5E5AA

Crystal structure of the chromatin-tethering domain of human cytomegalovirus ie1 protein bound to the nucleosome core particle
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
99
structure length
99
Chain Sequence
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human cytomegalovirus IE1 protein alters the higher-order chromatin structure by targeting the acidic patch of the nucleosome
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/viral protein/dna
molecule keywords DNA (146-MER)
total genus 30
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5e5aA00
3X1UC 3UT9C 3B6FD 5DNND 1BH9B 3W96D 5B31G 5AVCB 3LELB 4X23C 4HGAC 5AV8A 4EO5B 4XUJD 4WU9B 1EQZA 3KWQD 3B0BA 3WA9A 4KHAA 2HUEC 3AFAB 1M18B 2FJ7A 5BNXA 3W97B 3LELD 4NE6A 4H9SC 4XZQD 1R4VA 5CPJD 5B2ID 3RELA 3MNND 3AFAC 1S32A 1P3IC 4ZBJB 4WU9A 4WU8A 3C1BD 3REJC 1M19C 1ID3A 3MGQA 3X1UD 3X1TA 3AZMD 5B31D 1U35D 2F8NH 3AYWA 1P3BD 1ULYA 3LZ1A 3REIA 1KX3A 3WA9C 4M6BA 5GT3B 4Z66B 3AZND 3C1CA 3AN2C 5B0ZD 1P34D 3AZJC 3AN2A 1KX3C 2PYOB 2NZDD 4X23A 3AZJB 2NQBB 5B2IB 4Z5TD 4LD9D 1WWSA 3WA9B 1KX4D 4CAYB 4KHAB 5DNMA 3X1TB 1M19A 1ID3C 4H9OA 5AVBA 3W98D 3LZ1B 3REIB 4J8WD 5CPIB 3KXBD 5AV8D 5JRGC 3AZLC 1U35B 3MGRD 3O62A 3AZLA 2JSSA 1S32B 1AOID 4YM6B 1P3LA 1P3MD 2AROB 3W99B 1TAFB 3AZED 3LELA 1BFMA 2PYOD 3B6FB 4G91C 1F1EA 2HIOB 3AZHD 1P3PA 4Z2MH 5B33C 5FUGA 5CHLB 1EQZB 3MNNB 5B24C 3UTBD 5AV9A 2F8NK 4YS3B 3LJAB 4ZUXD 4CSRA 4G92C 3LZ1C 3REIC 1A7WA 3TU4A 3W99A 3AYWC 2F8NA 3MGPB 3MGRB 5GSUA 3W97C 5B1MB 5B32C 3B0CT 1P3BA 4YM6C 5F99C 5GXQB 2HIOA 4H9QA 5E5AC 2CV5B 4HGAB 3KUYB 1P3ID 4AWLB 3AFAA 5B32B 4R8PD 4LD9B 5CPJC 1EQZD 3AV2D 4Z5TB 5B1MD 5AV5B 2PYOC 2F8NB 3AV1B 5CPKD 3B0DB 4WV4B 2YFVB 4AWLC 5AV6A 4Z66C 3AZKD 3AN2B 3W98B 3AZIC 3WKJC 5BS7A 3NQUB 4XZQA 2LY8A 3AZLD 5AY8D 4J8UD 5CP6D 5DNNA 5B40B 2BYMA 3MGQB 3AV2C 1KX4C 3X1SA 5CPKB 2RVQD 3UT9A 1P3FC 3X1UA 3AV1A 1P3KC 4KGCB 4XUJA 3AZMA 5JRGD 1U35A 3AV2B 3KWQA 3WA9D 3AZLB 1HQ3A 4EO5C 4KGCC 5AY8B 4J8UB 2FJ7D 1H3OB 3NQUA 3B6GD 3B0DC 3VH6A 3REKA 3KSYA 1P3KB 3AZNC 3AN2D 1M18A 3REJD 1P3GA 3TU4D 3REKC 5CPJA 2AROC 3UTAC 4Z5TA 5B31C 1KU5A 4KGCA 4QLCA 4XUJC 3B6GB 3C1BB 4H9NB 3KUYD 3VH5W 4YM6A 1P3LB 5GT3D 4WU8B 3AFAD 5B0ZB 1TAFA 4JJNA 3B0CW 3AYWD 5C3IC 1F66A 4UUZB 3R45B 3VH5T 3MGPD 1P34A 4H9QB 3AZEA 2YFWB 5GT3C 1ZLAB 4QLCB 4Z66A 3C1CB 1B67A 3AZGB 1P3AC 1P3OB 3KXBB 3V9RB 5AV6C 3MVDD 2BYKB 3REHB 1TZYB 3LZ0B 2YFVA 5AV6B 5AV5D 1AOIC 3W96B 3W99D 3AZEB 5B33B 5GSUD 3AZFD 1S32D 5JRGB 5B24B 1P3BC 3W98C 3LZ0C 4WU9D 2CV5D 2IO5B 3B6GA 3AZMC 3REHD 5AVBC 3W99C 1M1AA 5CP6B 3MGSD 1F66B 4CAYA 5DNMB 3AV2A 5AV9C 1KX3D 1KX5B 5CPIC 3AZFC 5B33A 4XZQC 5E5AB 3AZKB 5GT0B 3LZ0D 3WKJA 2NZDA 3AZKC 5G49B 5AVCC 3MVDC 3AZFB 5B1LD 5DNMD 3AYWB 3X1TC 1F66D 1M19D 5B31B 5B1MC 5AVBD 1JFIA 4WU8C 3AZMB 4KUDC 4J8XB 4H9NA 1P3IA 3AV1D 1H3OA 1P3AD 3WTPE 5E5AA 4JJNB 3WAAD 5JRGA 5AV9B 1BH8A 5JA4B 1N1JB 5B32A 3MVDA 5AV6D 4G91B 1BH9A 3WAAC 4J8VD 4H9PA 1EQZC 4ZUXC 3A6NB 3WAAB 5AV9D 3AZIB 5B2JD 4KGCD 4KUDD 4ZUXA 4X23B 3AZJA 2CV5A 1P3PC 3C1CC 3UT9D 3B6FC 3KUYA 4J8XC 1N1JA 4YM6D 3R45A 5AVCD 1HQ3D 3X1UB 1S32C 1HTAA 2HIOD 1ZLAA 3VH5A 3O62C 3RELC 3AZGA 4CSRB 1P3KD 1ZLAC 5GT0D 1M1AB 4R8PA 4H9SA 5GSUB 5B1MA 3B6FA 1TZYD 2CV5C 1P3PB 3AZKA 2NZDC 5AY8C 5GT3A 4J8UC 4JJND 4NE5A 1HQ3B 3WAAA 3AZFA 5AY8A 4J8UA 2RVQC 4R8PB 3X1SD 3REKB 3X1VB 4YS3C 5CP6C 1M1AD 1M19B 4WZSB 4WNNA 3NQJB 1P34B 4J8VA 3A6ND 4R8PC 1P3OD 2L5AA 1WWIA 4KUDA 3AZGC 5CPKC 3REKD 3X1SB 5BT1D 3AZHC 3X1VD 1M18D 5F99D 2HUEB 1M18C 3UT9B 5GXQD 2BYKA 4YS3D 5AVCA 2FJ7C 1P3MC 5B0YC 4UUZA 5B24D 3KUYC 4J8XA 3LZ1D 3REID 5AV8B 3KWQC 4J8VB 3C1BC 3VH6T 2YFWA 4XZQB 3AV1C 5CPIA 5AV8C 1P3KA 3MGSA 5B32G 4H9RB 5DNNB 5B40A 1BH8B 2AROD 4NE3A 5JA4A 2FJ7B 3UTAB 3O62B 3MVDB 5GXQC 2NQBC 5DNNC 1KX4A 1M1AC 1F66C 5BT1C 3MGPA 2F8NG 4LD9C 4XUJB 1TZYA 3B6GC 3LZ0A 3WKJD 1B6WA 3WTPC 1KX5A 3WTPD 4Z66D 3AZNB 5GT0C 4ZUXB 3A6NC 5B2IA 3RELD 3MNNA 5B1LB 1P3FD 3MGSB 5B0YB 1AOIA 2NQBD 5BO0A 5B2JA 1P3GB 3UTAA 4WU8D 3W96C 1P3GC 5AV5A 1ID3D 2CWEA 1P3AA 5B1LC 5E5AD 3X1TD 2HIOC 1P3BB 3KXBC 1P3OA 1P3IB 5B0YD 3UTBA 5B32D 1P3FB 1HQ3C 1U35C 1TZYC 1P34C 4E44A 5B0ZA 3REHA 3WKJB 3X1VA 3WTPB 3X1VC 4H9OB 2F8ND 5FUGB 5B40C 1KX4B 3UTBC 3MGSC 5B24A 1P3AB 4J8XD 1P3OC 5C3IB 4H9PB 3AZJD 5B33D 5B0ZC 4Z2MG 3LJAA 3W98A 3VH6W 3AZIA 4J8WA 3KXBA 4NFTA 3V9RA 3LELC 2AROA 4DRAA 3W97D 3MGRA 5B1LA 1P3LD 1P3LC 3W96A 3C1CD 3MGRC 3AZGD 5CPKA 1Q9CA 4E45A 5GT0A 4J8WC 5F99B 1KX3B 1KX5D 4X23D 1P3MB 3MNNC 3RELB 3LJAC 3A6NA 4LD9A 3KWQB 4J8VC 4ZBJC 3UTBB 1P3FA 5DNMC 5CP6A 3TU4B 2NQBA 4G92B 5BNVB 3REJB 3AZEC 3UTAD 3AZHB 3X1SC 1JFIB 3TU4C 5AVBB 5GXQA 2IO5C 3REHC 4JJNC 3O62D 5BS7C 2NZDB 5B0YA 1P3MA 1AOIB 5KDMA 4H9RA 5G49A 3C1BA 4QLCC 2PYOA 3MGQD 4J8WB 3MGQC 5CPID 5AV5C 5BNVA 3REJA 1P3GD 4Z5TC 5B31A 5B40D 3AZHA 1P3PD 4WU9C 5B2JC 4DRBA 1ZLAD 4WNNB 3NQJA 3AZNA 4QLCD 5B2IC 3LJAD 5F99A 1ID3B 3AZID 3WTPA 5KDMB 1KX5C 4YS3A 4KUDB 2BYMB 5B2JB 5BO0B 3W97A 5BNXB 5GSUC 5CPJB 3MGPC
chains in the Genus database with same CATH superfamily
3X1UC 3UT9C 3B6FD 3FDDA 5DNND 1BH9B 3W96D 5B31G 5AVCB 3LELB 4X23C 4HGAC 5AV8A 2G5IC 4EO5B 4XUJD 4WU9B 1EQZA 3KWQD 3B0BA 3WA9A 4KHAA 2HUEC 3AFAB 1M18B 2UWXA 5BNXA 2FJ7A 2ZY2A 3W97B 3LELD 4NE6A 3H0MC 4H9SC 4XZQD 1R4VA 5CPJD 5B2ID 3RELA 3MNND 3AFAC 1S32A 1P3IC 4ZBJB 4WU9A 4WU8A 3C1BD 3REJC 1M19C 1ID3A 3MGQA 3X1UD 3X1TA 3AZMD 5B31D 1U35D 2F8NH 2Y2IA 3AYWA 1P3BD 1ULYA 3H0RC 3LZ1A 3REIA 1KX3A 3WA9C 4M6BA 5GT3B 4Z66B 3AZND 3C1CA 3AN2C 5B0ZD 1P34D 3AZJC 3AN2A 1KX3C 2PYOB 2NZDD 4X23A 3AZJB 2NQBB 5B2IB 4Z5TD 4LD9D 1WWSA 1PZRA 3WA9B 1KX4D 4CAYB 4KHAB 5DNMA 3X1TB 1M19A 1ID3C 4H9OA 5AVBA 3W98D 3LZ1B 3REIB 4J8WD 5CPIB 3KXBD 5AV8D 5JRGC 3AZLC 2ZY3A 1U35B 3MGRD 3O62A 3AZLA 1T3UA 2JSSA 1S32B 1AOID 4YM6B 1P3LA 1P3MD 2AROB 3W99B 1TAFB 3AZED 3LELA 1BFMA 2PYOD 3B6FB 4G91C 1F1EA 2HIOB 3AZHD 1P3PA 4Z2MH 5B33C 5FUGA 5CHLB 1EQZB 3MNNB 5B24C 3UTBD 5AV9A 2F8NK 4YS3B 3LJAB 4ZUXD 4CSRA 4G92C 3LZ1C 3REIC 1A7WA 3TU4A 3W99A 3AYWC 2F8NA 3MGPB 3MGRB 5GSUA 3W97C 5B1MB 5B32C 3B0CT 1P3BA 4YM6C 5F99C 5GXQB 2HIOA 4H9QA 5E5AC 2CV5B 4HGAB 2FFFB 3KUYB 1P3ID 4AWLB 3H0LC 5B32B 3AFAA 4R8PD 4LD9B 5CPJC 1EQZD 3AV2D 4Z5TB 5B1MD 5AV5B 3KFUG 2F2AC 2PYOC 2F8NB 3AV1B 5CPKD 3B0DB 4WV4B 2YFVB 4AWLC 5AV6A 4Z66C 3AZKD 3AN2B 3W98B 3AZIC 3WKJC 5BS7A 2ZY4A 3NQUB 4XZQA 2LY8A 3AZLD 5AY8D 4J8UD 5CP6D 5DNNA 5B40B 2BYMA 3MGQB 3AV2C 1KX4C 3X1SA 2Y2PA 5CPKB 2RVQD 3UT9A 1P3FC 3X1UA 3AV1A 1P3KC 4KGCB 4XUJA 3AZMA 5JRGD 1U35A 3AV2B 3KWQA 3WA9D 3AZLB 1HQ3A 4EO5C 4KGCC 5AY8B 4J8UB 2FJ7D 1H3OB 3NQUA 4UPKA 3B6GD 3B0DC 3VH6A 3REKA 3KSYA 1P3KB 3AZNC 3AN2D 1M18A 3REJD 1P3GA 3TU4D 3REKC 5CPJA 2AROC 3UTAC 4Z5TA 5B31C 1KU5A 4KGCA 4QLCA 4XUJC 3B6GB 3C1BB 4H9NB 3KUYD 3VH5W 4YM6A 1P3LB 5GT3D 4WU8B 3AFAD 5B0ZB 1TAFA 4JJNA 3B0CW 3AYWD 5C3IC 1F66A 4UUZB 3R45B 3VH5T 3MGPD 1P34A 4H9QB 3AZEA 2YFWB 5GT3C 1ZLAB 4QLCB 4Z66A 3C1CB 1B67A 3AZGB 1P3AC 1P3OB 3KXBB 3V9RB 5AV6C 3MVDD 2BYKB 3REHB 1TZYB 3LZ0B 2YFVA 5AV6B 4WJ3C 5AV5D 1AOIC 3W96B 3W99D 3AZEB 3P5JB 5B33B 5GSUD 3AZFD 1S32D 5JRGB 5B24B 1P3BC 3W98C 3LZ0C 4WU9D 2CV5D 2IO5B 3B6GA 3AZMC 3REHD 5AVBC 3W99C 1M1AA 3A1KA 5CP6B 3MGSD 1F66B 4CAYA 5DNMB 3AV2A 5AV9C 1KX3D 1KX5B 5CPIC 3AZFC 5B33A 3EPKA 4XZQC 5E5AB 3AZKB 5GT0B 3LZ0D 3WKJA 2NZDA 3AZKC 5G49B 5AVCC 3MVDC 3AZFB 1W2EA 5B1LD 5DNMD 3AYWB 3X1TC 1F66D 2J8PA 1M19D 5B31B 5B1MC 5AVBD 2JE5A 1JFIA 4WU8C 3AZMB 4KUDC 4J8XB 4H9NA 1P3IA 3AV1D 1H3OA 1P3AD 3WTPE 5E5AA 2Y2NA 4JJNB 3WAAD 5JRGA 5AV9B 2Y2JA 1BH8A 5JA4B 1N1JB 5B32A 3MVDA 5AV6D 4G91B 1BH9A 3WAAC 4J8VD 4H9PA 1EQZC 4ZUXC 3A6NB 3WAAB 5AV9D 3AZIB 5B2JD 4KGCD 4KUDD 4ZUXA 4X23B 3AZJA 2CV5A 1P3PC 3C1CC 3UT9D 3B6FC 3KUYA 3EG5B 2BG1A 4J8XC 1N1JA 4YM6D 3EPJA 3R45A 5AVCD 3EPLA 1HQ3D 3X1UB 1S32C 1HTAA 2HIOD 1ZLAA 3VH5A 3O62C 3RELC 3AZGA 4CSRB 1P3KD 1ZLAC 5GT0D 1M1AB 4R8PA 2Y2OA 4H9SA 5GSUB 5B1MA 3B6FA 1TZYD 2CV5C 1P3PB 3AZKA 2NZDC 5AY8C 5GT3A 4J8UC 4JJND 4NE5A 1HQ3B 3AL0C 3WAAA 2ZM5A 3AZFA 5AY8A 4J8UA 2RVQC 4DQYB 4R8PB 3X1SD 3REKB 3X1VB 4YS3C 5CP6C 2Y2QA 1M1AD 1M19B 4WZSB 4WNNA 3NQJB 1P34B 4J8VA 3A6ND 4R8PC 1P3OD 2L5AA 1WWIA 4KUDA 3AZGC 3A1IA 5CPKC 3REKD 3X1SB 3F6TA 5BT1D 3AZHC 3X1VD 1M18D 5F99D 2HUEB 1M18C 3UT9B 2W8SA 5GXQD 2BYKA 4YS3D 5AVCA 2FJ7C 1P3MC 5B0YC 4UUZA 5B24D 3KUYC 4J8XA 3LZ1D 3REID 5AV8B 3KWQC 4J8VB 3C1BC 3VH6T 2YFWA 4XZQB 3AV1C 5CPIA 5AV8C 1P3KA 3MGSA 5B32G 4H9RB 5B40A 5DNNB 5JA4A 1BH8B 2AROD 4NE3A 2FJ7B 3UTAB 3O62B 3MVDB 5GXQC 2NQBC 5DNNC 1KX4A 1M1AC 1F66C 5BT1C 3MGPA 2F8NG 4LD9C 4XUJB 1TZYA 3B6GC 3LZ0A 3WKJD 1B6WA 3WTPC 1KX5A 3WTPD 4Z66D 3AZNB 5GT0C 4ZUXB 3A6NC 5B2IA 3RELD 2Y2HA 3MNNA 5B1LB 2ZY5A 1P3FD 3MGSB 5B0YB 1AOIA 2Y2KA 2NQBD 5BO0A 5B2JA 1P3GB 3UTAA 4WU8D 3W96C 1P3GC 5AV5A 1ID3D 2CWEA 1P3AA 5B1LC 5E5AD 3X1TD 2Y2MA 2XD1A 2HIOC 2Y2GA 1P3BB 1Z2CB 3KXBC 1P3OA 1P3IB 5B0YD 3UTBA 5B32D 1P3FB 1HQ3C 1U35C 1TZYC 1P34C 4E44A 5B0ZA 3REHA 3WKJB 3X1VA 3WTPB 3X1VC 4H9OB 2F8ND 5FUGB 5B40C 1KX4B 3UTBC 3MGSC 5B24A 1P3AB 4J8XD 1P3OC 5C3IB 4H9PB 3AZJD 5B33D 5B0ZC 4Z2MG 3LJAA 3W98A 3VH6W 3AZIA 4J8WA 3KXBA 4NFTA 3V9RA 3LELC 2AROA 4DRAA 3W97D 3MGRA 5B1LA 3IP4C 1P3LD 1P3LC 2DQNC 3W96A 3C1CD 3MGRC 3AZGD 5CPKA 1Q9CA 4E45A 5GT0A 4J8WC 5F99B 1KX3B 1KX5D 4X23D 1P3MB 3MNNC 3RELB 3LJAC 3A6NA 4LD9A 3KWQB 4J8VC 4ZBJC 3UTBB 1P3FA 5DNMC 5CP6A 3TU4B 2NQBA 4G92B 5BNVB 3REJB 3AZEC 3UTAD 3AZHB 3X1SC 1JFIB 3TU4C 5AVBB 5GXQA 2IO5C 3REHC 4JJNC 3EPHA 3O62D 5BS7C 2VQRA 2NZDB 5B0YA 1P3MA 1AOIB 5KDMA 4H9RA 2G5HC 5G49A 3C1BA 4QLCC 2PYOA 3MGQD 4J8WB 3MGQC 5CPID 5AV5C 5BNVA 3REJA 2XD5A 4Z5TC 5B31A 5B40D 3AZHA 1P3GD 1P3PD 4WU9C 5B2JC 4DRBA 2Y2LA 1ZLAD 4WNNB 3NQJA 3AZNA 4QLCD 5B2IC 3LJAD 5F99A 2JCHA 1ID3B 3AZID 3WTPA 5KDMB 1KX5C 4YS3A 4KUDB 2RIQA 2BYMB 5B2JB 5BO0B 2DF4C 3W97A 5BNXB 5GSUC 5CPJB 3MGPC
chains in the Genus database with same CATH topology
3X1UC 3UT9C 3B6FD 3FDDA 5DNND 1BH9B 3W96D 5B31G 5AVCB 3LELB 4X23C 4HGAC 5AV8A 2G5IC 4EO5B 4XUJD 4WU9B 1EQZA 3KWQD 3B0BA 3WA9A 4KHAA 2HUEC 3AFAB 1M18B 2UWXA 5BNXA 2FJ7A 2ZY2A 3W97B 3LELD 4NE6A 3H0MC 4H9SC 4XZQD 1R4VA 5CPJD 5B2ID 3RELA 3MNND 3AFAC 1S32A 1P3IC 4ZBJB 4WU9A 4WU8A 3C1BD 3REJC 1M19C 1ID3A 3MGQA 3X1UD 3X1TA 3AZMD 5B31D 1U35D 2F8NH 2Y2IA 3AYWA 1P3BD 1ULYA 3H0RC 3LZ1A 3REIA 1KX3A 3WA9C 4M6BA 5GT3B 4Z66B 3AZND 3C1CA 3AN2C 5B0ZD 1P34D 3AZJC 3AN2A 1KX3C 2PYOB 2NZDD 4X23A 3AZJB 2NQBB 5B2IB 4Z5TD 4LD9D 1WWSA 1PZRA 3WA9B 1KX4D 4CAYB 4KHAB 5DNMA 3X1TB 1M19A 1ID3C 4H9OA 5AVBA 3W98D 3LZ1B 3REIB 4J8WD 5CPIB 3KXBD 5AV8D 5JRGC 3AZLC 2ZY3A 1U35B 3MGRD 3O62A 3AZLA 1T3UA 2JSSA 1S32B 1AOID 4YM6B 1P3LA 1P3MD 2AROB 3W99B 1TAFB 3AZED 3LELA 1BFMA 2PYOD 3B6FB 4G91C 1F1EA 2HIOB 3AZHD 1P3PA 4Z2MH 5B33C 5FUGA 5CHLB 1EQZB 3MNNB 5B24C 3UTBD 5AV9A 2F8NK 4YS3B 3LJAB 4ZUXD 4CSRA 4G92C 3LZ1C 3REIC 1A7WA 3TU4A 3W99A 3AYWC 2F8NA 3MGPB 3MGRB 5GSUA 3W97C 5B1MB 5B32C 3B0CT 1P3BA 4YM6C 5F99C 5GXQB 2HIOA 4H9QA 5E5AC 2CV5B 4HGAB 2FFFB 3KUYB 1P3ID 4AWLB 3H0LC 5B32B 3AFAA 4R8PD 4LD9B 5CPJC 1EQZD 3AV2D 4Z5TB 5B1MD 5AV5B 3KFUG 2F2AC 2PYOC 2F8NB 3AV1B 5CPKD 3B0DB 4WV4B 2YFVB 4AWLC 5AV6A 4Z66C 3AZKD 3AN2B 3W98B 3AZIC 3WKJC 5BS7A 2ZY4A 3NQUB 4XZQA 2LY8A 3AZLD 5AY8D 4J8UD 5CP6D 5DNNA 5B40B 2BYMA 3MGQB 3AV2C 1KX4C 3X1SA 2Y2PA 5CPKB 2RVQD 3UT9A 1P3FC 3X1UA 3AV1A 1P3KC 4KGCB 4XUJA 3AZMA 5JRGD 1U35A 3AV2B 3KWQA 3WA9D 3AZLB 1HQ3A 4EO5C 4KGCC 5AY8B 4J8UB 2FJ7D 1H3OB 3NQUA 4UPKA 3B6GD 3B0DC 3VH6A 3REKA 3KSYA 1P3KB 3AZNC 3AN2D 1M18A 3REJD 1P3GA 3TU4D 3REKC 5CPJA 2AROC 3UTAC 4Z5TA 5B31C 1KU5A 4KGCA 4QLCA 4XUJC 3B6GB 3C1BB 4H9NB 3KUYD 3VH5W 4YM6A 1P3LB 5GT3D 4WU8B 3AFAD 5B0ZB 1TAFA 4JJNA 3B0CW 3AYWD 5C3IC 1F66A 4UUZB 3R45B 3VH5T 3MGPD 1P34A 4H9QB 3AZEA 2YFWB 5GT3C 1ZLAB 4QLCB 4Z66A 3C1CB 1B67A 3AZGB 1P3AC 1P3OB 3KXBB 3V9RB 5AV6C 3MVDD 2BYKB 3REHB 1TZYB 3LZ0B 2YFVA 5AV6B 4WJ3C 5AV5D 1AOIC 3W96B 3W99D 3AZEB 3P5JB 5B33B 5GSUD 3AZFD 1S32D 5JRGB 5B24B 1P3BC 3W98C 3LZ0C 4WU9D 2CV5D 2IO5B 3B6GA 3AZMC 3REHD 5AVBC 3W99C 1M1AA 3A1KA 5CP6B 3MGSD 1F66B 4CAYA 5DNMB 3AV2A 5AV9C 1KX3D 1KX5B 5CPIC 3AZFC 5B33A 3EPKA 4XZQC 5E5AB 3AZKB 5GT0B 3LZ0D 3WKJA 2NZDA 3AZKC 5G49B 5AVCC 3MVDC 3AZFB 1W2EA 5B1LD 5DNMD 3AYWB 3X1TC 1F66D 2J8PA 1M19D 5B31B 5B1MC 5AVBD 2JE5A 1JFIA 4WU8C 3AZMB 4KUDC 4J8XB 4H9NA 1P3IA 3AV1D 1H3OA 1P3AD 3WTPE 5E5AA 2Y2NA 4JJNB 3WAAD 5JRGA 5AV9B 2Y2JA 1BH8A 5JA4B 1N1JB 5B32A 3MVDA 5AV6D 4G91B 1BH9A 3WAAC 4J8VD 4H9PA 1EQZC 4ZUXC 3A6NB 3WAAB 5AV9D 3AZIB 5B2JD 4KGCD 4KUDD 4ZUXA 4X23B 3AZJA 2CV5A 1P3PC 3C1CC 3UT9D 3B6FC 3KUYA 3EG5B 2BG1A 4J8XC 1N1JA 4YM6D 3EPJA 3R45A 5AVCD 3EPLA 1HQ3D 3X1UB 1S32C 1HTAA 2HIOD 1ZLAA 3VH5A 3O62C 3RELC 3AZGA 4CSRB 1P3KD 1ZLAC 5GT0D 1M1AB 4R8PA 2Y2OA 4H9SA 5GSUB 5B1MA 3B6FA 1TZYD 2CV5C 1P3PB 3AZKA 2NZDC 5AY8C 5GT3A 4J8UC 4JJND 4NE5A 1HQ3B 3AL0C 3WAAA 2ZM5A 3AZFA 5AY8A 4J8UA 2RVQC 4DQYB 4R8PB 3X1SD 3REKB 3X1VB 4YS3C 5CP6C 2Y2QA 1M1AD 1M19B 4WZSB 4WNNA 3NQJB 1P34B 4J8VA 3A6ND 4R8PC 1P3OD 2L5AA 1WWIA 4KUDA 3AZGC 3A1IA 5CPKC 3REKD 3X1SB 3F6TA 5BT1D 3AZHC 3X1VD 1M18D 5F99D 2HUEB 1M18C 3UT9B 2W8SA 5GXQD 2BYKA 4YS3D 5AVCA 2FJ7C 1P3MC 5B0YC 4UUZA 5B24D 3KUYC 4J8XA 3LZ1D 3REID 5AV8B 3KWQC 4J8VB 3C1BC 3VH6T 2YFWA 4XZQB 3AV1C 5CPIA 5AV8C 1P3KA 3MGSA 5B32G 4H9RB 5B40A 5DNNB 5JA4A 1BH8B 2AROD 4NE3A 2FJ7B 3UTAB 3O62B 3MVDB 5GXQC 2NQBC 5DNNC 1KX4A 1M1AC 1F66C 5BT1C 3MGPA 2F8NG 4LD9C 4XUJB 1TZYA 3B6GC 3LZ0A 3WKJD 1B6WA 3WTPC 1KX5A 3WTPD 4Z66D 3AZNB 5GT0C 4ZUXB 3A6NC 5B2IA 3RELD 2Y2HA 3MNNA 5B1LB 2ZY5A 1P3FD 3MGSB 5B0YB 1AOIA 2Y2KA 2NQBD 5BO0A 5B2JA 1P3GB 3UTAA 4WU8D 3W96C 1P3GC 5AV5A 1ID3D 2CWEA 1P3AA 5B1LC 5E5AD 3X1TD 2Y2MA 2XD1A 2HIOC 2Y2GA 1P3BB 1Z2CB 3KXBC 1P3OA 1P3IB 5B0YD 3UTBA 5B32D 1P3FB 1HQ3C 1U35C 1TZYC 1P34C 4E44A 5B0ZA 3REHA 3WKJB 3X1VA 3WTPB 3X1VC 4H9OB 2F8ND 5FUGB 5B40C 1KX4B 3UTBC 3MGSC 5B24A 1P3AB 4J8XD 1P3OC 5C3IB 4H9PB 3AZJD 5B33D 5B0ZC 4Z2MG 3LJAA 3W98A 3VH6W 3AZIA 4J8WA 3KXBA 4NFTA 3V9RA 3LELC 2AROA 4DRAA 3W97D 3MGRA 5B1LA 3IP4C 1P3LD 1P3LC 2DQNC 3W96A 3C1CD 3MGRC 3AZGD 5CPKA 1Q9CA 4E45A 5GT0A 4J8WC 5F99B 1KX3B 1KX5D 4X23D 1P3MB 3MNNC 3RELB 3LJAC 3A6NA 4LD9A 3KWQB 4J8VC 4ZBJC 3UTBB 1P3FA 5DNMC 5CP6A 3TU4B 2NQBA 4G92B 5BNVB 3REJB 3AZEC 3UTAD 3AZHB 3X1SC 1JFIB 3TU4C 5AVBB 5GXQA 2IO5C 3REHC 4JJNC 3EPHA 3O62D 5BS7C 2VQRA 2NZDB 5B0YA 1P3MA 1AOIB 5KDMA 4H9RA 2G5HC 5G49A 3C1BA 4QLCC 2PYOA 3MGQD 4J8WB 3MGQC 5CPID 5AV5C 5BNVA 3REJA 2XD5A 4Z5TC 5B31A 5B40D 3AZHA 1P3GD 1P3PD 4WU9C 5B2JC 4DRBA 2Y2LA 1ZLAD 4WNNB 3NQJA 3AZNA 4QLCD 5B2IC 3LJAD 5F99A 2JCHA 1ID3B 3AZID 3WTPA 5KDMB 1KX5C 4YS3A 4KUDB 2RIQA 2BYMB 5B2JB 5BO0B 2DF4C 3W97A 5BNXB 5GSUC 5CPJB 3MGPC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X1U C;  3UT9 C;  3B6F D;  5DNN D;  1BH9 B;  3W96 D;  5B31 G;  5AVC B;  3LEL B;  4X23 C;  4HGA C;  5AV8 A;  4EO5 B;  4XUJ D;  4WU9 B;  1EQZ A;  3KWQ D;  3B0B A;  3WA9 A;  4KHA A;  2HUE C;  3AFA B;  1M18 B;  2FJ7 A;  5BNX A;  3W97 B;  3LEL D;  4NE6 A;  4H9S C;  4XZQ D;  1R4V A;  5CPJ D;  5B2I D;  3REL A;  3MNN D;  3AFA C;  1S32 A;  1P3I C;  4ZBJ B;  4WU9 A;  4WU8 A;  3C1B D;  3REJ C;  1M19 C;  1ID3 A;  3MGQ A;  3X1U D;  3X1T A;  3AZM D;  5B31 D;  1U35 D;  2F8N H;  3AYW A;  1P3B D;  1ULY A;  3LZ1 A;  3REI A;  1KX3 A;  3WA9 C;  4M6B A;  5GT3 B;  4Z66 B;  3AZN D;  3C1C A;  3AN2 C;  5B0Z D;  1P34 D;  3AZJ C;  3AN2 A;  1KX3 C;  2PYO B;  2NZD D;  4X23 A;  3AZJ B;  2NQB B;  5B2I B;  4Z5T D;  4LD9 D;  1WWS A;  3WA9 B;  1KX4 D;  4CAY B;  4KHA B;  5DNM A;  3X1T B;  1M19 A;  1ID3 C;  4H9O A;  5AVB A;  3W98 D;  3LZ1 B;  3REI B;  4J8W D;  5CPI B;  3KXB D;  5AV8 D;  5JRG C;  3AZL C;  1U35 B;  3MGR D;  3O62 A;  3AZL A;  2JSS A;  1S32 B;  1AOI D;  4YM6 B;  1P3L A;  1P3M D;  2ARO B;  3W99 B;  1TAF B;  3AZE D;  3LEL A;  1BFM A;  2PYO D;  3B6F B;  4G91 C;  1F1E A;  2HIO B;  3AZH D;  1P3P A;  4Z2M H;  5B33 C;  5FUG A;  5CHL B;  1EQZ B;  3MNN B;  5B24 C;  3UTB D;  5AV9 A;  2F8N K;  4YS3 B;  3LJA B;  4ZUX D;  4CSR A;  4G92 C;  3LZ1 C;  3REI C;  1A7W A;  3TU4 A;  3W99 A;  3AYW C;  2F8N A;  3MGP B;  3MGR B;  5GSU A;  3W97 C;  5B1M B;  5B32 C;  3B0C T;  1P3B A;  4YM6 C;  5F99 C;  5GXQ B;  2HIO A;  4H9Q A;  5E5A C;  2CV5 B;  4HGA B;  3KUY B;  1P3I D;  4AWL B;  3AFA A;  5B32 B;  4R8P D;  4LD9 B;  5CPJ C;  1EQZ D;  3AV2 D;  4Z5T B;  5B1M D;  5AV5 B;  2PYO C;  2F8N B;  3AV1 B;  5CPK D;  3B0D B;  4WV4 B;  2YFV B;  4AWL C;  5AV6 A;  4Z66 C;  3AZK D;  3AN2 B;  3W98 B;  3AZI C;  3WKJ C;  5BS7 A;  3NQU B;  4XZQ A;  2LY8 A;  3AZL D;  5AY8 D;  4J8U D;  5CP6 D;  5DNN A;  5B40 B;  2BYM A;  3MGQ B;  3AV2 C;  1KX4 C;  3X1S A;  5CPK B;  2RVQ D;  3UT9 A;  1P3F C;  3X1U A;  3AV1 A;  1P3K C;  4KGC B;  4XUJ A;  3AZM A;  5JRG D;  1U35 A;  3AV2 B;  3KWQ A;  3WA9 D;  3AZL B;  1HQ3 A;  4EO5 C;  4KGC C;  5AY8 B;  4J8U B;  2FJ7 D;  1H3O B;  3NQU A;  3B6G D;  3B0D C;  3VH6 A;  3REK A;  3KSY A;  1P3K B;  3AZN C;  3AN2 D;  1M18 A;  3REJ D;  1P3G A;  3TU4 D;  3REK C;  5CPJ A;  2ARO C;  3UTA C;  4Z5T A;  5B31 C;  1KU5 A;  4KGC A;  4QLC A;  4XUJ C;  3B6G B;  3C1B B;  4H9N B;  3KUY D;  3VH5 W;  4YM6 A;  1P3L B;  5GT3 D;  4WU8 B;  3AFA D;  5B0Z B;  1TAF A;  4JJN A;  3B0C W;  3AYW D;  5C3I C;  1F66 A;  4UUZ B;  3R45 B;  3VH5 T;  3MGP D;  1P34 A;  4H9Q B;  3AZE A;  2YFW B;  5GT3 C;  1ZLA B;  4QLC B;  4Z66 A;  3C1C B;  1B67 A;  3AZG B;  1P3A C;  1P3O B;  3KXB B;  3V9R B;  5AV6 C;  3MVD D;  2BYK B;  3REH B;  1TZY B;  3LZ0 B;  2YFV A;  5AV6 B;  5AV5 D;  1AOI C;  3W96 B;  3W99 D;  3AZE B;  5B33 B;  5GSU D;  3AZF D;  1S32 D;  5JRG B;  5B24 B;  1P3B C;  3W98 C;  3LZ0 C;  4WU9 D;  2CV5 D;  2IO5 B;  3B6G A;  3AZM C;  3REH D;  5AVB C;  3W99 C;  1M1A A;  5CP6 B;  3MGS D;  1F66 B;  4CAY A;  5DNM B;  3AV2 A;  5AV9 C;  1KX3 D;  1KX5 B;  5CPI C;  3AZF C;  5B33 A;  4XZQ C;  5E5A B;  3AZK B;  5GT0 B;  3LZ0 D;  3WKJ A;  2NZD A;  3AZK C;  5G49 B;  5AVC C;  3MVD C;  3AZF B;  5B1L D;  5DNM D;  3AYW B;  3X1T C;  1F66 D;  1M19 D;  5B31 B;  5B1M C;  5AVB D;  1JFI A;  4WU8 C;  3AZM B;  4KUD C;  4J8X B;  4H9N A;  1P3I A;  3AV1 D;  1H3O A;  1P3A D;  3WTP E;  5E5A A;  4JJN B;  3WAA D;  5JRG A;  5AV9 B;  1BH8 A;  5JA4 B;  1N1J B;  5B32 A;  3MVD A;  5AV6 D;  4G91 B;  1BH9 A;  3WAA C;  4J8V D;  4H9P A;  1EQZ C;  4ZUX C;  3A6N B;  3WAA B;  5AV9 D;  3AZI B;  5B2J D;  4KGC D;  4KUD D;  4ZUX A;  4X23 B;  3AZJ A;  2CV5 A;  1P3P C;  3C1C C;  3UT9 D;  3B6F C;  3KUY A;  4J8X C;  1N1J A;  4YM6 D;  3R45 A;  5AVC D;  1HQ3 D;  3X1U B;  1S32 C;  1HTA A;  2HIO D;  1ZLA A;  3VH5 A;  3O62 C;  3REL C;  3AZG A;  4CSR B;  1P3K D;  1ZLA C;  5GT0 D;  1M1A B;  4R8P A;  4H9S A;  5GSU B;  5B1M A;  3B6F A;  1TZY D;  2CV5 C;  1P3P B;  3AZK A;  2NZD C;  5AY8 C;  5GT3 A;  4J8U C;  4JJN D;  4NE5 A;  1HQ3 B;  3WAA A;  3AZF A;  5AY8 A;  4J8U A;  2RVQ C;  4R8P B;  3X1S D;  3REK B;  3X1V B;  4YS3 C;  5CP6 C;  1M1A D;  1M19 B;  4WZS B;  4WNN A;  3NQJ B;  1P34 B;  4J8V A;  3A6N D;  4R8P C;  1P3O D;  2L5A A;  1WWI A;  4KUD A;  3AZG C;  5CPK C;  3REK D;  3X1S B;  5BT1 D;  3AZH C;  3X1V D;  1M18 D;  5F99 D;  2HUE B;  1M18 C;  3UT9 B;  5GXQ D;  2BYK A;  4YS3 D;  5AVC A;  2FJ7 C;  1P3M C;  5B0Y C;  4UUZ A;  5B24 D;  3KUY C;  4J8X A;  3LZ1 D;  3REI D;  5AV8 B;  3KWQ C;  4J8V B;  3C1B C;  3VH6 T;  2YFW A;  4XZQ B;  3AV1 C;  5CPI A;  5AV8 C;  1P3K A;  3MGS A;  5B32 G;  4H9R B;  5DNN B;  5B40 A;  1BH8 B;  2ARO D;  4NE3 A;  5JA4 A;  2FJ7 B;  3UTA B;  3O62 B;  3MVD B;  5GXQ C;  2NQB C;  5DNN C;  1KX4 A;  1M1A C;  1F66 C;  5BT1 C;  3MGP A;  2F8N G;  4LD9 C;  4XUJ B;  1TZY A;  3B6G C;  3LZ0 A;  3WKJ D;  1B6W A;  3WTP C;  1KX5 A;  3WTP D;  4Z66 D;  3AZN B;  5GT0 C;  4ZUX B;  3A6N C;  5B2I A;  3REL D;  3MNN A;  5B1L B;  1P3F D;  3MGS B;  5B0Y B;  1AOI A;  2NQB D;  5BO0 A;  5B2J A;  1P3G B;  3UTA A;  4WU8 D;  3W96 C;  1P3G C;  5AV5 A;  1ID3 D;  2CWE A;  1P3A A;  5B1L C;  5E5A D;  3X1T D;  2HIO C;  1P3B B;  3KXB C;  1P3O A;  1P3I B;  5B0Y D;  3UTB A;  5B32 D;  1P3F B;  1HQ3 C;  1U35 C;  1TZY C;  1P34 C;  4E44 A;  5B0Z A;  3REH A;  3WKJ B;  3X1V A;  3WTP B;  3X1V C;  4H9O B;  2F8N D;  5FUG B;  5B40 C;  1KX4 B;  3UTB C;  3MGS C;  5B24 A;  1P3A B;  4J8X D;  1P3O C;  5C3I B;  4H9P B;  3AZJ D;  5B33 D;  5B0Z C;  4Z2M G;  3LJA A;  3W98 A;  3VH6 W;  3AZI A;  4J8W A;  3KXB A;  4NFT A;  3V9R A;  3LEL C;  2ARO A;  4DRA A;  3W97 D;  3MGR A;  5B1L A;  1P3L D;  1P3L C;  3W96 A;  3C1C D;  3MGR C;  3AZG D;  5CPK A;  1Q9C A;  4E45 A;  5GT0 A;  4J8W C;  5F99 B;  1KX3 B;  1KX5 D;  4X23 D;  1P3M B;  3MNN C;  3REL B;  3LJA C;  3A6N A;  4LD9 A;  3KWQ B;  4J8V C;  4ZBJ C;  3UTB B;  1P3F A;  5DNM C;  5CP6 A;  3TU4 B;  2NQB A;  4G92 B;  5BNV B;  3REJ B;  3AZE C;  3UTA D;  3AZH B;  3X1S C;  1JFI B;  3TU4 C;  5AVB B;  5GXQ A;  2IO5 C;  3REH C;  4JJN C;  3O62 D;  5BS7 C;  2NZD B;  5B0Y A;  1P3M A;  1AOI B;  5KDM A;  4H9R A;  5G49 A;  3C1B A;  4QLC C;  2PYO A;  3MGQ D;  4J8W B;  3MGQ C;  5CPI D;  5AV5 C;  5BNV A;  3REJ A;  1P3G D;  4Z5T C;  5B31 A;  5B40 D;  3AZH A;  1P3P D;  4WU9 C;  5B2J C;  4DRB A;  1ZLA D;  4WNN B;  3NQJ A;  3AZN A;  4QLC D;  5B2I C;  3LJA D;  5F99 A;  1ID3 B;  3AZI D;  3WTP A;  5KDM B;  1KX5 C;  4YS3 A;  4KUD B;  2BYM B;  5B2J B;  5BO0 B;  3W97 A;  5BNX B;  5GSU C;  5CPJ B;  3MGP C; 
#chains in the Genus database with same CATH topology
 3X1U C;  3UT9 C;  3B6F D;  3FDD A;  5DNN D;  1BH9 B;  3W96 D;  5B31 G;  5AVC B;  3LEL B;  4X23 C;  4HGA C;  5AV8 A;  2G5I C;  4EO5 B;  4XUJ D;  4WU9 B;  1EQZ A;  3KWQ D;  3B0B A;  3WA9 A;  4KHA A;  2HUE C;  3AFA B;  1M18 B;  2UWX A;  5BNX A;  2FJ7 A;  2ZY2 A;  3W97 B;  3LEL D;  4NE6 A;  3H0M C;  4H9S C;  4XZQ D;  1R4V A;  5CPJ D;  5B2I D;  3REL A;  3MNN D;  3AFA C;  1S32 A;  1P3I C;  4ZBJ B;  4WU9 A;  4WU8 A;  3C1B D;  3REJ C;  1M19 C;  1ID3 A;  3MGQ A;  3X1U D;  3X1T A;  3AZM D;  5B31 D;  1U35 D;  2F8N H;  2Y2I A;  3AYW A;  1P3B D;  1ULY A;  3H0R C;  3LZ1 A;  3REI A;  1KX3 A;  3WA9 C;  4M6B A;  5GT3 B;  4Z66 B;  3AZN D;  3C1C A;  3AN2 C;  5B0Z D;  1P34 D;  3AZJ C;  3AN2 A;  1KX3 C;  2PYO B;  2NZD D;  4X23 A;  3AZJ B;  2NQB B;  5B2I B;  4Z5T D;  4LD9 D;  1WWS A;  1PZR A;  3WA9 B;  1KX4 D;  4CAY B;  4KHA B;  5DNM A;  3X1T B;  1M19 A;  1ID3 C;  4H9O A;  5AVB A;  3W98 D;  3LZ1 B;  3REI B;  4J8W D;  5CPI B;  3KXB D;  5AV8 D;  5JRG C;  3AZL C;  2ZY3 A;  1U35 B;  3MGR D;  3O62 A;  3AZL A;  1T3U A;  2JSS A;  1S32 B;  1AOI D;  4YM6 B;  1P3L A;  1P3M D;  2ARO B;  3W99 B;  1TAF B;  3AZE D;  3LEL A;  1BFM A;  2PYO D;  3B6F B;  4G91 C;  1F1E A;  2HIO B;  3AZH D;  1P3P A;  4Z2M H;  5B33 C;  5FUG A;  5CHL B;  1EQZ B;  3MNN B;  5B24 C;  3UTB D;  5AV9 A;  2F8N K;  4YS3 B;  3LJA B;  4ZUX D;  4CSR A;  4G92 C;  3LZ1 C;  3REI C;  1A7W A;  3TU4 A;  3W99 A;  3AYW C;  2F8N A;  3MGP B;  3MGR B;  5GSU A;  3W97 C;  5B1M B;  5B32 C;  3B0C T;  1P3B A;  4YM6 C;  5F99 C;  5GXQ B;  2HIO A;  4H9Q A;  5E5A C;  2CV5 B;  4HGA B;  2FFF B;  3KUY B;  1P3I D;  4AWL B;  3H0L C;  5B32 B;  3AFA A;  4R8P D;  4LD9 B;  5CPJ C;  1EQZ D;  3AV2 D;  4Z5T B;  5B1M D;  5AV5 B;  3KFU G;  2F2A C;  2PYO C;  2F8N B;  3AV1 B;  5CPK D;  3B0D B;  4WV4 B;  2YFV B;  4AWL C;  5AV6 A;  4Z66 C;  3AZK D;  3AN2 B;  3W98 B;  3AZI C;  3WKJ C;  5BS7 A;  2ZY4 A;  3NQU B;  4XZQ A;  2LY8 A;  3AZL D;  5AY8 D;  4J8U D;  5CP6 D;  5DNN A;  5B40 B;  2BYM A;  3MGQ B;  3AV2 C;  1KX4 C;  3X1S A;  2Y2P A;  5CPK B;  2RVQ D;  3UT9 A;  1P3F C;  3X1U A;  3AV1 A;  1P3K C;  4KGC B;  4XUJ A;  3AZM A;  5JRG D;  1U35 A;  3AV2 B;  3KWQ A;  3WA9 D;  3AZL B;  1HQ3 A;  4EO5 C;  4KGC C;  5AY8 B;  4J8U B;  2FJ7 D;  1H3O B;  3NQU A;  4UPK A;  3B6G D;  3B0D C;  3VH6 A;  3REK A;  3KSY A;  1P3K B;  3AZN C;  3AN2 D;  1M18 A;  3REJ D;  1P3G A;  3TU4 D;  3REK C;  5CPJ A;  2ARO C;  3UTA C;  4Z5T A;  5B31 C;  1KU5 A;  4KGC A;  4QLC A;  4XUJ C;  3B6G B;  3C1B B;  4H9N B;  3KUY D;  3VH5 W;  4YM6 A;  1P3L B;  5GT3 D;  4WU8 B;  3AFA D;  5B0Z B;  1TAF A;  4JJN A;  3B0C W;  3AYW D;  5C3I C;  1F66 A;  4UUZ B;  3R45 B;  3VH5 T;  3MGP D;  1P34 A;  4H9Q B;  3AZE A;  2YFW B;  5GT3 C;  1ZLA B;  4QLC B;  4Z66 A;  3C1C B;  1B67 A;  3AZG B;  1P3A C;  1P3O B;  3KXB B;  3V9R B;  5AV6 C;  3MVD D;  2BYK B;  3REH B;  1TZY B;  3LZ0 B;  2YFV A;  5AV6 B;  4WJ3 C;  5AV5 D;  1AOI C;  3W96 B;  3W99 D;  3AZE B;  3P5J B;  5B33 B;  5GSU D;  3AZF D;  1S32 D;  5JRG B;  5B24 B;  1P3B C;  3W98 C;  3LZ0 C;  4WU9 D;  2CV5 D;  2IO5 B;  3B6G A;  3AZM C;  3REH D;  5AVB C;  3W99 C;  1M1A A;  3A1K A;  5CP6 B;  3MGS D;  1F66 B;  4CAY A;  5DNM B;  3AV2 A;  5AV9 C;  1KX3 D;  1KX5 B;  5CPI C;  3AZF C;  5B33 A;  3EPK A;  4XZQ C;  5E5A B;  3AZK B;  5GT0 B;  3LZ0 D;  3WKJ A;  2NZD A;  3AZK C;  5G49 B;  5AVC C;  3MVD C;  3AZF B;  1W2E A;  5B1L D;  5DNM D;  3AYW B;  3X1T C;  1F66 D;  2J8P A;  1M19 D;  5B31 B;  5B1M C;  5AVB D;  2JE5 A;  1JFI A;  4WU8 C;  3AZM B;  4KUD C;  4J8X B;  4H9N A;  1P3I A;  3AV1 D;  1H3O A;  1P3A D;  3WTP E;  5E5A A;  2Y2N A;  4JJN B;  3WAA D;  5JRG A;  5AV9 B;  2Y2J A;  1BH8 A;  5JA4 B;  1N1J B;  5B32 A;  3MVD A;  5AV6 D;  4G91 B;  1BH9 A;  3WAA C;  4J8V D;  4H9P A;  1EQZ C;  4ZUX C;  3A6N B;  3WAA B;  5AV9 D;  3AZI B;  5B2J D;  4KGC D;  4KUD D;  4ZUX A;  4X23 B;  3AZJ A;  2CV5 A;  1P3P C;  3C1C C;  3UT9 D;  3B6F C;  3KUY A;  3EG5 B;  2BG1 A;  4J8X C;  1N1J A;  4YM6 D;  3EPJ A;  3R45 A;  5AVC D;  3EPL A;  1HQ3 D;  3X1U B;  1S32 C;  1HTA A;  2HIO D;  1ZLA A;  3VH5 A;  3O62 C;  3REL C;  3AZG A;  4CSR B;  1P3K D;  1ZLA C;  5GT0 D;  1M1A B;  4R8P A;  2Y2O A;  4H9S A;  5GSU B;  5B1M A;  3B6F A;  1TZY D;  2CV5 C;  1P3P B;  3AZK A;  2NZD C;  5AY8 C;  5GT3 A;  4J8U C;  4JJN D;  4NE5 A;  1HQ3 B;  3AL0 C;  3WAA A;  2ZM5 A;  3AZF A;  5AY8 A;  4J8U A;  2RVQ C;  4DQY B;  4R8P B;  3X1S D;  3REK B;  3X1V B;  4YS3 C;  5CP6 C;  2Y2Q A;  1M1A D;  1M19 B;  4WZS B;  4WNN A;  3NQJ B;  1P34 B;  4J8V A;  3A6N D;  4R8P C;  1P3O D;  2L5A A;  1WWI A;  4KUD A;  3AZG C;  3A1I A;  5CPK C;  3REK D;  3X1S B;  3F6T A;  5BT1 D;  3AZH C;  3X1V D;  1M18 D;  5F99 D;  2HUE B;  1M18 C;  3UT9 B;  2W8S A;  5GXQ D;  2BYK A;  4YS3 D;  5AVC A;  2FJ7 C;  1P3M C;  5B0Y C;  4UUZ A;  5B24 D;  3KUY C;  4J8X A;  3LZ1 D;  3REI D;  5AV8 B;  3KWQ C;  4J8V B;  3C1B C;  3VH6 T;  2YFW A;  4XZQ B;  3AV1 C;  5CPI A;  5AV8 C;  1P3K A;  3MGS A;  5B32 G;  4H9R B;  5B40 A;  5DNN B;  5JA4 A;  1BH8 B;  2ARO D;  4NE3 A;  2FJ7 B;  3UTA B;  3O62 B;  3MVD B;  5GXQ C;  2NQB C;  5DNN C;  1KX4 A;  1M1A C;  1F66 C;  5BT1 C;  3MGP A;  2F8N G;  4LD9 C;  4XUJ B;  1TZY A;  3B6G C;  3LZ0 A;  3WKJ D;  1B6W A;  3WTP C;  1KX5 A;  3WTP D;  4Z66 D;  3AZN B;  5GT0 C;  4ZUX B;  3A6N C;  5B2I A;  3REL D;  2Y2H A;  3MNN A;  5B1L B;  2ZY5 A;  1P3F D;  3MGS B;  5B0Y B;  1AOI A;  2Y2K A;  2NQB D;  5BO0 A;  5B2J A;  1P3G B;  3UTA A;  4WU8 D;  3W96 C;  1P3G C;  5AV5 A;  1ID3 D;  2CWE A;  1P3A A;  5B1L C;  5E5A D;  3X1T D;  2Y2M A;  2XD1 A;  2HIO C;  2Y2G A;  1P3B B;  1Z2C B;  3KXB C;  1P3O A;  1P3I B;  5B0Y D;  3UTB A;  5B32 D;  1P3F B;  1HQ3 C;  1U35 C;  1TZY C;  1P34 C;  4E44 A;  5B0Z A;  3REH A;  3WKJ B;  3X1V A;  3WTP B;  3X1V C;  4H9O B;  2F8N D;  5FUG B;  5B40 C;  1KX4 B;  3UTB C;  3MGS C;  5B24 A;  1P3A B;  4J8X D;  1P3O C;  5C3I B;  4H9P B;  3AZJ D;  5B33 D;  5B0Z C;  4Z2M G;  3LJA A;  3W98 A;  3VH6 W;  3AZI A;  4J8W A;  3KXB A;  4NFT A;  3V9R A;  3LEL C;  2ARO A;  4DRA A;  3W97 D;  3MGR A;  5B1L A;  3IP4 C;  1P3L D;  1P3L C;  2DQN C;  3W96 A;  3C1C D;  3MGR C;  3AZG D;  5CPK A;  1Q9C A;  4E45 A;  5GT0 A;  4J8W C;  5F99 B;  1KX3 B;  1KX5 D;  4X23 D;  1P3M B;  3MNN C;  3REL B;  3LJA C;  3A6N A;  4LD9 A;  3KWQ B;  4J8V C;  4ZBJ C;  3UTB B;  1P3F A;  5DNM C;  5CP6 A;  3TU4 B;  2NQB A;  4G92 B;  5BNV B;  3REJ B;  3AZE C;  3UTA D;  3AZH B;  3X1S C;  1JFI B;  3TU4 C;  5AVB B;  5GXQ A;  2IO5 C;  3REH C;  4JJN C;  3EPH A;  3O62 D;  5BS7 C;  2VQR A;  2NZD B;  5B0Y A;  1P3M A;  1AOI B;  5KDM A;  4H9R A;  2G5H C;  5G49 A;  3C1B A;  4QLC C;  2PYO A;  3MGQ D;  4J8W B;  3MGQ C;  5CPI D;  5AV5 C;  5BNV A;  3REJ A;  2XD5 A;  4Z5T C;  5B31 A;  5B40 D;  3AZH A;  1P3G D;  1P3P D;  4WU9 C;  5B2J C;  4DRB A;  2Y2L A;  1ZLA D;  4WNN B;  3NQJ A;  3AZN A;  4QLC D;  5B2I C;  3LJA D;  5F99 A;  2JCH A;  1ID3 B;  3AZI D;  3WTP A;  5KDM B;  1KX5 C;  4YS3 A;  4KUD B;  2RIQ A;  2BYM B;  5B2J B;  5BO0 B;  2DF4 C;  3W97 A;  5BNX B;  5GSU C;  5CPJ B;  3MGP C; 
#chains in the Genus database with same CATH homology
 3X1U C;  3UT9 C;  3B6F D;  3FDD A;  5DNN D;  1BH9 B;  3W96 D;  5B31 G;  5AVC B;  3LEL B;  4X23 C;  4HGA C;  5AV8 A;  2G5I C;  4EO5 B;  4XUJ D;  4WU9 B;  1EQZ A;  3KWQ D;  3B0B A;  3WA9 A;  4KHA A;  2HUE C;  3AFA B;  1M18 B;  2UWX A;  5BNX A;  2FJ7 A;  2ZY2 A;  3W97 B;  3LEL D;  4NE6 A;  3H0M C;  4H9S C;  4XZQ D;  1R4V A;  5CPJ D;  5B2I D;  3REL A;  3MNN D;  3AFA C;  1S32 A;  1P3I C;  4ZBJ B;  4WU9 A;  4WU8 A;  3C1B D;  3REJ C;  1M19 C;  1ID3 A;  3MGQ A;  3X1U D;  3X1T A;  3AZM D;  5B31 D;  1U35 D;  2F8N H;  2Y2I A;  3AYW A;  1P3B D;  1ULY A;  3H0R C;  3LZ1 A;  3REI A;  1KX3 A;  3WA9 C;  4M6B A;  5GT3 B;  4Z66 B;  3AZN D;  3C1C A;  3AN2 C;  5B0Z D;  1P34 D;  3AZJ C;  3AN2 A;  1KX3 C;  2PYO B;  2NZD D;  4X23 A;  3AZJ B;  2NQB B;  5B2I B;  4Z5T D;  4LD9 D;  1WWS A;  1PZR A;  3WA9 B;  1KX4 D;  4CAY B;  4KHA B;  5DNM A;  3X1T B;  1M19 A;  1ID3 C;  4H9O A;  5AVB A;  3W98 D;  3LZ1 B;  3REI B;  4J8W D;  5CPI B;  3KXB D;  5AV8 D;  5JRG C;  3AZL C;  2ZY3 A;  1U35 B;  3MGR D;  3O62 A;  3AZL A;  1T3U A;  2JSS A;  1S32 B;  1AOI D;  4YM6 B;  1P3L A;  1P3M D;  2ARO B;  3W99 B;  1TAF B;  3AZE D;  3LEL A;  1BFM A;  2PYO D;  3B6F B;  4G91 C;  1F1E A;  2HIO B;  3AZH D;  1P3P A;  4Z2M H;  5B33 C;  5FUG A;  5CHL B;  1EQZ B;  3MNN B;  5B24 C;  3UTB D;  5AV9 A;  2F8N K;  4YS3 B;  3LJA B;  4ZUX D;  4CSR A;  4G92 C;  3LZ1 C;  3REI C;  1A7W A;  3TU4 A;  3W99 A;  3AYW C;  2F8N A;  3MGP B;  3MGR B;  5GSU A;  3W97 C;  5B1M B;  5B32 C;  3B0C T;  1P3B A;  4YM6 C;  5F99 C;  5GXQ B;  2HIO A;  4H9Q A;  5E5A C;  2CV5 B;  4HGA B;  2FFF B;  3KUY B;  1P3I D;  4AWL B;  3H0L C;  5B32 B;  3AFA A;  4R8P D;  4LD9 B;  5CPJ C;  1EQZ D;  3AV2 D;  4Z5T B;  5B1M D;  5AV5 B;  3KFU G;  2F2A C;  2PYO C;  2F8N B;  3AV1 B;  5CPK D;  3B0D B;  4WV4 B;  2YFV B;  4AWL C;  5AV6 A;  4Z66 C;  3AZK D;  3AN2 B;  3W98 B;  3AZI C;  3WKJ C;  5BS7 A;  2ZY4 A;  3NQU B;  4XZQ A;  2LY8 A;  3AZL D;  5AY8 D;  4J8U D;  5CP6 D;  5DNN A;  5B40 B;  2BYM A;  3MGQ B;  3AV2 C;  1KX4 C;  3X1S A;  2Y2P A;  5CPK B;  2RVQ D;  3UT9 A;  1P3F C;  3X1U A;  3AV1 A;  1P3K C;  4KGC B;  4XUJ A;  3AZM A;  5JRG D;  1U35 A;  3AV2 B;  3KWQ A;  3WA9 D;  3AZL B;  1HQ3 A;  4EO5 C;  4KGC C;  5AY8 B;  4J8U B;  2FJ7 D;  1H3O B;  3NQU A;  4UPK A;  3B6G D;  3B0D C;  3VH6 A;  3REK A;  3KSY A;  1P3K B;  3AZN C;  3AN2 D;  1M18 A;  3REJ D;  1P3G A;  3TU4 D;  3REK C;  5CPJ A;  2ARO C;  3UTA C;  4Z5T A;  5B31 C;  1KU5 A;  4KGC A;  4QLC A;  4XUJ C;  3B6G B;  3C1B B;  4H9N B;  3KUY D;  3VH5 W;  4YM6 A;  1P3L B;  5GT3 D;  4WU8 B;  3AFA D;  5B0Z B;  1TAF A;  4JJN A;  3B0C W;  3AYW D;  5C3I C;  1F66 A;  4UUZ B;  3R45 B;  3VH5 T;  3MGP D;  1P34 A;  4H9Q B;  3AZE A;  2YFW B;  5GT3 C;  1ZLA B;  4QLC B;  4Z66 A;  3C1C B;  1B67 A;  3AZG B;  1P3A C;  1P3O B;  3KXB B;  3V9R B;  5AV6 C;  3MVD D;  2BYK B;  3REH B;  1TZY B;  3LZ0 B;  2YFV A;  5AV6 B;  4WJ3 C;  5AV5 D;  1AOI C;  3W96 B;  3W99 D;  3AZE B;  3P5J B;  5B33 B;  5GSU D;  3AZF D;  1S32 D;  5JRG B;  5B24 B;  1P3B C;  3W98 C;  3LZ0 C;  4WU9 D;  2CV5 D;  2IO5 B;  3B6G A;  3AZM C;  3REH D;  5AVB C;  3W99 C;  1M1A A;  3A1K A;  5CP6 B;  3MGS D;  1F66 B;  4CAY A;  5DNM B;  3AV2 A;  5AV9 C;  1KX3 D;  1KX5 B;  5CPI C;  3AZF C;  5B33 A;  3EPK A;  4XZQ C;  5E5A B;  3AZK B;  5GT0 B;  3LZ0 D;  3WKJ A;  2NZD A;  3AZK C;  5G49 B;  5AVC C;  3MVD C;  3AZF B;  1W2E A;  5B1L D;  5DNM D;  3AYW B;  3X1T C;  1F66 D;  2J8P A;  1M19 D;  5B31 B;  5B1M C;  5AVB D;  2JE5 A;  1JFI A;  4WU8 C;  3AZM B;  4KUD C;  4J8X B;  4H9N A;  1P3I A;  3AV1 D;  1H3O A;  1P3A D;  3WTP E;  5E5A A;  2Y2N A;  4JJN B;  3WAA D;  5JRG A;  5AV9 B;  2Y2J A;  1BH8 A;  5JA4 B;  1N1J B;  5B32 A;  3MVD A;  5AV6 D;  4G91 B;  1BH9 A;  3WAA C;  4J8V D;  4H9P A;  1EQZ C;  4ZUX C;  3A6N B;  3WAA B;  5AV9 D;  3AZI B;  5B2J D;  4KGC D;  4KUD D;  4ZUX A;  4X23 B;  3AZJ A;  2CV5 A;  1P3P C;  3C1C C;  3UT9 D;  3B6F C;  3KUY A;  3EG5 B;  2BG1 A;  4J8X C;  1N1J A;  4YM6 D;  3EPJ A;  3R45 A;  5AVC D;  3EPL A;  1HQ3 D;  3X1U B;  1S32 C;  1HTA A;  2HIO D;  1ZLA A;  3VH5 A;  3O62 C;  3REL C;  3AZG A;  4CSR B;  1P3K D;  1ZLA C;  5GT0 D;  1M1A B;  4R8P A;  2Y2O A;  4H9S A;  5GSU B;  5B1M A;  3B6F A;  1TZY D;  2CV5 C;  1P3P B;  3AZK A;  2NZD C;  5AY8 C;  5GT3 A;  4J8U C;  4JJN D;  4NE5 A;  1HQ3 B;  3AL0 C;  3WAA A;  2ZM5 A;  3AZF A;  5AY8 A;  4J8U A;  2RVQ C;  4DQY B;  4R8P B;  3X1S D;  3REK B;  3X1V B;  4YS3 C;  5CP6 C;  2Y2Q A;  1M1A D;  1M19 B;  4WZS B;  4WNN A;  3NQJ B;  1P34 B;  4J8V A;  3A6N D;  4R8P C;  1P3O D;  2L5A A;  1WWI A;  4KUD A;  3AZG C;  3A1I A;  5CPK C;  3REK D;  3X1S B;  3F6T A;  5BT1 D;  3AZH C;  3X1V D;  1M18 D;  5F99 D;  2HUE B;  1M18 C;  3UT9 B;  2W8S A;  5GXQ D;  2BYK A;  4YS3 D;  5AVC A;  2FJ7 C;  1P3M C;  5B0Y C;  4UUZ A;  5B24 D;  3KUY C;  4J8X A;  3LZ1 D;  3REI D;  5AV8 B;  3KWQ C;  4J8V B;  3C1B C;  3VH6 T;  2YFW A;  4XZQ B;  3AV1 C;  5CPI A;  5AV8 C;  1P3K A;  3MGS A;  5B32 G;  4H9R B;  5B40 A;  5DNN B;  5JA4 A;  1BH8 B;  2ARO D;  4NE3 A;  2FJ7 B;  3UTA B;  3O62 B;  3MVD B;  5GXQ C;  2NQB C;  5DNN C;  1KX4 A;  1M1A C;  1F66 C;  5BT1 C;  3MGP A;  2F8N G;  4LD9 C;  4XUJ B;  1TZY A;  3B6G C;  3LZ0 A;  3WKJ D;  1B6W A;  3WTP C;  1KX5 A;  3WTP D;  4Z66 D;  3AZN B;  5GT0 C;  4ZUX B;  3A6N C;  5B2I A;  3REL D;  2Y2H A;  3MNN A;  5B1L B;  2ZY5 A;  1P3F D;  3MGS B;  5B0Y B;  1AOI A;  2Y2K A;  2NQB D;  5BO0 A;  5B2J A;  1P3G B;  3UTA A;  4WU8 D;  3W96 C;  1P3G C;  5AV5 A;  1ID3 D;  2CWE A;  1P3A A;  5B1L C;  5E5A D;  3X1T D;  2Y2M A;  2XD1 A;  2HIO C;  2Y2G A;  1P3B B;  1Z2C B;  3KXB C;  1P3O A;  1P3I B;  5B0Y D;  3UTB A;  5B32 D;  1P3F B;  1HQ3 C;  1U35 C;  1TZY C;  1P34 C;  4E44 A;  5B0Z A;  3REH A;  3WKJ B;  3X1V A;  3WTP B;  3X1V C;  4H9O B;  2F8N D;  5FUG B;  5B40 C;  1KX4 B;  3UTB C;  3MGS C;  5B24 A;  1P3A B;  4J8X D;  1P3O C;  5C3I B;  4H9P B;  3AZJ D;  5B33 D;  5B0Z C;  4Z2M G;  3LJA A;  3W98 A;  3VH6 W;  3AZI A;  4J8W A;  3KXB A;  4NFT A;  3V9R A;  3LEL C;  2ARO A;  4DRA A;  3W97 D;  3MGR A;  5B1L A;  3IP4 C;  1P3L D;  1P3L C;  2DQN C;  3W96 A;  3C1C D;  3MGR C;  3AZG D;  5CPK A;  1Q9C A;  4E45 A;  5GT0 A;  4J8W C;  5F99 B;  1KX3 B;  1KX5 D;  4X23 D;  1P3M B;  3MNN C;  3REL B;  3LJA C;  3A6N A;  4LD9 A;  3KWQ B;  4J8V C;  4ZBJ C;  3UTB B;  1P3F A;  5DNM C;  5CP6 A;  3TU4 B;  2NQB A;  4G92 B;  5BNV B;  3REJ B;  3AZE C;  3UTA D;  3AZH B;  3X1S C;  1JFI B;  3TU4 C;  5AVB B;  5GXQ A;  2IO5 C;  3REH C;  4JJN C;  3EPH A;  3O62 D;  5BS7 C;  2VQR A;  2NZD B;  5B0Y A;  1P3M A;  1AOI B;  5KDM A;  4H9R A;  2G5H C;  5G49 A;  3C1B A;  4QLC C;  2PYO A;  3MGQ D;  4J8W B;  3MGQ C;  5CPI D;  5AV5 C;  5BNV A;  3REJ A;  2XD5 A;  4Z5T C;  5B31 A;  5B40 D;  3AZH A;  1P3G D;  1P3P D;  4WU9 C;  5B2J C;  4DRB A;  2Y2L A;  1ZLA D;  4WNN B;  3NQJ A;  3AZN A;  4QLC D;  5B2I C;  3LJA D;  5F99 A;  2JCH A;  1ID3 B;  3AZI D;  3WTP A;  5KDM B;  1KX5 C;  4YS3 A;  4KUD B;  2RIQ A;  2BYM B;  5B2J B;  5BO0 B;  2DF4 C;  3W97 A;  5BNX B;  5GSU C;  5CPJ B;  3MGP C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...