYO B;  4WU9 B;  3C1C A;  3AN2 D;  5B0Y B;  4J8U D;  4EO5 C;  5JA4 B;  3AZN A;  3REJ D;  1KX4 C;  4J8X D;  3EPL A;  2Y2J A;  3NQU A;  3AV1 C;  5F99 C;  2W8S A;  1KX5 C;  4H9O A;  1P3F B;  3WKJ D;  4ZUX B;  3X1S A;  4WU9 A;  1F66 D;  4XUJ C;  5DNN B;  3WA9 C;  5AV8 A;  4JJN C;  1TAF B;  3X1V A;  5CPK A;  3P5J B;  3AZM D;  3REH A;  1M19 B;  3AZK A;  4M6B A;  2FJ7 B;  5AV6 C;  1BH8 A;  3REL D;  4KGC C;  3UTA D;  4G91 C;  4H9Q A;  3X1S D;  2NZD A;  1AOI A;  3AZJ C;  5B32 B;  3AZL D;  3REL C;  1M18 A;  1P3G B;  5GXQ A;  4ZUX C;  3MVD D;  1U35 B;  3AYW C;  5GT0 A;  5B2I B;  4R8P A;  3MVD B;  1P3A A;  2PYO A;  4KGC A;  3AFA C;  5B33 D;  3WTP D;  3W97 D;  2RIQ A;  3UTB D;  3MGP C;  3KWQ C;  3AFA A;  3C1C B;  3KSY A;  3AV1 B;  5AVB B;  3C1B C;  5KDM A;  4WU8 C;  3B6F D;  3AZG A;  5JRG C;  3REL A;  1M18 C;  5B0Z B;  1EQZ C;  5B0Z D;  3LZ1 C;  4Z66 A;  3MGS C;  4ZBJ C;  3KXB D;  4J8U A;  1BH9 A;  3AZK B;  5BO0 A;  3A6N C;  2CV5 D;  5BT1 D;  3REL B;  2BYM A;  3WAA C;  5B31 C;  1P34 B;  3A6N A;  4WJ3 C;  3MGQ D;  1WWS A;  3W98 D;  3X1U B;  4XZQ C;  5B32 D;  4J8W A;  2F8N G;  4DRB A;  3MGP B;  1P3L D;  3X1T D;  3LZ0 C;  5CHL B;  4LD9 B;  3AYW B;  3AZG D;  2PYO C;  3WAA D;  5B1M A;  1P3M C;  2Y2L A;  1P3G C;  1U35 C;  4Z5T B;  5B2I A;  1P3A B;  2RVQ C;  1ID3 D;  3MGR D;  5AVC C;  4XZQ B;  2RVQ D;  5AV8 C;  5DNM D;  1W2E A;  5B40 D;  2IO5 C;  3MNN C;  3UT9 C;  1P3F C;  3VH6 T;  3MNN D;  5AV9 D;  5AV5 A;  1KX3 B;  3AZF A;  1BFM A;  1P34 C;  3EPJ A;  3REK A;  1KX4 D;  3WTP C;  1BH9 B;  4NE5 A;  3X1T A;  1M19 C;  3UTB A;  2HUE C;  5B1L D;  4Z66 B;  3TU4 A;  2NQB C;  3AZK C;  5C3I B;  4J8U B;  5DNN C;  2HIO A;  3AN2 B;  1KX3 A;  3WA9 A;  2YFV A;  5CP6 D;  3AZF C;  3AZJ D;  3H0R C;  5GT3 D;  3KXB C;  5AVB D;  4YS3 D;  3B6F B;  3X1T B;  4QLC D;  4DQY B;  1HQ3 C;  3V9R B;  4YS3 C;  1EQZ D;  5AV9 C;  5B2I C;  4E44 A;  2ZM5 A;  5AVC A;  5GXQ D;  5CP6 C;  1F66 B;  2UWX A;  4WU8 A;  2JSS A;  2HIO D;  4LD9 A;  4AWL C;  3AZN D;  3AZK D;  1ID3 C;  3O62 D;  1TZY D;  3AFA D;  3LZ1 D;  2HUE B;  5B0Z C;  5B1M D;  2NQB B;  5DNN A;  3NQJ A;  5GXQ C;  3X1S B;  5AV5 D;  4WU8 B;  2PYO D;  4KUD C;  5GSU D;  5AV5 B;  5CP6 A;  4WU8 D;  5F99 D;  4H9R B;  3H0M C;  5FUG B;  3KXB A;  3X1V B;  5GT3 B;  3REH B;  3X1V D;  4J8U C;  3EPH A;  3AZL A;  3AN2 C;  5B31 B;  4Z5T D;  5G49 A;  5DNN D;  2Y2H A;  5CPI D;  2F8N B;  5CPI B;  4X23 D;  3WA9 B;  2VQR A;  2ZY5 A;  3X1V C;  3C1B A;  5GT3 A;  2JE5 A;  5B32 A;  4J8W D;  4XUJ D;  1F66 C;  4KGC B;  4CAY A;  5JA4 A;  3W99 B;  4KUD D;  1M1A C;  2F2A C;  5AV9 B;  1KX3 D;  1M18 D;  5GXQ B;  1F66 A;  5AVC B;  5AV6 D;  1ZLA D;  5AV8 D;  1P3A C;  4H9O B;  1P3F A;  4J8X C;  2L5A A;  3AZJ A;  4Z5T C;  4J8V C;  1S32 A;  3AFA B;  5BNV B;  3B6G A;  4J8V D;  3A1I A;  4NE3 A;  3KUY C;  3B0D C;  4HGA C;  1P34 D;  1B67 A;  5B2I D;  5GSU C;  3W96 B;  5AV5 C;  4H9N B;  3KWQ B;  2NZD D;  5BO0 B;  3C1C D;  1P3F D;  1KX3 C;  3MGS A;  1S32 B;  3W98 C;  3REI A;  2Y2K A;  4UPK A;  3VH5 T;  2YFW A;  3O62 C;  5CPJ B;  2Y2I A;  3UTB C;  3UTA C;  5B33 C;  3W97 C;  5BS7 A;  5C3I C;  5B2J B;  3VH6 A;  5B32 G;  4CSR A;  3LEL D;  1P3A D;  4NE6 A;  1N1J B;  1ZLA B;  1P34 A;  5B31 A;  3MGP A;  5CPI C;  3LEL C;  5GSU A;  3A1K A;  1P3G A;  3X1U A;  2XD1 A;  3LZ1 B;  4XUJ B;  3MGS D;  3O62 B;  3R45 A;  4WZS B;  3VH5 A;  2ZY3 A;  5CPJ C;  1EQZ A;  1P3P A;  3WAA A;  5AV9 A;  1ZLA A;  5B0Z A;  1P3B C;  5AY8 C;  3F6T A;  4LD9 D;  4Z2M H;  5BT1 C;  3MGP D;  1P3L B;  3H0L C;  1S32 D;  4H9P B;  4QLC B;  3B6G B;  5B1L C;  5BNX B;  1ID3 B;  2F8N D;  3AZJ B;  1P3P D;  5AV6 A;  1H3O A;  4AWL B;  1P3B D;  3TU4 C;  4LD9 C;  1P3B B;  1ZLA C;  3LZ0 D;  1P3K C;  3KFU G;  2F8N K;  2JCH A;  2FJ7 D;  2Y2Q A;  4KUD B;  4YM6 A;  1JFI B;  2Y2P A;  1TZY B;  4J8W B;  1R4V A;  3X1S C;  5B1L A;  5JRG B;  5AV6 B;  5AVC D;  2FFF B;  1KX5 A;  4CSR B;  1P3B A;  2BYK A;  1M1A A;  3AYW A;  3V9R A;  1P3G D;  3AZM C;  3WTP A;  1TZY A;  4XUJ A;  4H9S A;  4QLC C;  3AZM A;  5B0Y D;  2NZD C;  3VH5 W;  1M1A B;  3C1B D;  2Y2N A;  3AZF B;  3AZH C;  1KX5 D;  3B0C T;  3B6F C;  3WAA B;  4YS3 B;  3W99 C;  4H9P A;  5DNM C;  1TZY C;  2G5I C;  2J8P A;  4Z2M G;  1P3L A;  3AZN C;  3WKJ A;  3WA9 D;  2HIO B;  3AZL C;  3AN2 A;  3TU4 B;  5B24 C;  1P3I C;  5F99 A;  3MGR A;  3LJA C;  4J8W C;  1Z2C B;  5GT3 C;  3UT9 B;  1T3U A;  4KHA B;  5BS7 C;  2F8N A;  4G91 B;  1PZR A;  5B31 D;  5JRG A;  4YM6 D;  3LJA D;  3W99 A;  3REI C;  4JJN B;  3REH D;  4WNN A;  3EPK A;  3AZG B;  2FJ7 C;  4JJN D;  4Z66 C;  2ARO B;  4UUZ A;  5B24 D;  5B32 C;  1P3I D;  3LZ0 B;  3WTP B;  3LEL B;  2DF4 C;  4R8P C;  5GT0 C;  3AZE D;  2CV5 A;  3W96 D;  1AOI C;  4KGC D;  3AV1 D;  5JRG D;  5B40 B;  1P3O D;  2Y2G A;  2Y2M A;  5BNV A;  5B1M C;  1P3O B;  3IP4 C;  3NQU B;  5AY8 D;  3KXB B;  3A6N B;  3AZE C;  3LEL A;  4XZQ A;  5G49 B;  5B0Y C;  2HIO C;  3W96 A;  3AZL B;  3MVD C;  5E5A C;  3W97 A;  5B33 A;  3KUY B;  3MGS B;  1HTA A;  5B1M B;  3REI B;  3AZG C;  1M19 A;  5E5A A;  1HQ3 B;  5F99 B;  4H9Q B;  5AVB C;  3C1B B;  3W98 B;  3B0B A;  5GSU B;  3MGQ B;  3AZE A;  2ZY4 A;  1N1J A;  1A7W A;  4KHA A;  1P3M A;  4X23 C;  3AYW D;  4ZUX D;  3UT9 A;  3B0D B;  1KX4 A;  2ARO C;  1F1E A;  2G5H C;  3B6G D;  3VH6 W;  4JJN A;  3O62 A;  1HQ3 A;  5AY8 A;  4NFT A;  5GT0 B;  2ARO A;  4UUZ B;  4R8P B;  3REK C;  4WNN B;  3AZE B;  1P3P C;  1U35 A;  1P3M B;  3MVD A;  3UTA B;  3AV1 A;  5DNM B;  1ULY A;  4ZUX A;  3UT9 D;  5CPK D;  1ID3 A;  3REI D;  4H9S C;  2LY8 A;  1TAF A;  4QLC A;  5AY8 B;  5B24 A;  5CPK B;  1P3I A;  5AVB A;  3AZH D;  2YFW B;  3FDD A;  5AV8 B;  2YFV B;  5B40 A;  3AZI C;  1BH8 B;  4KUD A;  1U35 D;  5B1L B;  3NQJ B;  4Z66 D;  4E45 A;  4J8V B;  5B24 B;  1P3I B;  1HQ3 D;  3LZ1 A;  4J8X B;  2Y2O A;  2BYK B;  5FUG A;  4XZQ D;  4X23 B;  2BYM B;  3MGQ C;  3AV2 A;  3AZF D;  1KX5 B;  1EQZ B;  2NQB A;  1M18 B;  3MGQ A;  3AV2 C;  3A6N D;  3W99 D;  3LJA A;  3EG5 B;  2CV5 C;  1KU5 A;  1P3K B;  3AZH A;  3AZM B;  1M19 D;  1AOI D;  1KX4 B;  4H9R A;  4ZBJ B;  1H3O B;  2CWE A;  1Q9C A;  5KDM B;  3UTA A;  5BNX A;  3WKJ C;  4YS3 A;  1S32 C;  3REH C;  5B40 C;  3AZI A;  3X1U D;  3AZH B;  2ARO D;  1JFI A;  3KWQ D;  5DNM A;  3X1U C;  3REJ B;  1P3O C;  4YM6 B;  3MGR C;  4WV4 B;  4G92 C;  1M1A D;  2F8N H;  2BG1 A;  3MNN A;  3B0C W;  5B2J D;  4CAY B;  3REK D;  1P3L C;  5E5A D;  4J8X A;  4H9N A;  3KWQ A;  5B0Y A;  3AZN B;  4J8V A;  3B6G C;  3AL0 C;  5B2J C;  3AV2 B;  2IO5 B;  3MNN B;  4X23 A;  2NQB D;  3LZ0 A;  5B2J A;  3C1C C;  4Z5T A;  4EO5 B;  1P3K A;  1B6W A;  3LJA B;  2ZY2 A;  3WKJ B;  5CPJ A;  1P3P B;  2FJ7 A;  3AZI D;  1P3O A;  3REK B;  3AZI B;  4YM6 C;  3MGR B;  3UTB B;  1WWI A;  5CP6 B;  4DRA A;  5B33 B;  3KUY A;  5CPK C;  3W97 B;  3REJ C;  2NZD B;  3WTP E;  1P3M D; 
#chains in the Genus database with same CATH homology
 4G92 B;  3R45 B;  4WU9 C;  3X1T C;  3REJ A;  3W96 C;  5CPJ D;  5GT0 D;  4R8P D;  3W98 A;  5B31 G;  1AOI B;  5E5A B;  3B6F A;  2XD5 A;  1P3K D;  4HGA B;  3TU4 D;  3AV2 D;  3KUY D;  2DQN C;  4WU9 D;  2CV5 B;  5CPI A;  2PYO B;  4WU9 B;  3C1C A;  3AN2 D;  5B0Y B;  4J8U D;  4EO5 C;  5JA4 B;  3AZN A;  3REJ D;  1KX4 C;  4J8X D;  3EPL A;  2Y2J A;  3NQU A;  3AV1 C;  5F99 C;  2W8S A;  1KX5 C;  4H9O A;  1P3F B;  3WKJ D;  4ZUX B;  3X1S A;  4WU9 A;  1F66 D;  4XUJ C;  5DNN B;  3WA9 C;  5AV8 A;  4JJN C;  1TAF B;  3X1V A;  5CPK A;  3P5J B;  3AZM D;  3REH A;  1M19 B;  3AZK A;  4M6B A;  2FJ7 B;  5AV6 C;  1BH8 A;  3REL D;  4KGC C;  3UTA D;  4G91 C;  4H9Q A;  3X1S D;  2NZD A;  1AOI A;  3AZJ C;  5B32 B;  3AZL D;  3REL C;  1M18 A;  1P3G B;  5GXQ A;  4ZUX C;  3MVD D;  1U35 B;  3AYW C;  5GT0 A;  5B2I B;  4R8P A;  3MVD B;  1P3A A;  2PYO A;  4KGC A;  3AFA C;  5B33 D;  3WTP D;  3W97 D;  2RIQ A;  3UTB D;  3MGP C;  3KWQ C;  3AFA A;  3C1C B;  3KSY A;  3AV1 B;  5AVB B;  3C1B C;  5KDM A;  4WU8 C;  3B6F D;  3AZG A;  5JRG C;  3REL A;  1M18 C;  5B0Z B;  1EQZ C;  5B0Z D;  3LZ1 C;  4Z66 A;  3MGS C;  4ZBJ C;  3KXB D;  4J8U A;  1BH9 A;  3AZK B;  5BO0 A;  3A6N C;  2CV5 D;  5BT1 D;  3REL B;  2BYM A;  3WAA C;  5B31 C;  1P34 B;  3A6N A;  4WJ3 C;  3MGQ D;  1WWS A;  3W98 D;  3X1U B;  4XZQ C;  5B32 D;  4J8W A;  2F8N G;  4DRB A;  3MGP B;  1P3L D;  3X1T D;  3LZ0 C;  5CHL B;  4LD9 B;  3AYW B;  3AZG D;  2PYO C;  3WAA D;  5B1M A;  1P3M C;  2Y2L A;  1P3G C;  1U35 C;  4Z5T B;  5B2I A;  1P3A B;  2RVQ C;  1ID3 D;  3MGR D;  5AVC C;  4XZQ B;  2RVQ D;  5AV8 C;  5DNM D;  1W2E A;  5B40 D;  2IO5 C;  3MNN C;  3UT9 C;  1P3F C;  3VH6 T;  3MNN D;  5AV9 D;  5AV5 A;  1KX3 B;  3AZF A;  1BFM A;  1P34 C;  3EPJ A;  3REK A;  1KX4 D;  3WTP C;  1BH9 B;  4NE5 A;  3X1T A;  1M19 C;  3UTB A;  2HUE C;  5B1L D;  4Z66 B;  3TU4 A;  2NQB C;  3AZK C;  5C3I B;  4J8U B;  5DNN C;  2HIO A;  3AN2 B;  1KX3 A;  3WA9 A;  2YFV A;  5CP6 D;  3AZF C;  3AZJ D;  3H0R C;  5GT3 D;  3KXB C;  5AVB D;  4YS3 D;  3B6F B;  3X1T B;  4QLC D;  4DQY B;  1HQ3 C;  3V9R B;  4YS3 C;  1EQZ D;  5AV9 C;  5B2I C;  4E44 A;  2ZM5 A;  5AVC A;  5GXQ D;  5CP6 C;  1F66 B;  2UWX A;  4WU8 A;  2JSS A;  2HIO D;  4LD9 A;  4AWL C;  3AZN D;  3AZK D;  1ID3 C;  3O62 D;  1TZY D;  3AFA D;  3LZ1 D;  2HUE B;  5B0Z C;  5B1M D;  2NQB B;  5DNN A;  3NQJ A;  5GXQ C;  3X1S B;  5AV5 D;  4WU8 B;  2PYO D;  4KUD C;  5GSU D;  5AV5 B;  5CP6 A;  4WU8 D;  5F99 D;  4H9R B;  3H0M C;  5FUG B;  3KXB A;  3X1V B;  5GT3 B;  3REH B;  3X1V D;  4J8U C;  3EPH A;  3AZL A;  3AN2 C;  5B31 B;  4Z5T D;  5G49 A;  5DNN D;  2Y2H A;  5CPI D;  2F8N B;  5CPI B;  4X23 D;  3WA9 B;  2VQR A;  2ZY5 A;  3X1V C;  3C1B A;  5GT3 A;  2JE5 A;  5B32 A;  4J8W D;  4XUJ D;  1F66 C;  4KGC B;  4CAY A;  5JA4 A;  3W99 B;  4KUD D;  1M1A C;  2F2A C;  5AV9 B;  1KX3 D;  1M18 D;  5GXQ B;  1F66 A;  5AVC B;  5AV6 D;  1ZLA D;  5AV8 D;  1P3A C;  4H9O B;  1P3F A;  4J8X C;  2L5A A;  3AZJ A;  4Z5T C;  4J8V C;  1S32 A;  3AFA B;  5BNV B;  3B6G A;  4J8V D;  3A1I A;  4NE3 A;  3KUY C;  3B0D C;  4HGA C;  1P34 D;  1B67 A;  5B2I D;  5GSU C;  3W96 B;  5AV5 C;  4H9N B;  3KWQ B;  2NZD D;  5BO0 B;  3C1C D;  1P3F D;  1KX3 C;  3MGS A;  1S32 B;  3W98 C;  3REI A;  2Y2K A;  4UPK A;  3VH5 T;  2YFW A;  3O62 C;  5CPJ B;  2Y2I A;  3UTB C;  3UTA C;  5B33 C;  3W97 C;  5BS7 A;  5C3I C;  5B2J B;  3VH6 A;  5B32 G;  4CSR A;  3LEL D;  1P3A D;  4NE6 A;  1N1J B;  1ZLA B;  1P34 A;  5B31 A;  3MGP A;  5CPI C;  3LEL C;  5GSU A;  3A1K A;  1P3G A;  3X1U A;  2XD1 A;  3LZ1 B;  4XUJ B;  3MGS D;  3O62 B;  3R45 A;  4WZS B;  3VH5 A;  2ZY3 A;  5CPJ C;  1EQZ A;  1P3P A;  3WAA A;  5AV9 A;  1ZLA A;  5B0Z A;  1P3B C;  5AY8 C;  3F6T A;  4LD9 D;  4Z2M H;  5BT1 C;  3MGP D;  1P3L B;  3H0L C;  1S32 D;  4H9P B;  4QLC B;  3B6G B;  5B1L C;  5BNX B;  1ID3 B;  2F8N D;  3AZJ B;  1P3P D;  5AV6 A;  1H3O A;  4AWL B;  1P3B D;  3TU4 C;  4LD9 C;  1P3B B;  1ZLA C;  3LZ0 D;  1P3K C;  3KFU G;  2F8N K;  2JCH A;  2FJ7 D;  2Y2Q A;  4KUD B;  4YM6 A;  1JFI B;  2Y2P A;  1TZY B;  4J8W B;  1R4V A;  3X1S C;  5B1L A;  5JRG B;  5AV6 B;  5AVC D;  2FFF B;  1KX5 A;  4CSR B;  1P3B A;  2BYK A;  1M1A A;  3AYW A;  3V9R A;  1P3G D;  3AZM C;  3WTP A;  1TZY A;  4XUJ A;  4H9S A;  4QLC C;  3AZM A;  5B0Y D;  2NZD C;  3VH5 W;  1M1A B;  3C1B D;  2Y2N A;  3AZF B;  3AZH C;  1KX5 D;  3B0C T;  3B6F C;  3WAA B;  4YS3 B;  3W99 C;  4H9P A;  5DNM C;  1TZY C;  2G5I C;  2J8P A;  4Z2M G;  1P3L A;  3AZN C;  3WKJ A;  3WA9 D;  2HIO B;  3AZL C;  3AN2 A;  3TU4 B;  5B24 C;  1P3I C;  5F99 A;  3MGR A;  3LJA C;  4J8W C;  1Z2C B;  5GT3 C;  3UT9 B;  1T3U A;  4KHA B;  5BS7 C;  2F8N A;  4G91 B;  1PZR A;  5B31 D;  5JRG A;  4YM6 D;  3LJA D;  3W99 A;  3REI C;  4JJN B;  3REH D;  4WNN A;  3EPK A;  3AZG B;  2FJ7 C;  4JJN D;  4Z66 C;  2ARO B;  4UUZ A;  5B24 D;  5B32 C;  1P3I D;  3LZ0 B;  3WTP B;  3LEL B;  2DF4 C;  4R8P C;  5GT0 C;  3AZE D;  2CV5 A;  3W96 D;  1AOI C;  4KGC D;  3AV1 D;  5JRG D;  5B40 B;  1P3O D;  2Y2G A;  2Y2M A;  5BNV A;  5B1M C;  1P3O B;  3IP4 C;  3NQU B;  5AY8 D;  3KXB B;  3A6N B;  3AZE C;  3LEL A;  4XZQ A;  5G49 B;  5B0Y C;  2HIO C;  3W96 A;  3AZL B;  3MVD C;  5E5A C;  3W97 A;  5B33 A;  3KUY B;  3MGS B;  1HTA A;  5B1M B;  3REI B;  3AZG C;  1M19 A;  5E5A A;  1HQ3 B;  5F99 B;  4H9Q B;  5AVB C;  3C1B B;  3W98 B;  3B0B A;  5GSU B;  3MGQ B;  3AZE A;  2ZY4 A;  1N1J A;  1A7W A;  4KHA A;  1P3M A;  4X23 C;  3AYW D;  4ZUX D;  3UT9 A;  3B0D B;  1KX4 A;  2ARO C;  1F1E A;  2G5H C;  3B6G D;  3VH6 W;  4JJN A;  3O62 A;  1HQ3 A;  5AY8 A;  4NFT A;  5GT0 B;  2ARO A;  4UUZ B;  4R8P B;  3REK C;  4WNN B;  3AZE B;  1P3P C;  1U35 A;  1P3M B;  3MVD A;  3UTA B;  3AV1 A;  5DNM B;  1ULY A;  4ZUX A;  3UT9 D;  5CPK D;  1ID3 A;  3REI D;  4H9S C;  2LY8 A;  1TAF A;  4QLC A;  5AY8 B;  5B24 A;  5CPK B;  1P3I A;  5AVB A;  3AZH D;  2YFW B;  3FDD A;  5AV8 B;  2YFV B;  5B40 A;  3AZI C;  1BH8 B;  4KUD A;  1U35 D;  5B1L B;  3NQJ B;  4Z66 D;  4E45 A;  4J8V B;  5B24 B;  1P3I B;  1HQ3 D;  3LZ1 A;  4J8X B;  2Y2O A;  2BYK B;  5FUG A;  4XZQ D;  4X23 B;  2BYM B;  3MGQ C;  3AV2 A;  3AZF D;  1KX5 B;  1EQZ B;  2NQB A;  1M18 B;  3MGQ A;  3AV2 C;  3A6N D;  3W99 D;  3LJA A;  3EG5 B;  2CV5 C;  1KU5 A;  1P3K B;  3AZH A;  3AZM B;  1M19 D;  1AOI D;  1KX4 B;  4H9R A;  4ZBJ B;  1H3O B;  2CWE A;  1Q9C A;  5KDM B;  3UTA A;  5BNX A;  3WKJ C;  4YS3 A;  1S32 C;  3REH C;  5B40 C;  3AZI A;  3X1U D;  3AZH B;  2ARO D;  1JFI A;  3KWQ D;  5DNM A;  3X1U C;  3REJ B;  1P3O C;  4YM6 B;  3MGR C;  4WV4 B;  4G92 C;  1M1A D;  2F8N H;  2BG1 A;  3MNN A;  3B0C W;  5B2J D;  4CAY B;  3REK D;  1P3L C;  5E5A D;  4J8X A;  4H9N A;  3KWQ A;  5B0Y A;  3AZN B;  4J8V A;  3B6G C;  3AL0 C;  5B2J C;  3AV2 B;  2IO5 B;  3MNN B;  4X23 A;  2NQB D;  3LZ0 A;  5B2J A;  3C1C C;  4Z5T A;  4EO5 B;  1P3K A;  1B6W A;  3LJA B;  2ZY2 A;  3WKJ B;  5CPJ A;  1P3P B;  2FJ7 A;  3AZI D;  1P3O A;  3REK B;  3AZI B;  4YM6 C;  3MGR B;  3UTB B;  1WWI A;  5CP6 B;  4DRA A;  5B33 B;  3KUY A;  5CPK C;  3W97 B;  3REJ C;  2NZD B;  3WTP E;  1P3M D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...