5E5AA

Crystal structure of the chromatin-tethering domain of human cytomegalovirus ie1 protein bound to the nucleosome core particle
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
99
structure length
99
Chain Sequence
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding/viral protein/dna
molecule keywords DNA (146-MER)
publication title Human cytomegalovirus IE1 protein alters the higher-order chromatin structure by targeting the acidic patch of the nucleosome
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5e5aA00
5CPJA 3KUYA 5AV5C 5B0YA 3TU4B 3W98C 3AZLC 5AVBA 1P3IA 3WAAA 1P3GA 3X1VB 5B1MD 3W97C 3W99C 2CV5D 3AZEB 3REJC 3X1UD 3MVDD 4Z66B 3MGQC 3X1VA 5JA4B 5BT1C 3AZJB 1ID3C 4Z5TC 3LZ1C 4YM6B 1HQ3C 3AZHD 3AZEA 5GT3C 5AV6C 3KWQC 1ZLAA 3AFAB 3AN2B 4QLCD 4Z66A 3AYWD 5CPKD 5AV8D 3X1SB 3AZJA 5G49B 4HGAC 5B40B 5B31B 5AVCC 3MGPC 2LY8A 5JRGC 3C1CB 1P3BD 3AN2A 3AZKC 4YS3C 3WTPC 3X1SA 1M1AA 5G49A 3MGSB 5B40A 5B31A 4G92B 5GXQB 3C1CA 5AV9C 3LELA 5B31G 5AY8D 5B0ZC 3KXBB 1S32D 1P3MC 1KX5D 5B33D 4E45A 3A6NB 3MGSA 2F8NH 1F66C 5GXQA 3TU4D 5CP6C 5F99B 3AZNC 3AZFD 1U35D 2NQBA 3X1VD 3O62C 1P3PC 5BS7C 3B6GC 4WU9A 5F99A 3MVDC 3LJAB 1BH8B 4J8WB 1N1JB 4YM6D 3AZIB 5GSUC 3AFAD 4R8PA 5B2JB 3UT9D 1KX4B 3LJAA 4QLCC 3MNNB 4J8WA 5GT0A 1N1JA 5B1LB 3W98B 5CPKC 4UUZB 5DNNB 3AZIA 4LD9A 5BNXB 5B2JA 3WTPE 4J8VC 3UTAC 1P3BC 5E5AC 3MNNA 1P3OD 5AV5A 1P3FB 3UTBB 3X1TB 1JFIB 3MGRC 3W98A 4Z2MG 3AZLA 4UUZA 2F8ND 5GXQD 5BNXA 4Z5TB 1HQ3B 5C3IC 3KWQB 3KXBD 4J8UB 1P3FA 3UTBA 3X1TA 1BH9B 5AY8C 5DNMC 1JFIA 3A6ND 1WWIA 1P3LC 4Z5TA 4HGAB 1ID3A 1HQ3A 1M18C 5GT3A 5AV6A 3KWQA 3MGPB 3WA9D 3AZFC 4J8UA 1U35C 3RELD 1BH9A 5CPIB 4KGCD 4H9RB 4CSRB 5AVCA 3MGPA 3AZGC 1P34C 3AZKA 3AZID 2AROC 3REIB 2HIOC 5B2JD 1P3MB 2NZDB 1KX4D 5CP6B 5B1LD 3AV1D 2FJ7C 5DNND 3WKJB 3REIA 3O62B 5B0ZA 3B0DB 1P3MA 1P3FD 3UTBD 5CP6A 2YFWB 1KX3D 1P3OC 3WKJA 3O62A 3AZMC 1F1EA 5CPJB 3KUYB 5BS7A 3V9RB 5B0YB 3B6GA 2RVQD 5AVBB 3WAAB 1P3GB 3B6FD 3REKC 3VH5T 1TAFB 5CHLB 4H9SC 3V9RA 1BFMA 1M19B 5GSUA 4XZQD 3WA9C 3UTAB 4ZBJC 5CPID 3RELC 1TAFA 3VH5W 4ZUXB 1ZLAB 3NQJB 5FUGB 3REHB 1M19A 4J8VA 3UTAA 4ZUXA 4EO5C 3NQJA 5FUGA 5DNMB 3MGRA 4KUDD 2PYOB 2NZDD 1ULYA 3REHA 4WU8B 1TZYC 5B32C 1P3LB 1M1AB 3AV1C 4DRBA 1AOIB 3C1BC 5DNMA 4AWLC 2PYOA 3AV2C 4WU8A 3LELB 1P3LA 1EQZC 4E44A 3AZGB 1AOIA 5CPJD 3KUYD 4X23C 5B0YD 5BNVB 5AVBD 1P3ID 3WAAD 3W96C 1P3GD 2NQBB 3VH6T 5B24B 4H9NB 3AZGA 5B2IC 4XUJC 4WU9B 1P34A 1P3KC 1P3AB 2AROA 5BNVA 5B24A 3VH6W 5B1MC 4H9NA 3AZED 1ZLAD 4WV4B 4J8XB 2CV5C 4R8PB 4G91B 1P3AA 4JJNB 3X1UC 4Z66D 4M6BA 5GT0B 3AZJD 4LD9B 3LZ0B 4J8XA 2PYOD 3AZHC 2BYMA 3AN2D 4JJNA 5AV5B 3X1SD 1M1AD 3AZLB 3AYWC 5AV8C 5B40D 1H3OB 5B31D 3LZ0A 3C1CD 3W97B 3W99B 3LELD 4CAYB 3REJB 4Z2MH 2HUEC 4WZSB 4NFTA 3MGSD 1H3OA 3MGQB 3B0BA 1ID3B 3W97A 3LZ1B 3W99A 5GT3B 5AV6B 2NQBD 4CAYA 3REJA 1P3IC 1S32C 3MGQA 1TZYB 5B33C 5BO0B 1KX5C 4WU9D 5F99D 2YFVA 3LZ1A 3TU4C 5AVCB 5JRGB 3X1VC 3AV2B 3AZKB 4YS3B 1TZYA 1WWSA 5BO0A 3WTPB 4R8PD 3AZEC 4JJND 3LJAD 3C1BA 4J8WD 5GT0D 5JRGA 5AV9B 3AV2A 2CWEA 4LD9D 3AZJC 4YS3A 3W96B 3LZ0D 4YM6C 5B0ZB 3WTPA 1EQZA 3AFAC 3UT9C 3MNND 4X23A 5B2IB 5AV5D 1F66B 5AV9A 3AZNB 3W98D 3AZLD 3W96A 2BYKB 1P3PB 5B40C 5B31C 3W97D 3W99D 1HTAA 3C1CC 3B6GB 1F66A 5B2IA 4XUJA 3X1TD 3AZNA 3MVDB 2BYKA 1P3PA 5BT1D 3KSYA 4Z5TD 1ID3D 1HQ3D 5GXQC 5GT3D 5AV6D 3KWQD 5GSUB 4H9QA 2CV5A 4J8UD 3KXBC 3X1UA 3MVDA 4QLCB 3A6NC 4NE5A 3R45B 5CPKB 5AVCD 3MGPD 4NE3A 5JRGD 3AZHA 4J8VB 3AZKD 4YS3D 1P3BB 5E5AB 4QLCA 3MGRB 4KGCC 3R45A 3AYWA 5CPKA 1B67A 4J8WC 5C3IB 1P3BA 5E5AA 3REID 5B0ZD 3AZIC 1P3MD 5AY8B 5B2JC 1S32B 5B33B 4H9PA 1KX4C 5CP6D 3AZND 3MNNC 1M18B 3WKJD 5B1LC 3O62D 1P3PD 3AZFB 5DNNC 1U35B 5AY8A 1S32A 1KX5A 3B6GD 1R4VA 5B33A 1P3FC 3TU4A 3UTBC 3X1TC 1M18A 1KX3C 3AZFA 1U35A 1P34B 2AROB 2IO5C 5GSUD 2HIOB 4NE6A 2RVQC 4J8UC 3UT9B 3B6FC 2FJ7B 5JA4A 1M19D 4YM6A 2HIOA 4J8VD 3UTAD 3AFAA 4XZQC 5E5AD 3UT9A 4ZUXD 5CPIC 2FJ7A 3MGRD 2BYMB 3REHD 1P3OB 2F8NB 3AZMB 4DRAA 3REIC 5DNMD 1P3OA 3REKB 4WNNB 4WU8D 4KUDC 1Q9CA 2NZDC 2F8NA 3AZMA 3VH5A 1P3LD 1M18D 5KDMB 2F8NG 1AOID 3WKJC 3KXBA 3WA9B 3B0DC 4ZBJB 3REKA 4WNNA 3RELB 4H9SA 3A6NA 4KGCB 5KDMA 3AZGD 3WA9A 1P34D 2AROD 2YFVB 3RELA 3KUYC 2HIOD 5CPJC 5B0YC 4EO5B 4KGCA 5B24D 5AVBC 3WAAC 1P3GC 2FJ7D 5B32B 1BH8A 1P3AD 3AV1B 4H9OB 3C1BB 1M19C 4AWLB 1A7WA 1KX4A 4J8XD 5B32A 4ZUXC 1EQZB 1ZLAC 5B1LA 4H9OA 3AV1A 1KX3B 3B0CT 5DNNA 3REHC 3AZMD 5B32G 4X23B 4Z66C 2IO5B 3NQUB 3REKD 2F8NK 3VH6A 2PYOC 1KU5A 1KX3A 3B6FB 3AN2C 3B0CW 4WU8C 4XUJB 1P3KB 3X1SC 1M1AC 1AOIC 3NQUA 4XZQB 5B1MB 3B6FA 3REJD 4H9QB 3LELC 2CV5B 1P3KA 3X1UB 3MGQD 1B6WA 4XZQA 3MGSC 3LZ1D 4G92C 5B1MA 2L5AA 2JSSA 5CPIA 3AZHB 4H9RA 4KHAB 4CSRA 2NQBC 4KUDB 5B24C 1TZYD 5B32D 3AYWB 5AV8B 5F99C 4WU9C 3C1BD 1P3AC 4KHAA 3AV2D 4KUDA 2NZDA 3WTPD 1EQZD 4J8XC 4R8PC 2HUEB 4G91C 5AV8A 4JJNC 4X23D 4H9PB 5AV9D 3LJAC 5GT0C 3W96D 4LD9C 1P3IB 3LZ0C 2YFWA 1KX5B 1F66D 5B2ID 4XUJD 1P3KD
chains in the Genus database with same CATH superfamily
1T3UA 5CPJA 3KUYA 5AV5C 5B0YA 3TU4B 3W98C 3AZLC 5AVBA 1P3IA 3WAAA 1P3GA 3X1VB 5B1MD 3W97C 3W99C 2CV5D 3AZEB 3REJC 3X1UD 3MVDD 4Z66B 3MGQC 3X1VA 5JA4B 5BT1C 3AZJB 1ID3C 4Z5TC 3LZ1C 4YM6B 1HQ3C 3AZHD 3AZEA 5GT3C 5AV6C 3KWQC 1ZLAA 3AFAB 3AN2B 4QLCD 4Z66A 3AYWD 5CPKD 5AV8D 3X1SB 3AZJA 5G49B 4HGAC 5B40B 5B31B 5AVCC 3MGPC 2LY8A 5JRGC 3C1CB 1P3BD 3AN2A 3AZKC 4YS3C 3WTPC 3X1SA 1M1AA 5G49A 3KFUG 2J8PA 5B40A 5B31A 3MGSB 4G92B 5GXQB 3C1CA 5AV9C 3LELA 5B31G 5AY8D 5B0ZC 3KXBB 2Y2NA 1S32D 1P3MC 1KX5D 5B33D 4E45A 3A6NB 3MGSA 2F8NH 1F66C 5GXQA 3TU4D 5CP6C 5F99B 3AZNC 2F2AC 3AZFD 1U35D 2NQBA 3X1VD 3O62C 1P3PC 5BS7C 3A1KA 3B6GC 4WU9A 5F99A 2JE5A 3MVDC 3LJAB 1BH8B 4J8WB 1N1JB 4YM6D 3AZIB 5GSUC 3AFAD 4R8PA 5B2JB 3UT9D 4DQYB 2DF4C 1KX4B 3LJAA 4QLCC 3MNNB 4J8WA 5GT0A 1N1JA 5B1LB 3W98B 5CPKC 4UUZB 5DNNB 3AZIA 4LD9A 3EG5B 5BNXB 5B2JA 2G5IC 3WTPE 4J8VC 3UTAC 1P3BC 5E5AC 2UWXA 3MNNA 5AV5A 1P3FB 3UTBB 3X1TB 1P3OD 3MGRC 1JFIB 3W98A 2G5HC 4Z2MG 3AZLA 4UUZA 2F8ND 5GXQD 5BNXA 4Z5TB 1HQ3B 5C3IC 3KWQB 2BG1A 3KXBD 4J8UB 1P3FA 3UTBA 3X1TA 1BH9B 5AY8C 5DNMC 1JFIA 3A6ND 1WWIA 1P3LC 4Z5TA 4HGAB 1ID3A 1HQ3A 1M18C 5GT3A 5AV6A 3KWQA 3MGPB 3WA9D 3AZFC 4J8UA 1U35C 3RELD 1BH9A 5CPIB 4KGCD 4H9RB 4CSRB 5AVCA 3MGPA 3AZGC 1P34C 3AZKA 3AZID 2AROC 1Z2CB 3REIB 2HIOC 5B2JD 2ZY3A 1P3MB 2NZDB 1KX4D 3F6TA 5CP6B 5B1LD 3AV1D 2FJ7C 5DNND 3WKJB 2Y2JA 3REIA 3O62B 5B0ZA 3B0DB 1P3MA 3AL0C 1P3FD 3UTBD 5CP6A 2YFWB 1KX3D 1P3OC 3WKJA 3O62A 3AZMC 1F1EA 5CPJB 3KUYB 5BS7A 3V9RB 5B0YB 3B6GA 2RVQD 5AVBB 3WAAB 1P3GB 3B6FD 3REKC 3VH5T 1TAFB 5CHLB 4H9SC 3V9RA 1BFMA 1M19B 5GSUA 4XZQD 3WA9C 3UTAB 4ZBJC 5CPID 3RELC 1TAFA 3VH5W 4ZUXB 1ZLAB 3NQJB 5FUGB 3REHB 1M19A 4WJ3C 4J8VA 3UTAA 4ZUXA 4EO5C 3NQJA 5FUGA 5DNMB 3MGRA 4KUDD 2PYOB 2NZDD 1ULYA 3REHA 4WU8B 1TZYC 5B32C 1P3LB 1M1AB 3AV1C 4DRBA 1AOIB 3C1BC 5DNMA 4AWLC 2PYOA 3AV2C 3EPLA 4WU8A 3LELB 1P3LA 1EQZC 4E44A 3AZGB 1AOIA 5CPJD 3KUYD 4X23C 5B0YD 5BNVB 5AVBD 1P3ID 3WAAD 3W96C 1P3GD 2NQBB 3VH6T 5B24B 2XD5A 4H9NB 3AZGA 5B2IC 4XUJC 4WU9B 1P34A 3EPKA 1P3AB 2AROA 1P3KC 5BNVA 5B24A 3VH6W 5B1MC 4H9NA 3AZED 1ZLAD 4WV4B 4J8XB 2CV5C 4R8PB 4G91B 1P3AA 4JJNB 3X1UC 4Z66D 4M6BA 5GT0B 3AZJD 4LD9B 2VQRA 3LZ0B 4J8XA 2PYOD 3AZHC 2BYMA 3AN2D 3IP4C 4JJNA 5AV5B 3X1SD 1M1AD 3AZLB 3AYWC 5AV8C 5B40D 1H3OB 5B31D 3LZ0A 3C1CD 3W97B 3W99B 3LELD 4CAYB 3REJB 4Z2MH 2HUEC 4WZSB 4NFTA 3MGSD 2ZM5A 1H3OA 3MGQB 2Y2KA 3B0BA 1ID3B 3W97A 3LZ1B 3W99A 5GT3B 5AV6B 2NQBD 4CAYA 3REJA 1P3IC 3H0LC 1S32C 3MGQA 1TZYB 5B33C 5BO0B 1KX5C 4WU9D 5F99D 2YFVA 2Y2QA 3LZ1A 3H0RC 3TU4C 5AVCB 5JRGB 3X1VC 3AV2B 3AZKB 4YS3B 1TZYA 1WWSA 5BO0A 3WTPB 4R8PD 3AZEC 4JJND 3LJAD 3C1BA 4J8WD 5GT0D 5JRGA 5AV9B 3AV2A 2CWEA 4LD9D 3AZJC 4YS3A 3W96B 3LZ0D 4YM6C 5B0ZB 3WTPA 1EQZA 3AFAC 1W2EA 3UT9C 3MNND 4X23A 5B2IB 5AV5D 1F66B 5AV9A 3AZNB 3W98D 3AZLD 3W96A 2BYKB 1P3PB 5B40C 5B31C 3W97D 3W99D 1HTAA 3C1CC 3B6GB 1F66A 5B2IA 4XUJA 3X1TD 3AZNA 3MVDB 2BYKA 1P3PA 5BT1D 3KSYA 4Z5TD 1ID3D 1HQ3D 5GXQC 5GT3D 5AV6D 3KWQD 5GSUB 4H9QA 2CV5A 4J8UD 3KXBC 3X1UA 3MVDA 4QLCB 3A6NC 4NE5A 3R45B 5CPKB 5AVCD 3MGPD 4NE3A 5JRGD 3AZHA 4J8VB 3AZKD 4YS3D 1P3BB 5E5AB 4QLCA 3MGRB 4KGCC 3R45A 3AYWA 5CPKA 1B67A 4J8WC 5C3IB 1P3BA 5E5AA 3REID 3A1IA 5B0ZD 3AZIC 1P3MD 5AY8B 5B2JC 1S32B 5B33B 4H9PA 1KX4C 5CP6D 3AZND 2Y2LA 3MNNC 1M18B 3WKJD 2JCHA 5B1LC 2W8SA 3O62D 1P3PD 3AZFB 5DNNC 1U35B 5AY8A 1S32A 2Y2IA 1KX5A 1R4VA 5B33A 3B6GD 1P3FC 3TU4A 3UTBC 3X1TC 1M18A 1KX3C 3AZFA 1U35A 1P34B 2AROB 2IO5C 5GSUD 2HIOB 4NE6A 2RVQC 4J8UC 3UT9B 3B6FC 2FJ7B 5JA4A 1M19D 4YM6A 2HIOA 4J8VD 3UTAD 3AFAA 4XZQC 5E5AD 3UT9A 4ZUXD 5CPIC 2FJ7A 3MGRD 2BYMB 3REHD 1P3OB 2F8NB 3AZMB 3H0MC 4DRAA 3REIC 5DNMD 1P3OA 3REKB 4WNNB 4WU8D 4KUDC 1Q9CA 2NZDC 2F8NA 3AZMA 3VH5A 1P3LD 1M18D 5KDMB 2F8NG 1AOID 3WKJC 3KXBA 3WA9B 3B0DC 4ZBJB 3REKA 4WNNA 3RELB 4H9SA 3A6NA 4KGCB 1PZRA 5KDMA 3AZGD 3P5JB 3WA9A 1P34D 3EPHA 2AROD 2YFVB 2Y2PA 3KUYC 2HIOD 3RELA 5B0YC 5CPJC 4EO5B 4KGCA 5B24D 5AVBC 3WAAC 1P3GC 2FJ7D 5B32B 1BH8A 1P3AD 3AV1B 4H9OB 4UPKA 3C1BB 1M19C 4AWLB 1A7WA 2FFFB 1KX4A 4J8XD 3EPJA 5B32A 4ZUXC 1EQZB 1ZLAC 5B1LA 4H9OA 3AV1A 1KX3B 2DQNC 3B0CT 5DNNA 3REHC 5B32G 3AZMD 4X23B 2Y2OA 4Z66C 2IO5B 3NQUB 3REKD 2F8NK 3VH6A 2PYOC 1KU5A 1KX3A 3B6FB 3AN2C 3B0CW 4WU8C 3FDDA 4XUJB 1P3KB 3X1SC 1M1AC 1AOIC 3NQUA 4XZQB 5B1MB 3B6FA 3REJD 4H9QB 3LELC 2CV5B 2Y2MA 1P3KA 3X1UB 3MGQD 1B6WA 4XZQA 3MGSC 3LZ1D 2Y2GA 4G92C 5B1MA 2L5AA 2JSSA 5CPIA 3AZHB 4H9RA 4KHAB 4CSRA 2NQBC 4KUDB 5B24C 1TZYD 5B32D 2ZY5A 3AYWB 5AV8B 5F99C 4WU9C 3C1BD 1P3AC 4KHAA 3AV2D 4KUDA 2XD1A 2NZDA 2Y2HA 2ZY4A 3WTPD 1EQZD 4J8XC 4R8PC 2HUEB 4G91C 5AV8A 4JJNC 4X23D 4H9PB 5AV9D 3LJAC 5GT0C 3W96D 4LD9C 1P3IB 3LZ0C 2YFWA 2ZY2A 1KX5B 2RIQA 1F66D 5B2ID 4XUJD 1P3KD
chains in the Genus database with same CATH topology
1T3UA 5CPJA 3KUYA 5AV5C 5B0YA 3TU4B 3W98C 3AZLC 5AVBA 1P3IA 3WAAA 1P3GA 3X1VB 5B1MD 3W97C 3W99C 2CV5D 3AZEB 3REJC 3X1UD 3MVDD 4Z66B 3MGQC 3X1VA 5JA4B 5BT1C 3AZJB 1ID3C 4Z5TC 3LZ1C 4YM6B 1HQ3C 3AZHD 3AZEA 5GT3C 5AV6C 3KWQC 1ZLAA 3AFAB 3AN2B 4QLCD 4Z66A 3AYWD 5CPKD 5AV8D 3X1SB 3AZJA 5G49B 4HGAC 5B40B 5B31B 5AVCC 3MGPC 2LY8A 5JRGC 3C1CB 1P3BD 3AN2A 3AZKC 4YS3C 3WTPC 3X1SA 1M1AA 5G49A 3KFUG 2J8PA 5B40A 5B31A 3MGSB 4G92B 5GXQB 3C1CA 5AV9C 3LELA 5B31G 5AY8D 5B0ZC 3KXBB 2Y2NA 1S32D 1P3MC 1KX5D 5B33D 4E45A 3A6NB 3MGSA 2F8NH 1F66C 5GXQA 3TU4D 5CP6C 5F99B 3AZNC 2F2AC 3AZFD 1U35D 2NQBA 3X1VD 3O62C 1P3PC 5BS7C 3A1KA 3B6GC 4WU9A 5F99A 2JE5A 3MVDC 3LJAB 1BH8B 4J8WB 1N1JB 4YM6D 3AZIB 5GSUC 3AFAD 4R8PA 5B2JB 3UT9D 4DQYB 2DF4C 1KX4B 3LJAA 4QLCC 3MNNB 4J8WA 5GT0A 1N1JA 5B1LB 3W98B 5CPKC 4UUZB 5DNNB 3AZIA 4LD9A 3EG5B 5BNXB 5B2JA 2G5IC 3WTPE 4J8VC 3UTAC 1P3BC 5E5AC 2UWXA 3MNNA 5AV5A 1P3FB 3UTBB 3X1TB 1P3OD 3MGRC 1JFIB 3W98A 2G5HC 4Z2MG 3AZLA 4UUZA 2F8ND 5GXQD 5BNXA 4Z5TB 1HQ3B 5C3IC 3KWQB 2BG1A 3KXBD 4J8UB 1P3FA 3UTBA 3X1TA 1BH9B 5AY8C 5DNMC 1JFIA 3A6ND 1WWIA 1P3LC 4Z5TA 4HGAB 1ID3A 1HQ3A 1M18C 5GT3A 5AV6A 3KWQA 3MGPB 3WA9D 3AZFC 4J8UA 1U35C 3RELD 1BH9A 5CPIB 4KGCD 4H9RB 4CSRB 5AVCA 3MGPA 3AZGC 1P34C 3AZKA 3AZID 2AROC 1Z2CB 3REIB 2HIOC 5B2JD 2ZY3A 1P3MB 2NZDB 1KX4D 3F6TA 5CP6B 5B1LD 3AV1D 2FJ7C 5DNND 3WKJB 2Y2JA 3REIA 3O62B 5B0ZA 3B0DB 1P3MA 3AL0C 1P3FD 3UTBD 5CP6A 2YFWB 1KX3D 1P3OC 3WKJA 3O62A 3AZMC 1F1EA 5CPJB 3KUYB 5BS7A 3V9RB 5B0YB 3B6GA 2RVQD 5AVBB 3WAAB 1P3GB 3B6FD 3REKC 3VH5T 1TAFB 5CHLB 4H9SC 3V9RA 1BFMA 1M19B 5GSUA 4XZQD 3WA9C 3UTAB 4ZBJC 5CPID 3RELC 1TAFA 3VH5W 4ZUXB 1ZLAB 3NQJB 5FUGB 3REHB 1M19A 4WJ3C 4J8VA 3UTAA 4ZUXA 4EO5C 3NQJA 5FUGA 5DNMB 3MGRA 4KUDD 2PYOB 2NZDD 1ULYA 3REHA 4WU8B 1TZYC 5B32C 1P3LB 1M1AB 3AV1C 4DRBA 1AOIB 3C1BC 5DNMA 4AWLC 2PYOA 3AV2C 3EPLA 4WU8A 3LELB 1P3LA 1EQZC 4E44A 3AZGB 1AOIA 5CPJD 3KUYD 4X23C 5B0YD 5BNVB 5AVBD 1P3ID 3WAAD 3W96C 1P3GD 2NQBB 3VH6T 5B24B 2XD5A 4H9NB 3AZGA 5B2IC 4XUJC 4WU9B 1P34A 3EPKA 1P3AB 2AROA 1P3KC 5BNVA 5B24A 3VH6W 5B1MC 4H9NA 3AZED 1ZLAD 4WV4B 4J8XB 2CV5C 4R8PB 4G91B 1P3AA 4JJNB 3X1UC 4Z66D 4M6BA 5GT0B 3AZJD 4LD9B 2VQRA 3LZ0B 4J8XA 2PYOD 3AZHC 2BYMA 3AN2D 3IP4C 4JJNA 5AV5B 3X1SD 1M1AD 3AZLB 3AYWC 5AV8C 5B40D 1H3OB 5B31D 3LZ0A 3C1CD 3W97B 3W99B 3LELD 4CAYB 3REJB 4Z2MH 2HUEC 4WZSB 4NFTA 3MGSD 2ZM5A 1H3OA 3MGQB 2Y2KA 3B0BA 1ID3B 3W97A 3LZ1B 3W99A 5GT3B 5AV6B 2NQBD 4CAYA 3REJA 1P3IC 3H0LC 1S32C 3MGQA 1TZYB 5B33C 5BO0B 1KX5C 4WU9D 5F99D 2YFVA 2Y2QA 3LZ1A 3H0RC 3TU4C 5AVCB 5JRGB 3X1VC 3AV2B 3AZKB 4YS3B 1TZYA 1WWSA 5BO0A 3WTPB 4R8PD 3AZEC 4JJND 3LJAD 3C1BA 4J8WD 5GT0D 5JRGA 5AV9B 3AV2A 2CWEA 4LD9D 3AZJC 4YS3A 3W96B 3LZ0D 4YM6C 5B0ZB 3WTPA 1EQZA 3AFAC 1W2EA 3UT9C 3MNND 4X23A 5B2IB 5AV5D 1F66B 5AV9A 3AZNB 3W98D 3AZLD 3W96A 2BYKB 1P3PB 5B40C 5B31C 3W97D 3W99D 1HTAA 3C1CC 3B6GB 1F66A 5B2IA 4XUJA 3X1TD 3AZNA 3MVDB 2BYKA 1P3PA 5BT1D 3KSYA 4Z5TD 1ID3D 1HQ3D 5GXQC 5GT3D 5AV6D 3KWQD 5GSUB 4H9QA 2CV5A 4J8UD 3KXBC 3X1UA 3MVDA 4QLCB 3A6NC 4NE5A 3R45B 5CPKB 5AVCD 3MGPD 4NE3A 5JRGD 3AZHA 4J8VB 3AZKD 4YS3D 1P3BB 5E5AB 4QLCA 3MGRB 4KGCC 3R45A 3AYWA 5CPKA 1B67A 4J8WC 5C3IB 1P3BA 5E5AA 3REID 3A1IA 5B0ZD 3AZIC 1P3MD 5AY8B 5B2JC 1S32B 5B33B 4H9PA 1KX4C 5CP6D 3AZND 2Y2LA 3MNNC 1M18B 3WKJD 2JCHA 5B1LC 2W8SA 3O62D 1P3PD 3AZFB 5DNNC 1U35B 5AY8A 1S32A 2Y2IA 1KX5A 1R4VA 5B33A 3B6GD 1P3FC 3TU4A 3UTBC 3X1TC 1M18A 1KX3C 3AZFA 1U35A 1P34B 2AROB 2IO5C 5GSUD 2HIOB 4NE6A 2RVQC 4J8UC 3UT9B 3B6FC 2FJ7B 5JA4A 1M19D 4YM6A 2HIOA 4J8VD 3UTAD 3AFAA 4XZQC 5E5AD 3UT9A 4ZUXD 5CPIC 2FJ7A 3MGRD 2BYMB 3REHD 1P3OB 2F8NB 3AZMB 3H0MC 4DRAA 3REIC 5DNMD 1P3OA 3REKB 4WNNB 4WU8D 4KUDC 1Q9CA 2NZDC 2F8NA 3AZMA 3VH5A 1P3LD 1M18D 5KDMB 2F8NG 1AOID 3WKJC 3KXBA 3WA9B 3B0DC 4ZBJB 3REKA 4WNNA 3RELB 4H9SA 3A6NA 4KGCB 1PZRA 5KDMA 3AZGD 3P5JB 3WA9A 1P34D 3EPHA 2AROD 2YFVB 2Y2PA 3KUYC 2HIOD 3RELA 5B0YC 5CPJC 4EO5B 4KGCA 5B24D 5AVBC 3WAAC 1P3GC 2FJ7D 5B32B 1BH8A 1P3AD 3AV1B 4H9OB 4UPKA 3C1BB 1M19C 4AWLB 1A7WA 2FFFB 1KX4A 4J8XD 3EPJA 5B32A 4ZUXC 1EQZB 1ZLAC 5B1LA 4H9OA 3AV1A 1KX3B 2DQNC 3B0CT 5DNNA 3REHC 5B32G 3AZMD 4X23B 2Y2OA 4Z66C 2IO5B 3NQUB 3REKD 2F8NK 3VH6A 2PYOC 1KU5A 1KX3A 3B6FB 3AN2C 3B0CW 4WU8C 3FDDA 4XUJB 1P3KB 3X1SC 1M1AC 1AOIC 3NQUA 4XZQB 5B1MB 3B6FA 3REJD 4H9QB 3LELC 2CV5B 2Y2MA 1P3KA 3X1UB 3MGQD 1B6WA 4XZQA 3MGSC 3LZ1D 2Y2GA 4G92C 5B1MA 2L5AA 2JSSA 5CPIA 3AZHB 4H9RA 4KHAB 4CSRA 2NQBC 4KUDB 5B24C 1TZYD 5B32D 2ZY5A 3AYWB 5AV8B 5F99C 4WU9C 3C1BD 1P3AC 4KHAA 3AV2D 4KUDA 2XD1A 2NZDA 2Y2HA 2ZY4A 3WTPD 1EQZD 4J8XC 4R8PC 2HUEB 4G91C 5AV8A 4JJNC 4X23D 4H9PB 5AV9D 3LJAC 5GT0C 3W96D 4LD9C 1P3IB 3LZ0C 2YFWA 2ZY2A 1KX5B 2RIQA 1F66D 5B2ID 4XUJD 1P3KD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CPJ A;  3KUY A;  5AV5 C;  5B0Y A;  3TU4 B;  3W98 C;  3AZL C;  5AVB A;  1P3I A;  3WAA A;  1P3G A;  3X1V B;  5B1M D;  3W97 C;  3W99 C;  2CV5 D;  3AZE B;  3REJ C;  3X1U D;  3MVD D;  4Z66 B;  3MGQ C;  3X1V A;  5JA4 B;  5BT1 C;  3AZJ B;  1ID3 C;  4Z5T C;  3LZ1 C;  4YM6 B;  1HQ3 C;  3AZH D;  3AZE A;  5GT3 C;  5AV6 C;  3KWQ C;  1ZLA A;  3AFA B;  3AN2 B;  4QLC D;  4Z66 A;  3AYW D;  5CPK D;  5AV8 D;  3X1S B;  3AZJ A;  5G49 B;  4HGA C;  5B40 B;  5B31 B;  5AVC C;  3MGP C;  2LY8 A;  5JRG C;  3C1C B;  1P3B D;  3AN2 A;  3AZK C;  4YS3 C;  3WTP C;  3X1S A;  1M1A A;  5G49 A;  3MGS B;  5B40 A;  5B31 A;  4G92 B;  5GXQ B;  3C1C A;  5AV9 C;  3LEL A;  5B31 G;  5AY8 D;  5B0Z C;  3KXB B;  1S32 D;  1P3M C;  1KX5 D;  5B33 D;  4E45 A;  3A6N B;  3MGS A;  2F8N H;  1F66 C;  5GXQ A;  3TU4 D;  5CP6 C;  5F99 B;  3AZN C;  3AZF D;  1U35 D;  2NQB A;  3X1V D;  3O62 C;  1P3P C;  5BS7 C;  3B6G C;  4WU9 A;  5F99 A;  3MVD C;  3LJA B;  1BH8 B;  4J8W B;  1N1J B;  4YM6 D;  3AZI B;  5GSU C;  3AFA D;  4R8P A;  5B2J B;  3UT9 D;  1KX4 B;  3LJA A;  4QLC C;  3MNN B;  4J8W A;  5GT0 A;  1N1J A;  5B1L B;  3W98 B;  5CPK C;  4UUZ B;  5DNN B;  3AZI A;  4LD9 A;  5BNX B;  5B2J A;  3WTP E;  4J8V C;  3UTA C;  1P3B C;  5E5A C;  3MNN A;  1P3O D;  5AV5 A;  1P3F B;  3UTB B;  3X1T B;  1JFI B;  3MGR C;  3W98 A;  4Z2M G;  3AZL A;  4UUZ A;  2F8N D;  5GXQ D;  5BNX A;  4Z5T B;  1HQ3 B;  5C3I C;  3KWQ B;  3KXB D;  4J8U B;  1P3F A;  3UTB A;  3X1T A;  1BH9 B;  5AY8 C;  5DNM C;  1JFI A;  3A6N D;  1WWI A;  1P3L C;  4Z5T A;  4HGA B;  1ID3 A;  1HQ3 A;  1M18 C;  5GT3 A;  5AV6 A;  3KWQ A;  3MGP B;  3WA9 D;  3AZF C;  4J8U A;  1U35 C;  3REL D;  1BH9 A;  5CPI B;  4KGC D;  4H9R B;  4CSR B;  5AVC A;  3MGP A;  3AZG C;  1P34 C;  3AZK A;  3AZI D;  2ARO C;  3REI B;  2HIO C;  5B2J D;  1P3M B;  2NZD B;  1KX4 D;  5CP6 B;  5B1L D;  3AV1 D;  2FJ7 C;  5DNN D;  3WKJ B;  3REI A;  3O62 B;  5B0Z A;  3B0D B;  1P3M A;  1P3F D;  3UTB D;  5CP6 A;  2YFW B;  1KX3 D;  1P3O C;  3WKJ A;  3O62 A;  3AZM C;  1F1E A;  5CPJ B;  3KUY B;  5BS7 A;  3V9R B;  5B0Y B;  3B6G A;  2RVQ D;  5AVB B;  3WAA B;  1P3G B;  3B6F D;  3REK C;  3VH5 T;  1TAF B;  5CHL B;  4H9S C;  3V9R A;  1BFM A;  1M19 B;  5GSU A;  4XZQ D;  3WA9 C;  3UTA B;  4ZBJ C;  5CPI D;  3REL C;  1TAF A;  3VH5 W;  4ZUX B;  1ZLA B;  3NQJ B;  5FUG B;  3REH B;  1M19 A;  4J8V A;  3UTA A;  4ZUX A;  4EO5 C;  3NQJ A;  5FUG A;  5DNM B;  3MGR A;  4KUD D;  2PYO B;  2NZD D;  1ULY A;  3REH A;  4WU8 B;  1TZY C;  5B32 C;  1P3L B;  1M1A B;  3AV1 C;  4DRB A;  1AOI B;  3C1B C;  5DNM A;  4AWL C;  2PYO A;  3AV2 C;  4WU8 A;  3LEL B;  1P3L A;  1EQZ C;  4E44 A;  3AZG B;  1AOI A;  5CPJ D;  3KUY D;  4X23 C;  5B0Y D;  5BNV B;  5AVB D;  1P3I D;  3WAA D;  3W96 C;  1P3G D;  2NQB B;  3VH6 T;  5B24 B;  4H9N B;  3AZG A;  5B2I C;  4XUJ C;  4WU9 B;  1P34 A;  1P3K C;  1P3A B;  2ARO A;  5BNV A;  5B24 A;  3VH6 W;  5B1M C;  4H9N A;  3AZE D;  1ZLA D;  4WV4 B;  4J8X B;  2CV5 C;  4R8P B;  4G91 B;  1P3A A;  4JJN B;  3X1U C;  4Z66 D;  4M6B A;  5GT0 B;  3AZJ D;  4LD9 B;  3LZ0 B;  4J8X A;  2PYO D;  3AZH C;  2BYM A;  3AN2 D;  4JJN A;  5AV5 B;  3X1S D;  1M1A D;  3AZL B;  3AYW C;  5AV8 C;  5B40 D;  1H3O B;  5B31 D;  3LZ0 A;  3C1C D;  3W97 B;  3W99 B;  3LEL D;  4CAY B;  3REJ B;  4Z2M H;  2HUE C;  4WZS B;  4NFT A;  3MGS D;  1H3O A;  3MGQ B;  3B0B A;  1ID3 B;  3W97 A;  3LZ1 B;  3W99 A;  5GT3 B;  5AV6 B;  2NQB D;  4CAY A;  3REJ A;  1P3I C;  1S32 C;  3MGQ A;  1TZY B;  5B33 C;  5BO0 B;  1KX5 C;  4WU9 D;  5F99 D;  2YFV A;  3LZ1 A;  3TU4 C;  5AVC B;  5JRG B;  3X1V C;  3AV2 B;  3AZK B;  4YS3 B;  1TZY A;  1WWS A;  5BO0 A;  3WTP B;  4R8P D;  3AZE C;  4JJN D;  3LJA D;  3C1B A;  4J8W D;  5GT0 D;  5JRG A;  5AV9 B;  3AV2 A;  2CWE A;  4LD9 D;  3AZJ C;  4YS3 A;  3W96 B;  3LZ0 D;  4YM6 C;  5B0Z B;  3WTP A;  1EQZ A;  3AFA C;  3UT9 C;  3MNN D;  4X23 A;  5B2I B;  5AV5 D;  1F66 B;  5AV9 A;  3AZN B;  3W98 D;  3AZL D;  3W96 A;  2BYK B;  1P3P B;  5B40 C;  5B31 C;  3W97 D;  3W99 D;  1HTA A;  3C1C C;  3B6G B;  1F66 A;  5B2I A;  4XUJ A;  3X1T D;  3AZN A;  3MVD B;  2BYK A;  1P3P A;  5BT1 D;  3KSY A;  4Z5T D;  1ID3 D;  1HQ3 D;  5GXQ C;  5GT3 D;  5AV6 D;  3KWQ D;  5GSU B;  4H9Q A;  2CV5 A;  4J8U D;  3KXB C;  3X1U A;  3MVD A;  4QLC B;  3A6N C;  4NE5 A;  3R45 B;  5CPK B;  5AVC D;  3MGP D;  4NE3 A;  5JRG D;  3AZH A;  4J8V B;  3AZK D;  4YS3 D;  1P3B B;  5E5A B;  4QLC A;  3MGR B;  4KGC C;  3R45 A;  3AYW A;  5CPK A;  1B67 A;  4J8W C;  5C3I B;  1P3B A;  5E5A A;  3REI D;  5B0Z D;  3AZI C;  1P3M D;  5AY8 B;  5B2J C;  1S32 B;  5B33 B;  4H9P A;  1KX4 C;  5CP6 D;  3AZN D;  3MNN C;  1M18 B;  3WKJ D;  5B1L C;  3O62 D;  1P3P D;  3AZF B;  5DNN C;  1U35 B;  5AY8 A;  1S32 A;  1KX5 A;  3B6G D;  1R4V A;  5B33 A;  1P3F C;  3TU4 A;  3UTB C;  3X1T C;  1M18 A;  1KX3 C;  3AZF A;  1U35 A;  1P34 B;  2ARO B;  2IO5 C;  5GSU D;  2HIO B;  4NE6 A;  2RVQ C;  4J8U C;  3UT9 B;  3B6F C;  2FJ7 B;  5JA4 A;  1M19 D;  4YM6 A;  2HIO A;  4J8V D;  3UTA D;  3AFA A;  4XZQ C;  5E5A D;  3UT9 A;  4ZUX D;  5CPI C;  2FJ7 A;  3MGR D;  2BYM B;  3REH D;  1P3O B;  2F8N B;  3AZM B;  4DRA A;  3REI C;  5DNM D;  1P3O A;  3REK B;  4WNN B;  4WU8 D;  4KUD C;  1Q9C A;  2NZD C;  2F8N A;  3AZM A;  3VH5 A;  1P3L D;  1M18 D;  5KDM B;  2F8N G;  1AOI D;  3WKJ C;  3KXB A;  3WA9 B;  3B0D C;  4ZBJ B;  3REK A;  4WNN A;  3REL B;  4H9S A;  3A6N A;  4KGC B;  5KDM A;  3AZG D;  3WA9 A;  1P34 D;  2ARO D;  2YFV B;  3REL A;  3KUY C;  2HIO D;  5CPJ C;  5B0Y C;  4EO5 B;  4KGC A;  5B24 D;  5AVB C;  3WAA C;  1P3G C;  2FJ7 D;  5B32 B;  1BH8 A;  1P3A D;  3AV1 B;  4H9O B;  3C1B B;  1M19 C;  4AWL B;  1A7W A;  1KX4 A;  4J8X D;  5B32 A;  4ZUX C;  1EQZ B;  1ZLA C;  5B1L A;  4H9O A;  3AV1 A;  1KX3 B;  3B0C T;  5DNN A;  3REH C;  3AZM D;  5B32 G;  4X23 B;  4Z66 C;  2IO5 B;  3NQU B;  3REK D;  2F8N K;  3VH6 A;  2PYO C;  1KU5 A;  1KX3 A;  3B6F B;  3AN2 C;  3B0C W;  4WU8 C;  4XUJ B;  1P3K B;  3X1S C;  1M1A C;  1AOI C;  3NQU A;  4XZQ B;  5B1M B;  3B6F A;  3REJ D;  4H9Q B;  3LEL C;  2CV5 B;  1P3K A;  3X1U B;  3MGQ D;  1B6W A;  4XZQ A;  3MGS C;  3LZ1 D;  4G92 C;  5B1M A;  2L5A A;  2JSS A;  5CPI A;  3AZH B;  4H9R A;  4KHA B;  4CSR A;  2NQB C;  4KUD B;  5B24 C;  1TZY D;  5B32 D;  3AYW B;  5AV8 B;  5F99 C;  4WU9 C;  3C1B D;  1P3A C;  4KHA A;  3AV2 D;  4KUD A;  2NZD A;  3WTP D;  1EQZ D;  4J8X C;  4R8P C;  2HUE B;  4G91 C;  5AV8 A;  4JJN C;  4X23 D;  4H9P B;  5AV9 D;  3LJA C;  5GT0 C;  3W96 D;  4LD9 C;  1P3I B;  3LZ0 C;  2YFW A;  1KX5 B;  1F66 D;  5B2I D;  4XUJ D;  1P3K D; 
#chains in the Genus database with same CATH topology
 1T3U A;  5CPJ A;  3KUY A;  5AV5 C;  5B0Y A;  3TU4 B;  3W98 C;  3AZL C;  5AVB A;  1P3I A;  3WAA A;  1P3G A;  3X1V B;  5B1M D;  3W97 C;  3W99 C;  2CV5 D;  3AZE B;  3REJ C;  3X1U D;  3MVD D;  4Z66 B;  3MGQ C;  3X1V A;  5JA4 B;  5BT1 C;  3AZJ B;  1ID3 C;  4Z5T C;  3LZ1 C;  4YM6 B;  1HQ3 C;  3AZH D;  3AZE A;  5GT3 C;  5AV6 C;  3KWQ C;  1ZLA A;  3AFA B;  3AN2 B;  4QLC D;  4Z66 A;  3AYW D;  5CPK D;  5AV8 D;  3X1S B;  3AZJ A;  5G49 B;  4HGA C;  5B40 B;  5B31 B;  5AVC C;  3MGP C;  2LY8 A;  5JRG C;  3C1C B;  1P3B D;  3AN2 A;  3AZK C;  4YS3 C;  3WTP C;  3X1S A;  1M1A A;  5G49 A;  3KFU G;  2J8P A;  5B40 A;  5B31 A;  3MGS B;  4G92 B;  5GXQ B;  3C1C A;  5AV9 C;  3LEL A;  5B31 G;  5AY8 D;  5B0Z C;  3KXB B;  2Y2N A;  1S32 D;  1P3M C;  1KX5 D;  5B33 D;  4E45 A;  3A6N B;  3MGS A;  2F8N H;  1F66 C;  5GXQ A;  3TU4 D;  5CP6 C;  5F99 B;  3AZN C;  2F2A C;  3AZF D;  1U35 D;  2NQB A;  3X1V D;  3O62 C;  1P3P C;  5BS7 C;  3A1K A;  3B6G C;  4WU9 A;  5F99 A;  2JE5 A;  3MVD C;  3LJA B;  1BH8 B;  4J8W B;  1N1J B;  4YM6 D;  3AZI B;  5GSU C;  3AFA D;  4R8P A;  5B2J B;  3UT9 D;  4DQY B;  2DF4 C;  1KX4 B;  3LJA A;  4QLC C;  3MNN B;  4J8W A;  5GT0 A;  1N1J A;  5B1L B;  3W98 B;  5CPK C;  4UUZ B;  5DNN B;  3AZI A;  4LD9 A;  3EG5 B;  5BNX B;  5B2J A;  2G5I C;  3WTP E;  4J8V C;  3UTA C;  1P3B C;  5E5A C;  2UWX A;  3MNN A;  5AV5 A;  1P3F B;  3UTB B;  3X1T B;  1P3O D;  3MGR C;  1JFI B;  3W98 A;  2G5H C;  4Z2M G;  3AZL A;  4UUZ A;  2F8N D;  5GXQ D;  5BNX A;  4Z5T B;  1HQ3 B;  5C3I C;  3KWQ B;  2BG1 A;  3KXB D;  4J8U B;  1P3F A;  3UTB A;  3X1T A;  1BH9 B;  5AY8 C;  5DNM C;  1JFI A;  3A6N D;  1WWI A;  1P3L C;  4Z5T A;  4HGA B;  1ID3 A;  1HQ3 A;  1M18 C;  5GT3 A;  5AV6 A;  3KWQ A;  3MGP B;  3WA9 D;  3AZF C;  4J8U A;  1U35 C;  3REL D;  1BH9 A;  5CPI B;  4KGC D;  4H9R B;  4CSR B;  5AVC A;  3MGP A;  3AZG C;  1P34 C;  3AZK A;  3AZI D;  2ARO C;  1Z2C B;  3REI B;  2HIO C;  5B2J D;  2ZY3 A;  1P3M B;  2NZD B;  1KX4 D;  3F6T A;  5CP6 B;  5B1L D;  3AV1 D;  2FJ7 C;  5DNN D;  3WKJ B;  2Y2J A;  3REI A;  3O62 B;  5B0Z A;  3B0D B;  1P3M A;  3AL0 C;  1P3F D;  3UTB D;  5CP6 A;  2YFW B;  1KX3 D;  1P3O C;  3WKJ A;  3O62 A;  3AZM C;  1F1E A;  5CPJ B;  3KUY B;  5BS7 A;  3V9R B;  5B0Y B;  3B6G A;  2RVQ D;  5AVB B;  3WAA B;  1P3G B;  3B6F D;  3REK C;  3VH5 T;  1TAF B;  5CHL B;  4H9S C;  3V9R A;  1BFM A;  1M19 B;  5GSU A;  4XZQ D;  3WA9 C;  3UTA B;  4ZBJ C;  5CPI D;  3REL C;  1TAF A;  3VH5 W;  4ZUX B;  1ZLA B;  3NQJ B;  5FUG B;  3REH B;  1M19 A;  4WJ3 C;  4J8V A;  3UTA A;  4ZUX A;  4EO5 C;  3NQJ A;  5FUG A;  5DNM B;  3MGR A;  4KUD D;  2PYO B;  2NZD D;  1ULY A;  3REH A;  4WU8 B;  1TZY C;  5B32 C;  1P3L B;  1M1A B;  3AV1 C;  4DRB A;  1AOI B;  3C1B C;  5DNM A;  4AWL C;  2PYO A;  3AV2 C;  3EPL A;  4WU8 A;  3LEL B;  1P3L A;  1EQZ C;  4E44 A;  3AZG B;  1AOI A;  5CPJ D;  3KUY D;  4X23 C;  5B0Y D;  5BNV B;  5AVB D;  1P3I D;  3WAA D;  3W96 C;  1P3G D;  2NQB B;  3VH6 T;  5B24 B;  2XD5 A;  4H9N B;  3AZG A;  5B2I C;  4XUJ C;  4WU9 B;  1P34 A;  3EPK A;  1P3A B;  2ARO A;  1P3K C;  5BNV A;  5B24 A;  3VH6 W;  5B1M C;  4H9N A;  3AZE D;  1ZLA D;  4WV4 B;  4J8X B;  2CV5 C;  4R8P B;  4G91 B;  1P3A A;  4JJN B;  3X1U C;  4Z66 D;  4M6B A;  5GT0 B;  3AZJ D;  4LD9 B;  2VQR A;  3LZ0 B;  4J8X A;  2PYO D;  3AZH C;  2BYM A;  3AN2 D;  3IP4 C;  4JJN A;  5AV5 B;  3X1S D;  1M1A D;  3AZL B;  3AYW C;  5AV8 C;  5B40 D;  1H3O B;  5B31 D;  3LZ0 A;  3C1C D;  3W97 B;  3W99 B;  3LEL D;  4CAY B;  3REJ B;  4Z2M H;  2HUE C;  4WZS B;  4NFT A;  3MGS D;  2ZM5 A;  1H3O A;  3MGQ B;  2Y2K A;  3B0B A;  1ID3 B;  3W97 A;  3LZ1 B;  3W99 A;  5GT3 B;  5AV6 B;  2NQB D;  4CAY A;  3REJ A;  1P3I C;  3H0L C;  1S32 C;  3MGQ A;  1TZY B;  5B33 C;  5BO0 B;  1KX5 C;  4WU9 D;  5F99 D;  2YFV A;  2Y2Q A;  3LZ1 A;  3H0R C;  3TU4 C;  5AVC B;  5JRG B;  3X1V C;  3AV2 B;  3AZK B;  4YS3 B;  1TZY A;  1WWS A;  5BO0 A;  3WTP B;  4R8P D;  3AZE C;  4JJN D;  3LJA D;  3C1B A;  4J8W D;  5GT0 D;  5JRG A;  5AV9 B;  3AV2 A;  2CWE A;  4LD9 D;  3AZJ C;  4YS3 A;  3W96 B;  3LZ0 D;  4YM6 C;  5B0Z B;  3WTP A;  1EQZ A;  3AFA C;  1W2E A;  3UT9 C;  3MNN D;  4X23 A;  5B2I B;  5AV5 D;  1F66 B;  5AV9 A;  3AZN B;  3W98 D;  3AZL D;  3W96 A;  2BYK B;  1P3P B;  5B40 C;  5B31 C;  3W97 D;  3W99 D;  1HTA A;  3C1C C;  3B6G B;  1F66 A;  5B2I A;  4XUJ A;  3X1T D;  3AZN A;  3MVD B;  2BYK A;  1P3P A;  5BT1 D;  3KSY A;  4Z5T D;  1ID3 D;  1HQ3 D;  5GXQ C;  5GT3 D;  5AV6 D;  3KWQ D;  5GSU B;  4H9Q A;  2CV5 A;  4J8U D;  3KXB C;  3X1U A;  3MVD A;  4QLC B;  3A6N C;  4NE5 A;  3R45 B;  5CPK B;  5AVC D;  3MGP D;  4NE3 A;  5JRG D;  3AZH A;  4J8V B;  3AZK D;  4YS3 D;  1P3B B;  5E5A B;  4QLC A;  3MGR B;  4KGC C;  3R45 A;  3AYW A;  5CPK A;  1B67 A;  4J8W C;  5C3I B;  1P3B A;  5E5A A;  3REI D;  3A1I A;  5B0Z D;  3AZI C;  1P3M D;  5AY8 B;  5B2J C;  1S32 B;  5B33 B;  4H9P A;  1KX4 C;  5CP6 D;  3AZN D;  2Y2L A;  3MNN C;  1M18 B;  3WKJ D;  2JCH A;  5B1L C;  2W8S A;  3O62 D;  1P3P D;  3AZF B;  5DNN C;  1U35 B;  5AY8 A;  1S32 A;  2Y2I A;  1KX5 A;  1R4V A;  5B33 A;  3B6G D;  1P3F C;  3TU4 A;  3UTB C;  3X1T C;  1M18 A;  1KX3 C;  3AZF A;  1U35 A;  1P34 B;  2ARO B;  2IO5 C;  5GSU D;  2HIO B;  4NE6 A;  2RVQ C;  4J8U C;  3UT9 B;  3B6F C;  2FJ7 B;  5JA4 A;  1M19 D;  4YM6 A;  2HIO A;  4J8V D;  3UTA D;  3AFA A;  4XZQ C;  5E5A D;  3UT9 A;  4ZUX D;  5CPI C;  2FJ7 A;  3MGR D;  2BYM B;  3REH D;  1P3O B;  2F8N B;  3AZM B;  3H0M C;  4DRA A;  3REI C;  5DNM D;  1P3O A;  3REK B;  4WNN B;  4WU8 D;  4KUD C;  1Q9C A;  2NZD C;  2F8N A;  3AZM A;  3VH5 A;  1P3L D;  1M18 D;  5KDM B;  2F8N G;  1AOI D;  3WKJ C;  3KXB A;  3WA9 B;  3B0D C;  4ZBJ B;  3REK A;  4WNN A;  3REL B;  4H9S A;  3A6N A;  4KGC B;  1PZR A;  5KDM A;  3AZG D;  3P5J B;  3WA9 A;  1P34 D;  3EPH A;  2ARO D;  2YFV B;  2Y2P A;  3KUY C;  2HIO D;  3REL A;  5B0Y C;  5CPJ C;  4EO5 B;  4KGC A;  5B24 D;  5AVB C;  3WAA C;  1P3G C;  2FJ7 D;  5B32 B;  1BH8 A;  1P3A D;  3AV1 B;  4H9O B;  4UPK A;  3C1B B;  1M19 C;  4AWL B;  1A7W A;  2FFF B;  1KX4 A;  4J8X D;  3EPJ A;  5B32 A;  4ZUX C;  1EQZ B;  1ZLA C;  5B1L A;  4H9O A;  3AV1 A;  1KX3 B;  2DQN C;  3B0C T;  5DNN A;  3REH C;  5B32 G;  3AZM D;  4X23 B;  2Y2O A;  4Z66 C;  2IO5 B;  3NQU B;  3REK D;  2F8N K;  3VH6 A;  2PYO C;  1KU5 A;  1KX3 A;  3B6F B;  3AN2 C;  3B0C W;  4WU8 C;  3FDD A;  4XUJ B;  1P3K B;  3X1S C;  1M1A C;  1AOI C;  3NQU A;  4XZQ B;  5B1M B;  3B6F A;  3REJ D;  4H9Q B;  3LEL C;  2CV5 B;  2Y2M A;  1P3K A;  3X1U B;  3MGQ D;  1B6W A;  4XZQ A;  3MGS C;  3LZ1 D;  2Y2G A;  4G92 C;  5B1M A;  2L5A A;  2JSS A;  5CPI A;  3AZH B;  4H9R A;  4KHA B;  4CSR A;  2NQB C;  4KUD B;  5B24 C;  1TZY D;  5B32 D;  2ZY5 A;  3AYW B;  5AV8 B;  5F99 C;  4WU9 C;  3C1B D;  1P3A C;  4KHA A;  3AV2 D;  4KUD A;  2XD1 A;  2NZD A;  2Y2H A;  2ZY4 A;  3WTP D;  1EQZ D;  4J8X C;  4R8P C;  2HUE B;  4G91 C;  5AV8 A;  4JJN C;  4X23 D;  4H9P B;  5AV9 D;  3LJA C;  5GT0 C;  3W96 D;  4LD9 C;  1P3I B;  3LZ0 C;  2YFW A;  2ZY2 A;  1KX5 B;  2RIQ A;  1F66 D;  5B2I D;  4XUJ D;  1P3K D; 
#chains in the Genus database with same CATH homology
 1T3U A;  5CPJ A;  3KUY A;  5AV5 C;  5B0Y A;  3TU4 B;  3W98 C;  3AZL C;  5AVB A;  1P3I A;  3WAA A;  1P3G A;  3X1V B;  5B1M D;  3W97 C;  3W99 C;  2CV5 D;  3AZE B;  3REJ C;  3X1U D;  3MVD D;  4Z66 B;  3MGQ C;  3X1V A;  5JA4 B;  5BT1 C;  3AZJ B;  1ID3 C;  4Z5T C;  3LZ1 C;  4YM6 B;  1HQ3 C;  3AZH D;  3AZE A;  5GT3 C;  5AV6 C;  3KWQ C;  1ZLA A;  3AFA B;  3AN2 B;  4QLC D;  4Z66 A;  3AYW D;  5CPK D;  5AV8 D;  3X1S B;  3AZJ A;  5G49 B;  4HGA C;  5B40 B;  5B31 B;  5AVC C;  3MGP C;  2LY8 A;  5JRG C;  3C1C B;  1P3B D;  3AN2 A;  3AZK C;  4YS3 C;  3WTP C;  3X1S A;  1M1A A;  5G49 A;  3KFU G;  2J8P A;  5B40 A;  5B31 A;  3MGS B;  4G92 B;  5GXQ B;  3C1C A;  5AV9 C;  3LEL A;  5B31 G;  5AY8 D;  5B0Z C;  3KXB B;  2Y2N A;  1S32 D;  1P3M C;  1KX5 D;  5B33 D;  4E45 A;  3A6N B;  3MGS A;  2F8N H;  1F66 C;  5GXQ A;  3TU4 D;  5CP6 C;  5F99 B;  3AZN C;  2F2A C;  3AZF D;  1U35 D;  2NQB A;  3X1V D;  3O62 C;  1P3P C;  5BS7 C;  3A1K A;  3B6G C;  4WU9 A;  5F99 A;  2JE5 A;  3MVD C;  3LJA B;  1BH8 B;  4J8W B;  1N1J B;  4YM6 D;  3AZI B;  5GSU C;  3AFA D;  4R8P A;  5B2J B;  3UT9 D;  4DQY B;  2DF4 C;  1KX4 B;  3LJA A;  4QLC C;  3MNN B;  4J8W A;  5GT0 A;  1N1J A;  5B1L B;  3W98 B;  5CPK C;  4UUZ B;  5DNN B;  3AZI A;  4LD9 A;  3EG5 B;  5BNX B;  5B2J A;  2G5I C;  3WTP E;  4J8V C;  3UTA C;  1P3B C;  5E5A C;  2UWX A;  3MNN A;  5AV5 A;  1P3F B;  3UTB B;  3X1T B;  1P3O D;  3MGR C;  1JFI B;  3W98 A;  2G5H C;  4Z2M G;  3AZL A;  4UUZ A;  2F8N D;  5GXQ D;  5BNX A;  4Z5T B;  1HQ3 B;  5C3I C;  3KWQ B;  2BG1 A;  3KXB D;  4J8U B;  1P3F A;  3UTB A;  3X1T A;  1BH9 B;  5AY8 C;  5DNM C;  1JFI A;  3A6N D;  1WWI A;  1P3L C;  4Z5T A;  4HGA B;  1ID3 A;  1HQ3 A;  1M18 C;  5GT3 A;  5AV6 A;  3KWQ A;  3MGP B;  3WA9 D;  3AZF C;  4J8U A;  1U35 C;  3REL D;  1BH9 A;  5CPI B;  4KGC D;  4H9R B;  4CSR B;  5AVC A;  3MGP A;  3AZG C;  1P34 C;  3AZK A;  3AZI D;  2ARO C;  1Z2C B;  3REI B;  2HIO C;  5B2J D;  2ZY3 A;  1P3M B;  2NZD B;  1KX4 D;  3F6T A;  5CP6 B;  5B1L D;  3AV1 D;  2FJ7 C;  5DNN D;  3WKJ B;  2Y2J A;  3REI A;  3O62 B;  5B0Z A;  3B0D B;  1P3M A;  3AL0 C;  1P3F D;  3UTB D;  5CP6 A;  2YFW B;  1KX3 D;  1P3O C;  3WKJ A;  3O62 A;  3AZM C;  1F1E A;  5CPJ B;  3KUY B;  5BS7 A;  3V9R B;  5B0Y B;  3B6G A;  2RVQ D;  5AVB B;  3WAA B;  1P3G B;  3B6F D;  3REK C;  3VH5 T;  1TAF B;  5CHL B;  4H9S C;  3V9R A;  1BFM A;  1M19 B;  5GSU A;  4XZQ D;  3WA9 C;  3UTA B;  4ZBJ C;  5CPI D;  3REL C;  1TAF A;  3VH5 W;  4ZUX B;  1ZLA B;  3NQJ B;  5FUG B;  3REH B;  1M19 A;  4WJ3 C;  4J8V A;  3UTA A;  4ZUX A;  4EO5 C;  3NQJ A;  5FUG A;  5DNM B;  3MGR A;  4KUD D;  2PYO B;  2NZD D;  1ULY A;  3REH A;  4WU8 B;  1TZY C;  5B32 C;  1P3L B;  1M1A B;  3AV1 C;  4DRB A;  1AOI B;  3C1B C;  5DNM A;  4AWL C;  2PYO A;  3AV2 C;  3EPL A;  4WU8 A;  3LEL B;  1P3L A;  1EQZ C;  4E44 A;  3AZG B;  1AOI A;  5CPJ D;  3KUY D;  4X23 C;  5B0Y D;  5BNV B;  5AVB D;  1P3I D;  3WAA D;  3W96 C;  1P3G D;  2NQB B;  3VH6 T;  5B24 B;  2XD5 A;  4H9N B;  3AZG A;  5B2I C;  4XUJ C;  4WU9 B;  1P34 A;  3EPK A;  1P3A B;  2ARO A;  1P3K C;  5BNV A;  5B24 A;  3VH6 W;  5B1M C;  4H9N A;  3AZE D;  1ZLA D;  4WV4 B;  4J8X B;  2CV5 C;  4R8P B;  4G91 B;  1P3A A;  4JJN B;  3X1U C;  4Z66 D;  4M6B A;  5GT0 B;  3AZJ D;  4LD9 B;  2VQR A;  3LZ0 B;  4J8X A;  2PYO D;  3AZH C;  2BYM A;  3AN2 D;  3IP4 C;  4JJN A;  5AV5 B;  3X1S D;  1M1A D;  3AZL B;  3AYW C;  5AV8 C;  5B40 D;  1H3O B;  5B31 D;  3LZ0 A;  3C1C D;  3W97 B;  3W99 B;  3LEL D;  4CAY B;  3REJ B;  4Z2M H;  2HUE C;  4WZS B;  4NFT A;  3MGS D;  2ZM5 A;  1H3O A;  3MGQ B;  2Y2K A;  3B0B A;  1ID3 B;  3W97 A;  3LZ1 B;  3W99 A;  5GT3 B;  5AV6 B;  2NQB D;  4CAY A;  3REJ A;  1P3I C;  3H0L C;  1S32 C;  3MGQ A;  1TZY B;  5B33 C;  5BO0 B;  1KX5 C;  4WU9 D;  5F99 D;  2YFV A;  2Y2Q A;  3LZ1 A;  3H0R C;  3TU4 C;  5AVC B;  5JRG B;  3X1V C;  3AV2 B;  3AZK B;  4YS3 B;  1TZY A;  1WWS A;  5BO0 A;  3WTP B;  4R8P D;  3AZE C;  4JJN D;  3LJA D;  3C1B A;  4J8W D;  5GT0 D;  5JRG A;  5AV9 B;  3AV2 A;  2CWE A;  4LD9 D;  3AZJ C;  4YS3 A;  3W96 B;  3LZ0 D;  4YM6 C;  5B0Z B;  3WTP A;  1EQZ A;  3AFA C;  1W2E A;  3UT9 C;  3MNN D;  4X23 A;  5B2I B;  5AV5 D;  1F66 B;  5AV9 A;  3AZN B;  3W98 D;  3AZL D;  3W96 A;  2BYK B;  1P3P B;  5B40 C;  5B31 C;  3W97 D;  3W99 D;  1HTA A;  3C1C C;  3B6G B;  1F66 A;  5B2I A;  4XUJ A;  3X1T D;  3AZN A;  3MVD B;  2BYK A;  1P3P A;  5BT1 D;  3KSY A;  4Z5T D;  1ID3 D;  1HQ3 D;  5GXQ C;  5GT3 D;  5AV6 D;  3KWQ D;  5GSU B;  4H9Q A;  2CV5 A;  4J8U D;  3KXB C;  3X1U A;  3MVD A;  4QLC B;  3A6N C;  4NE5 A;  3R45 B;  5CPK B;  5AVC D;  3MGP D;  4NE3 A;  5JRG D;  3AZH A;  4J8V B;  3AZK D;  4YS3 D;  1P3B B;  5E5A B;  4QLC A;  3MGR B;  4KGC C;  3R45 A;  3AYW A;  5CPK A;  1B67 A;  4J8W C;  5C3I B;  1P3B A;  5E5A A;  3REI D;  3A1I A;  5B0Z D;  3AZI C;  1P3M D;  5AY8 B;  5B2J C;  1S32 B;  5B33 B;  4H9P A;  1KX4 C;  5CP6 D;  3AZN D;  2Y2L A;  3MNN C;  1M18 B;  3WKJ D;  2JCH A;  5B1L C;  2W8S A;  3O62 D;  1P3P D;  3AZF B;  5DNN C;  1U35 B;  5AY8 A;  1S32 A;  2Y2I A;  1KX5 A;  1R4V A;  5B33 A;  3B6G D;  1P3F C;  3TU4 A;  3UTB C;  3X1T C;  1M18 A;  1KX3 C;  3AZF A;  1U35 A;  1P34 B;  2ARO B;  2IO5 C;  5GSU D;  2HIO B;  4NE6 A;  2RVQ C;  4J8U C;  3UT9 B;  3B6F C;  2FJ7 B;  5JA4 A;  1M19 D;  4YM6 A;  2HIO A;  4J8V D;  3UTA D;  3AFA A;  4XZQ C;  5E5A D;  3UT9 A;  4ZUX D;  5CPI C;  2FJ7 A;  3MGR D;  2BYM B;  3REH D;  1P3O B;  2F8N B;  3AZM B;  3H0M C;  4DRA A;  3REI C;  5DNM D;  1P3O A;  3REK B;  4WNN B;  4WU8 D;  4KUD C;  1Q9C A;  2NZD C;  2F8N A;  3AZM A;  3VH5 A;  1P3L D;  1M18 D;  5KDM B;  2F8N G;  1AOI D;  3WKJ C;  3KXB A;  3WA9 B;  3B0D C;  4ZBJ B;  3REK A;  4WNN A;  3REL B;  4H9S A;  3A6N A;  4KGC B;  1PZR A;  5KDM A;  3AZG D;  3P5J B;  3WA9 A;  1P34 D;  3EPH A;  2ARO D;  2YFV B;  2Y2P A;  3KUY C;  2HIO D;  3REL A;  5B0Y C;  5CPJ C;  4EO5 B;  4KGC A;  5B24 D;  5AVB C;  3WAA C;  1P3G C;  2FJ7 D;  5B32 B;  1BH8 A;  1P3A D;  3AV1 B;  4H9O B;  4UPK A;  3C1B B;  1M19 C;  4AWL B;  1A7W A;  2FFF B;  1KX4 A;  4J8X D;  3EPJ A;  5B32 A;  4ZUX C;  1EQZ B;  1ZLA C;  5B1L A;  4H9O A;  3AV1 A;  1KX3 B;  2DQN C;  3B0C T;  5DNN A;  3REH C;  5B32 G;  3AZM D;  4X23 B;  2Y2O A;  4Z66 C;  2IO5 B;  3NQU B;  3REK D;  2F8N K;  3VH6 A;  2PYO C;  1KU5 A;  1KX3 A;  3B6F B;  3AN2 C;  3B0C W;  4WU8 C;  3FDD A;  4XUJ B;  1P3K B;  3X1S C;  1M1A C;  1AOI C;  3NQU A;  4XZQ B;  5B1M B;  3B6F A;  3REJ D;  4H9Q B;  3LEL C;  2CV5 B;  2Y2M A;  1P3K A;  3X1U B;  3MGQ D;  1B6W A;  4XZQ A;  3MGS C;  3LZ1 D;  2Y2G A;  4G92 C;  5B1M A;  2L5A A;  2JSS A;  5CPI A;  3AZH B;  4H9R A;  4KHA B;  4CSR A;  2NQB C;  4KUD B;  5B24 C;  1TZY D;  5B32 D;  2ZY5 A;  3AYW B;  5AV8 B;  5F99 C;  4WU9 C;  3C1B D;  1P3A C;  4KHA A;  3AV2 D;  4KUD A;  2XD1 A;  2NZD A;  2Y2H A;  2ZY4 A;  3WTP D;  1EQZ D;  4J8X C;  4R8P C;  2HUE B;  4G91 C;  5AV8 A;  4JJN C;  4X23 D;  4H9P B;  5AV9 D;  3LJA C;  5GT0 C;  3W96 D;  4LD9 C;  1P3I B;  3LZ0 C;  2YFW A;  2ZY2 A;  1KX5 B;  2RIQ A;  1F66 D;  5B2I D;  4XUJ D;  1P3K D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...