5E5AA

Crystal structure of the chromatin-tethering domain of human cytomegalovirus ie1 protein bound to the nucleosome core particle
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
99
structure length
99
Chain Sequence
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (146-MER)
publication title Human cytomegalovirus IE1 protein alters the higher-order chromatin structure by targeting the acidic patch of the nucleosome
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/viral protein/dna
total genus 30
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5e5aA00
5BT1D 5BO0A 3AZHA 3KXBD 1P3BA 1B67A 3C1BA 1P3OB 1F66A 1P34B 5BNXA 3REJC 3AZID 3AV1B 4QLCA 5CPID 3WAAA 5B33A 3AZHB 3AYWB 3MGQC 1P3BB 4J8UD 1F66B 5AY8D 4XUJD 5FUGB 1B6WA 3KSYA 4DRBA 5B33B 5GT0C 3LJAA 4LD9B 3WA9B 4J8XA 3X1TA 4G91B 5CPJD 5B32D 5DNMD 4WU9B 1P3OC 1P34C 5B0YA 3AFAD 3AV1C 3AZED 3X1TB 3MVDB 3AZHC 1P3BC 1F66C 3C1BC 3B6FA 5B2ID 2NQBD 3LZ1D 3AV2D 4QLCC 4X23A 3W99A 3WAAC 5B0ZA 5B33C 3AN2D 1P3LA 5B31D 3B6FB 1KU5A 3X1VA 3B6GA 3W99B 1M18B 5AV8A 5B0ZB 1P3LB 4G91C 3LJAC 4G92C 5CPKA 2NZDD 3X1VB 4J8XC 5AV8B 3X1TC 3W97A 5CPKB 4J8VB 5B0YC 2L5AA 5KDMB 1KX3A 3W97B 3B6FC 2PYOA 5JRGA 1ZLAB 1Q9CA 4X23C 1P3MA 3W99C 4WV4B 5B0ZC 1P3LC 1KX3B 3B0CT 4Z5TA 2PYOB 5JRGB 3X1VC 1P3MB 3B6GC 5CP6D 5AV8C 2YFWA 3MGPB 4Z5TB 4CSRB 5AV9B 5CPKC 5B1LA 3MGSA 3AZGA 1P3PD 4Z66D 3MGRD 3W97C 5B1LB 3MGSB 5B24D 1S32A 3LZ0A 3AZGB 5AV5A 4NE3A 4YM6B 1AOID 1KX3C 3AZJA 4ZUXD 2PYOC 5JRGC 1S32B 3LZ0B 5AV5B 5B32G 1P3MC 1TZYD 4WZSB 3AZND 4Z5TC 1BH9A 4JJNA 1M1AD 4R8PA 3REID 3X1SA 3LELD 3REKD 1BH9B 5CHLB 5B1LC 4J8WD 3MGSC 5B31G 5E5AA 4JJNB 3AZGC 5JA4B 5B1MD 3X1SB 2FJ7A 4WU8D 1HTAA 4NFTA 1S32C 4WNNA 5GXQD 3LZ0C 3KUYB 5AV5C 3W96A 4M6BA 4HGAC 3AZJC 2FJ7B 1N1JA 3B0DB 4WNNB 1EQZA 2AROA 3RELD 5GT3A 1HQ3B 4NE5A 1WWSA 4H9OB 3KXBA 4JJNC 2AROB 4R8PC 3X1SC 5CPIA 3KXBB 3O62D 4J8UA 1KX4A 5E5AC 2FJ7C 1ID3D 5CPIB 3B0DC 4XZQA 3MNNA 4J8UB 5AY8B 3W96C 1KX5D 3WTPE 3MNNB 1EQZC 3UT9D 4KGCD 2AROC 3WKJD 3AZEA 5GT3C 2CV5C 5B32B 3KXBC 3AZMD 1P3KD 2NQBA 3LZ1A 3AYWA 3AFAB 3AV2A 3AZEB 2F8NK 5CPIC 5FUGA 1KX4C 4J8UC 2BYMA 3LZ1B 4KUDD 3AV2B 2NQBB 3B0BA 3WTPD 1BFMA 4H9QA 4XZQC 3MNNC 3WA9A 4LD9A 5AVBD 2BYMB 5B40D 3UTAD 4KHAA 4WU9A 4H9QB 2HIOD 2F8NA 4UUZA 4KHAB 3MVDA 3AZEC 2F8NB 3UTBD 4UUZB 2NQBC 3AYWC 2RVQC 3AV2C 3REJD 5C3IB 1P3ID 4Z2MH 1M18A 5DNNA 4EO5B 4LD9C 3WA9C 5DNNB 5GT0D 4WU9C 5CP6B 4J8VA 4Z66A 1M19D 5KDMA 3MVDC 1P3OD 5B2JA 1P34D 1P3PB 4Z66B 1ZLAA 3MGRB 1F66D 3C1BD 5B2JB 1TZYA 4H9PA 4QLCD 1AOIB 4ZUXB 3WAAD 1M18C 5B33D 5DNNC 3MGPA 4YS3A 4CSRA 5AV9A 1TZYB 4H9PB 3AZNB 4NE6A 2YFVA 4YS3B 3LJAD 4J8VC 3NQJA 4Z66C 2JSSA 5AVCA 4J8XD 3REIB 4H9SA 3LELB 4YM6A 3REKB 2YFVB 3REHD 5GXQA 5B2JC 3NQJB 5B0YD 1ZLAC 5AVCB 5B1MB 3VH6W 4WU8B 5GXQB 5F99A 4X23D 3VH5W 3W98D 3W99D 5B0ZD 1BH8A 3MGPC 3C1CA 4YS3C 5F99B 5AV9C 4H9NA 3AZKD 3B6GD 5AV8D 1BH8B 5JA4A 2HUEB 3C1CB 1U35A 4H9NB 4H9RB 5AVCC 3KUYA 4H9SC 1ID3A 4YM6C 3AZLA 3NQUA 3W97D 1U35B 5GXQC 1KX5A 5GSUD 1P3FD 1ID3B 3AZLB 3NQUB 3X1UD 1KX3D 4AWLB 2PYOD 5F99C 1KX5B 1HQ3A 3KWQD 4H9OA 3VH6T 2HUEC 4Z5TD 4CAYA 3C1CC 3UT9B 1P3KA 1P3GD 4KGCB 3V9RB 3AZIA 5AV6D 4CAYB 3AZMB 1P3KB 1U35C 5B1LD 3MGSD 4KUDA 5AY8A 3KUYC 3AZIB 1ID3C 4XUJA 3AZLC 4AWLC 5B40A 1S32D 4KUDB 1KX5C 4DRAA 3LZ0D 3WTPB 3UTAA 5AV5D 4XUJB 3AZJD 5B40B 3A6ND 5CPJA 1HQ3C 3AZFD 3UTAB 5B32A 5DNMA 1P3AD 3AFAA 5BT1C 1F1EA 3UTBA 1P3KC 5CPJB 5DNMB 2F8NH 1JFIA 5B2IA 3AZIC 4R8PD 3X1SD 1P3IA 1H3OA 3UTBB 3AN2A 4E45A 5B31A 4KUDC 5E5AD 1JFIB 5AY8C 5B2IB 3REJB 4XUJC 1P3IB 2FJ7D 1H3OB 3AN2B 5B40C 5B31B 3TU4D 3UTAC 3W96D 2NZDA 5BNVA 1M19A 5CPJC 1EQZD 5B32C 5DNMC 2NZDB 5BNVB 2AROD 1M19B 4Z2MG 3AFAC 5GT3D 2CV5D 3UTBC 5B2IC 3LZ1C 5BO0B 1P3IC 3AN2C 5B31C 3C1BB 1KX4D 5BNXB 3MGQD 4QLCB 3WAAB 4XZQD 5CP6A 2CWEA 3MNND 2NZDC 1M19C 1P3PA 3REHA 3LJAB 3MGRA 4G92B 5B24A 4J8XB 3AV1D 5C3IC 1AOIA 3REHB 3B0CW 4ZUXA 3AZHD 3AYWD 2RVQD 5B0YB 5B24B 1P3BD 3W98A 4EO5C 3R45A 3AZNA 4X23B 3AZKA 3W98B 3R45B 4LD9D 5CP6C 1M1AA 3WA9D 3REIA 3LELA 3REKA 5BS7A 3AZKB 2LY8A 4WU9D 4J8WA 3B6GB 2F8ND 4E44A 1P3PC 1M1AB 5B1MA 3REHC 1A7WA 3X1TD 3MGRC 4WU8A 3MVDD 4J8WB 5B24C 5GSUA 1P3FA 4ZBJB 1AOIC 3X1UA 4ZUXC 5GSUB 3KWQA 1P3FB 3B6FD 3W98C 1TZYC 3X1UB 3RELA 3AZNC 1M18D 5DNND 1P3LD 1P3GA 3KWQB 3AZKC 4H9RA 5AV6A 3RELB 3REIC 3X1VD 1M1AC 1TAFA 3LELC 3REKC 1P3GB 5BS7C 4J8WC 3O62A 5CPKD 4ZBJC 4J8VD 2YFWB 5AV6B 1TAFB 5B1MC 4WU8C 3O62B 5GSUC 1P3FC 5B2JD 1ZLAD 3VH6A 3X1UC 3A6NA 3AZFA 3KWQC 3UT9A 5JRGD 4HGAB 1P3AA 4KGCA 3VH5A 3AZJB 1P3MD 3RELC 3WKJA 3V9RA 3A6NB 3MGPD 3AZFB 1P3GC 4YS3D 3AZMA 5AV9D 1ULYA 1P3AB 1WWIA 5AV6C 3WKJB 3VH5T 3O62C 5AVCD 4R8PB 3WTPA 5G49A 3AZGD 4YM6D 3TU4A 5E5AB 5AVBA 2IO5B 2BYKA 5G49B 2HIOA 3A6NC 2F8NG 3TU4B 3AZFC 5AVBB 3UT9C 5F99D 3W96B 1P3AC 4KGCC 2BYKB 1N1JB 1R4VA 2HIOB 2CV5A 3WKJC 1EQZB 3C1CD 3AZMC 4JJND 5GT3B 2CV5B 3REJA 1U35D 3MGQA 2IO5C 3WTPC 3KUYD 3AZLD 1KX4B 3TU4C 5AVBC 3MGQB 5GT0A 2HIOC 4XZQB 1HQ3D 5GT0B 1P3OA 1P34A 3AV1A
chains in the Genus database with same CATH superfamily
5BT1D 5BO0A 2Y2IA 3AZHA 3KXBD 1P3BA 1B67A 3C1BA 1P3OB 1F66A 1P34B 5BNXA 3REJC 3AZID 3AV1B 4QLCA 5CPID 3WAAA 5B33A 3AZHB 3AYWB 3MGQC 1P3BB 4J8UD 1F66B 5AY8D 4XUJD 5FUGB 1B6WA 3KSYA 4DRBA 5B33B 5GT0C 3LJAA 4LD9B 3WA9B 4J8XA 3X1TA 4G91B 5CPJD 2J8PA 5B32D 5DNMD 4WU9B 1P3OC 1P34C 5B0YA 3AFAD 3AV1C 3AZED 3H0MC 2XD5A 3X1TB 3A1KA 3MVDB 3AZHC 1P3BC 3C1BC 1F66C 3B6FA 5B2ID 2NQBD 3LZ1D 3AV2D 4QLCC 4X23A 2ZY2A 3W99A 3WAAC 5B0ZA 5B33C 3AN2D 1P3LA 5B31D 3B6FB 1KU5A 3X1VA 3B6GA 3W99B 1M18B 5AV8A 5B0ZB 1P3LB 4G91C 3LJAC 4G92C 5CPKA 2NZDD 3X1VB 4J8XC 5AV8B 3X1TC 2ZM5A 3W97A 5CPKB 4J8VB 5B0YC 2L5AA 5KDMB 1KX3A 3W97B 3AL0C 3B6FC 2PYOA 5JRGA 1ZLAB 1Q9CA 3F6TA 4X23C 1P3MA 2Y2MA 4WV4B 3W99C 5B0ZC 1P3LC 1KX3B 2ZY3A 3B0CT 4Z5TA 2PYOB 5JRGB 1PZRA 3X1VC 1P3MB 3B6GC 5CP6D 5AV8C 2YFWA 3MGPB 4Z5TB 4CSRB 5AV9B 5CPKC 5B1LA 3MGSA 3AZGA 1P3PD 4Z66D 3MGRD 3W97C 2ZY5A 5B1LB 3MGSB 5B24D 1S32A 3LZ0A 3AZGB 1W2EA 1Z2CB 4NE3A 5AV5A 4YM6B 1AOID 1KX3C 3AZJA 4ZUXD 2PYOC 5JRGC 1S32B 3LZ0B 5AV5B 5B32G 1P3MC 1TZYD 4WZSB 3AZND 4Z5TC 1BH9A 3EPLA 4JJNA 1M1AD 4R8PA 3REID 3X1SA 3LELD 3REKD 1BH9B 5CHLB 5B1LC 4J8WD 3MGSC 3FDDA 5B31G 5E5AA 4JJNB 3AZGC 5JA4B 5B1MD 3X1SB 2FJ7A 4WU8D 1HTAA 4NFTA 1S32C 2Y2PA 4WNNA 5GXQD 3LZ0C 3KUYB 5AV5C 3W96A 4M6BA 4HGAC 3AZJC 2FJ7B 1N1JA 3B0DB 4WNNB 1EQZA 2AROA 3RELD 5GT3A 1HQ3B 4NE5A 1WWSA 4H9OB 3KXBA 4JJNC 2AROB 4R8PC 3X1SC 5CPIA 3A1IA 3KXBB 3O62D 4J8UA 1KX4A 5E5AC 4DQYB 2FJ7C 1ID3D 5CPIB 3B0DC 4XZQA 3MNNA 4J8UB 5AY8B 3W96C 1KX5D 3WTPE 3MNNB 1EQZC 3UT9D 4KGCD 2AROC 3WKJD 3AZEA 4UPKA 5GT3C 2CV5C 5B32B 3KXBC 3AZMD 1P3KD 2NQBA 3LZ1A 3AYWA 3AFAB 3AV2A 3AZEB 2F8NK 5CPIC 5FUGA 1KX4C 4J8UC 2BYMA 3LZ1B 4KUDD 3AV2B 2NQBB 3B0BA 3WTPD 1BFMA 4H9QA 4XZQC 3MNNC 3WA9A 4LD9A 2G5HC 5AVBD 2BYMB 5B40D 3UTAD 4KHAA 4WU9A 2XD1A 4H9QB 2HIOD 2F8NA 2FFFB 4UUZA 4KHAB 3MVDA 2Y2OA 3AZEC 2F8NB 3UTBD 4UUZB 2NQBC 3AYWC 2RVQC 3AV2C 3REJD 5C3IB 1P3ID 4Z2MH 1M18A 5DNNA 4EO5B 4LD9C 3WA9C 5DNNB 5GT0D 4WU9C 2W8SA 5CP6B 4J8VA 4Z66A 1M19D 5KDMA 2Y2GA 3MVDC 3KFUG 2JCHA 1P3OD 5B2JA 1P34D 1P3PB 4Z66B 1ZLAA 3MGRB 1F66D 3C1BD 5B2JB 1TZYA 4H9PA 4QLCD 1AOIB 4ZUXB 3WAAD 1M18C 5B33D 5DNNC 3MGPA 4YS3A 4CSRA 5AV9A 1TZYB 4H9PB 3AZNB 4NE6A 2YFVA 4YS3B 3LJAD 4J8VC 3NQJA 4Z66C 2JSSA 5AVCA 4J8XD 3REIB 4H9SA 3LELB 4YM6A 3REKB 2YFVB 3REHD 5GXQA 5B2JC 3NQJB 5B0YD 1ZLAC 5AVCB 5B1MB 3VH6W 4WU8B 5GXQB 5F99A 4X23D 3VH5W 3W98D 3W99D 5B0ZD 1BH8A 3MGPC 3C1CA 4YS3C 5F99B 5AV9C 4H9NA 3AZKD 3B6GD 5AV8D 1BH8B 5JA4A 2HUEB 3C1CB 1U35A 4H9NB 4H9RB 5AVCC 2VQRA 3KUYA 2Y2NA 4H9SC 1ID3A 4YM6C 3AZLA 3NQUA 3W97D 1U35B 5GXQC 1KX5A 5GSUD 1P3FD 2Y2QA 1ID3B 3AZLB 3NQUB 3X1UD 1KX3D 4AWLB 2PYOD 5F99C 1KX5B 1HQ3A 3KWQD 4H9OA 3VH6T 2HUEC 4Z5TD 4CAYA 3C1CC 3UT9B 1P3KA 2Y2JA 1P3GD 4KGCB 3V9RB 3AZIA 5AV6D 4CAYB 3AZMB 1P3KB 1U35C 2G5IC 5B1LD 3MGSD 4KUDA 2BG1A 5AY8A 3KUYC 3AZIB 1ID3C 4XUJA 3AZLC 4AWLC 5B40A 1S32D 4KUDB 1KX5C 4DRAA 3LZ0D 3WTPB 3UTAA 5AV5D 4XUJB 3AZJD 5B40B 3A6ND 5CPJA 1HQ3C 3AZFD 3UTAB 5B32A 5DNMA 1P3AD 3AFAA 5BT1C 1F1EA 3UTBA 1P3KC 5CPJB 5DNMB 2F8NH 1JFIA 5B2IA 3AZIC 4R8PD 3X1SD 1P3IA 1H3OA 3UTBB 3AN2A 4E45A 5B31A 4KUDC 5E5AD 3H0RC 1JFIB 5AY8C 5B2IB 3REJB 4WJ3C 4XUJC 1P3IB 2FJ7D 1H3OB 3AN2B 3EPKA 5B40C 5B31B 3TU4D 3UTAC 3W96D 2NZDA 5BNVA 1M19A 5CPJC 1EQZD 5B32C 5DNMC 2NZDB 5BNVB 2AROD 1M19B 4Z2MG 3AFAC 5GT3D 2CV5D 3UTBC 5B2IC 3LZ1C 5BO0B 1P3IC 3AN2C 5B31C 3C1BB 1KX4D 5BNXB 3MGQD 4QLCB 2DQNC 3WAAB 4XZQD 5CP6A 2CWEA 3MNND 1T3UA 2NZDC 1M19C 1P3PA 3EG5B 3REHA 3LJAB 3MGRA 4G92B 5B24A 4J8XB 3AV1D 5C3IC 1AOIA 3REHB 3B0CW 4ZUXA 2RIQA 2Y2HA 3AZHD 3AYWD 2RVQD 5B0YB 5B24B 1P3BD 3W98A 4EO5C 3R45A 3AZNA 4X23B 2UWXA 3AZKA 3W98B 3R45B 4LD9D 5CP6C 1M1AA 3WA9D 3REIA 3H0LC 3LELA 3REKA 5BS7A 3AZKB 2LY8A 4WU9D 4J8WA 3B6GB 2F8ND 4E44A 1P3PC 1M1AB 5B1MA 3REHC 1A7WA 3X1TD 3MGRC 4WU8A 3MVDD 4J8WB 5B24C 5GSUA 1P3FA 4ZBJB 1AOIC 2Y2LA 3X1UA 3P5JB 4ZUXC 5GSUB 3KWQA 1P3FB 3B6FD 3EPHA 3W98C 1TZYC 3X1UB 3RELA 3AZNC 1M18D 5DNND 1P3LD 1P3GA 3KWQB 3AZKC 4H9RA 5AV6A 3RELB 3REIC 3X1VD 1M1AC 1TAFA 3LELC 3REKC 1P3GB 5BS7C 4J8WC 3O62A 5CPKD 4ZBJC 4J8VD 2YFWB 5AV6B 1TAFB 5B1MC 4WU8C 3O62B 2JE5A 5GSUC 1P3FC 5B2JD 1ZLAD 3VH6A 3X1UC 2DF4C 3A6NA 3AZFA 3KWQC 3UT9A 5JRGD 2F2AC 4HGAB 1P3AA 4KGCA 3VH5A 3AZJB 1P3MD 3RELC 3WKJA 3EPJA 3V9RA 3A6NB 3MGPD 3AZFB 1P3GC 4YS3D 3AZMA 5AV9D 1ULYA 1P3AB 1WWIA 5AV6C 3WKJB 3VH5T 3O62C 5AVCD 4R8PB 3WTPA 5G49A 3AZGD 4YM6D 3TU4A 5E5AB 5AVBA 2IO5B 2BYKA 5G49B 2HIOA 2Y2KA 3A6NC 2F8NG 3IP4C 3TU4B 3AZFC 5AVBB 3UT9C 5F99D 3W96B 1P3AC 4KGCC 2BYKB 1N1JB 1R4VA 2HIOB 2CV5A 3WKJC 1EQZB 3C1CD 3AZMC 4JJND 5GT3B 2CV5B 3REJA 1U35D 3MGQA 2IO5C 3WTPC 3KUYD 3AZLD 1KX4B 3TU4C 5AVBC 3MGQB 5GT0A 2HIOC 4XZQB 2ZY4A 1HQ3D 5GT0B 1P3OA 1P34A 3AV1A
chains in the Genus database with same CATH topology
5BT1D 5BO0A 2Y2IA 3AZHA 3KXBD 1P3BA 1B67A 3C1BA 1P3OB 1F66A 1P34B 5BNXA 3REJC 3AZID 3AV1B 4QLCA 5CPID 3WAAA 5B33A 3AZHB 3AYWB 3MGQC 1P3BB 4J8UD 1F66B 5AY8D 4XUJD 5FUGB 1B6WA 3KSYA 4DRBA 5B33B 5GT0C 3LJAA 4LD9B 3WA9B 4J8XA 3X1TA 4G91B 5CPJD 2J8PA 5B32D 5DNMD 4WU9B 1P3OC 1P34C 5B0YA 3AFAD 3AV1C 3AZED 3H0MC 2XD5A 3X1TB 3A1KA 3MVDB 3AZHC 1P3BC 3C1BC 1F66C 3B6FA 5B2ID 2NQBD 3LZ1D 3AV2D 4QLCC 4X23A 2ZY2A 3W99A 3WAAC 5B0ZA 5B33C 3AN2D 1P3LA 5B31D 3B6FB 1KU5A 3X1VA 3B6GA 3W99B 1M18B 5AV8A 5B0ZB 1P3LB 4G91C 3LJAC 4G92C 5CPKA 2NZDD 3X1VB 4J8XC 5AV8B 3X1TC 2ZM5A 3W97A 5CPKB 4J8VB 5B0YC 2L5AA 5KDMB 1KX3A 3W97B 3AL0C 3B6FC 2PYOA 5JRGA 1ZLAB 1Q9CA 3F6TA 4X23C 1P3MA 2Y2MA 4WV4B 3W99C 5B0ZC 1P3LC 1KX3B 2ZY3A 3B0CT 4Z5TA 2PYOB 5JRGB 1PZRA 3X1VC 1P3MB 3B6GC 5CP6D 5AV8C 2YFWA 3MGPB 4Z5TB 4CSRB 5AV9B 5CPKC 5B1LA 3MGSA 3AZGA 1P3PD 4Z66D 3MGRD 3W97C 2ZY5A 5B1LB 3MGSB 5B24D 1S32A 3LZ0A 3AZGB 1W2EA 1Z2CB 4NE3A 5AV5A 4YM6B 1AOID 1KX3C 3AZJA 4ZUXD 2PYOC 5JRGC 1S32B 3LZ0B 5AV5B 5B32G 1P3MC 1TZYD 4WZSB 3AZND 4Z5TC 1BH9A 3EPLA 4JJNA 1M1AD 4R8PA 3REID 3X1SA 3LELD 3REKD 1BH9B 5CHLB 5B1LC 4J8WD 3MGSC 3FDDA 5B31G 5E5AA 4JJNB 3AZGC 5JA4B 5B1MD 3X1SB 2FJ7A 4WU8D 1HTAA 4NFTA 1S32C 2Y2PA 4WNNA 5GXQD 3LZ0C 3KUYB 5AV5C 3W96A 4M6BA 4HGAC 3AZJC 2FJ7B 1N1JA 3B0DB 4WNNB 1EQZA 2AROA 3RELD 5GT3A 1HQ3B 4NE5A 1WWSA 4H9OB 3KXBA 4JJNC 2AROB 4R8PC 3X1SC 5CPIA 3A1IA 3KXBB 3O62D 4J8UA 1KX4A 5E5AC 4DQYB 2FJ7C 1ID3D 5CPIB 3B0DC 4XZQA 3MNNA 4J8UB 5AY8B 3W96C 1KX5D 3WTPE 3MNNB 1EQZC 3UT9D 4KGCD 2AROC 3WKJD 3AZEA 4UPKA 5GT3C 2CV5C 5B32B 3KXBC 3AZMD 1P3KD 2NQBA 3LZ1A 3AYWA 3AFAB 3AV2A 3AZEB 2F8NK 5CPIC 5FUGA 1KX4C 4J8UC 2BYMA 3LZ1B 4KUDD 3AV2B 2NQBB 3B0BA 3WTPD 1BFMA 4H9QA 4XZQC 3MNNC 3WA9A 4LD9A 2G5HC 5AVBD 2BYMB 5B40D 3UTAD 4KHAA 4WU9A 2XD1A 4H9QB 2HIOD 2F8NA 2FFFB 4UUZA 4KHAB 3MVDA 2Y2OA 3AZEC 2F8NB 3UTBD 4UUZB 2NQBC 3AYWC 2RVQC 3AV2C 3REJD 5C3IB 1P3ID 4Z2MH 1M18A 5DNNA 4EO5B 4LD9C 3WA9C 5DNNB 5GT0D 4WU9C 2W8SA 5CP6B 4J8VA 4Z66A 1M19D 5KDMA 2Y2GA 3MVDC 3KFUG 2JCHA 1P3OD 5B2JA 1P34D 1P3PB 4Z66B 1ZLAA 3MGRB 1F66D 3C1BD 5B2JB 1TZYA 4H9PA 4QLCD 1AOIB 4ZUXB 3WAAD 1M18C 5B33D 5DNNC 3MGPA 4YS3A 4CSRA 5AV9A 1TZYB 4H9PB 3AZNB 4NE6A 2YFVA 4YS3B 3LJAD 4J8VC 3NQJA 4Z66C 2JSSA 5AVCA 4J8XD 3REIB 4H9SA 3LELB 4YM6A 3REKB 2YFVB 3REHD 5GXQA 5B2JC 3NQJB 5B0YD 1ZLAC 5AVCB 5B1MB 3VH6W 4WU8B 5GXQB 5F99A 4X23D 3VH5W 3W98D 3W99D 5B0ZD 1BH8A 3MGPC 3C1CA 4YS3C 5F99B 5AV9C 4H9NA 3AZKD 3B6GD 5AV8D 1BH8B 5JA4A 2HUEB 3C1CB 1U35A 4H9NB 4H9RB 5AVCC 2VQRA 3KUYA 2Y2NA 4H9SC 1ID3A 4YM6C 3AZLA 3NQUA 3W97D 1U35B 5GXQC 1KX5A 5GSUD 1P3FD 2Y2QA 1ID3B 3AZLB 3NQUB 3X1UD 1KX3D 4AWLB 2PYOD 5F99C 1KX5B 1HQ3A 3KWQD 4H9OA 3VH6T 2HUEC 4Z5TD 4CAYA 3C1CC 3UT9B 1P3KA 2Y2JA 1P3GD 4KGCB 3V9RB 3AZIA 5AV6D 4CAYB 3AZMB 1P3KB 1U35C 2G5IC 5B1LD 3MGSD 4KUDA 2BG1A 5AY8A 3KUYC 3AZIB 1ID3C 4XUJA 3AZLC 4AWLC 5B40A 1S32D 4KUDB 1KX5C 4DRAA 3LZ0D 3WTPB 3UTAA 5AV5D 4XUJB 3AZJD 5B40B 3A6ND 5CPJA 1HQ3C 3AZFD 3UTAB 5B32A 5DNMA 1P3AD 3AFAA 5BT1C 1F1EA 3UTBA 1P3KC 5CPJB 5DNMB 2F8NH 1JFIA 5B2IA 3AZIC 4R8PD 3X1SD 1P3IA 1H3OA 3UTBB 3AN2A 4E45A 5B31A 4KUDC 5E5AD 3H0RC 1JFIB 5AY8C 5B2IB 3REJB 4WJ3C 4XUJC 1P3IB 2FJ7D 1H3OB 3AN2B 3EPKA 5B40C 5B31B 3TU4D 3UTAC 3W96D 2NZDA 5BNVA 1M19A 5CPJC 1EQZD 5B32C 5DNMC 2NZDB 5BNVB 2AROD 1M19B 4Z2MG 3AFAC 5GT3D 2CV5D 3UTBC 5B2IC 3LZ1C 5BO0B 1P3IC 3AN2C 5B31C 3C1BB 1KX4D 5BNXB 3MGQD 4QLCB 2DQNC 3WAAB 4XZQD 5CP6A 2CWEA 3MNND 1T3UA 2NZDC 1M19C 1P3PA 3EG5B 3REHA 3LJAB 3MGRA 4G92B 5B24A 4J8XB 3AV1D 5C3IC 1AOIA 3REHB 3B0CW 4ZUXA 2RIQA 2Y2HA 3AZHD 3AYWD 2RVQD 5B0YB 5B24B 1P3BD 3W98A 4EO5C 3R45A 3AZNA 4X23B 2UWXA 3AZKA 3W98B 3R45B 4LD9D 5CP6C 1M1AA 3WA9D 3REIA 3H0LC 3LELA 3REKA 5BS7A 3AZKB 2LY8A 4WU9D 4J8WA 3B6GB 2F8ND 4E44A 1P3PC 1M1AB 5B1MA 3REHC 1A7WA 3X1TD 3MGRC 4WU8A 3MVDD 4J8WB 5B24C 5GSUA 1P3FA 4ZBJB 1AOIC 2Y2LA 3X1UA 3P5JB 4ZUXC 5GSUB 3KWQA 1P3FB 3B6FD 3EPHA 3W98C 1TZYC 3X1UB 3RELA 3AZNC 1M18D 5DNND 1P3LD 1P3GA 3KWQB 3AZKC 4H9RA 5AV6A 3RELB 3REIC 3X1VD 1M1AC 1TAFA 3LELC 3REKC 1P3GB 5BS7C 4J8WC 3O62A 5CPKD 4ZBJC 4J8VD 2YFWB 5AV6B 1TAFB 5B1MC 4WU8C 3O62B 2JE5A 5GSUC 1P3FC 5B2JD 1ZLAD 3VH6A 3X1UC 2DF4C 3A6NA 3AZFA 3KWQC 3UT9A 5JRGD 2F2AC 4HGAB 1P3AA 4KGCA 3VH5A 3AZJB 1P3MD 3RELC 3WKJA 3EPJA 3V9RA 3A6NB 3MGPD 3AZFB 1P3GC 4YS3D 3AZMA 5AV9D 1ULYA 1P3AB 1WWIA 5AV6C 3WKJB 3VH5T 3O62C 5AVCD 4R8PB 3WTPA 5G49A 3AZGD 4YM6D 3TU4A 5E5AB 5AVBA 2IO5B 2BYKA 5G49B 2HIOA 2Y2KA 3A6NC 2F8NG 3IP4C 3TU4B 3AZFC 5AVBB 3UT9C 5F99D 3W96B 1P3AC 4KGCC 2BYKB 1N1JB 1R4VA 2HIOB 2CV5A 3WKJC 1EQZB 3C1CD 3AZMC 4JJND 5GT3B 2CV5B 3REJA 1U35D 3MGQA 2IO5C 3WTPC 3KUYD 3AZLD 1KX4B 3TU4C 5AVBC 3MGQB 5GT0A 2HIOC 4XZQB 2ZY4A 1HQ3D 5GT0B 1P3OA 1P34A 3AV1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BT1 D;  5BO0 A;  3AZH A;  3KXB D;  1P3B A;  1B67 A;  3C1B A;  1P3O B;  1F66 A;  1P34 B;  5BNX A;  3REJ C;  3AZI D;  3AV1 B;  4QLC A;  5CPI D;  3WAA A;  5B33 A;  3AZH B;  3AYW B;  3MGQ C;  1P3B B;  4J8U D;  1F66 B;  5AY8 D;  4XUJ D;  5FUG B;  1B6W A;  3KSY A;  4DRB A;  5B33 B;  5GT0 C;  3LJA A;  4LD9 B;  3WA9 B;  4J8X A;  3X1T A;  4G91 B;  5CPJ D;  5B32 D;  5DNM D;  4WU9 B;  1P3O C;  1P34 C;  5B0Y A;  3AFA D;  3AV1 C;  3AZE D;  3X1T B;  3MVD B;  3AZH C;  1P3B C;  1F66 C;  3C1B C;  3B6F A;  5B2I D;  2NQB D;  3LZ1 D;  3AV2 D;  4QLC C;  4X23 A;  3W99 A;  3WAA C;  5B0Z A;  5B33 C;  3AN2 D;  1P3L A;  5B31 D;  3B6F B;  1KU5 A;  3X1V A;  3B6G A;  3W99 B;  1M18 B;  5AV8 A;  5B0Z B;  1P3L B;  4G91 C;  3LJA C;  4G92 C;  5CPK A;  2NZD D;  3X1V B;  4J8X C;  5AV8 B;  3X1T C;  3W97 A;  5CPK B;  4J8V B;  5B0Y C;  2L5A A;  5KDM B;  1KX3 A;  3W97 B;  3B6F C;  2PYO A;  5JRG A;  1ZLA B;  1Q9C A;  4X23 C;  1P3M A;  3W99 C;  4WV4 B;  5B0Z C;  1P3L C;  1KX3 B;  3B0C T;  4Z5T A;  2PYO B;  5JRG B;  3X1V C;  1P3M B;  3B6G C;  5CP6 D;  5AV8 C;  2YFW A;  3MGP B;  4Z5T B;  4CSR B;  5AV9 B;  5CPK C;  5B1L A;  3MGS A;  3AZG A;  1P3P D;  4Z66 D;  3MGR D;  3W97 C;  5B1L B;  3MGS B;  5B24 D;  1S32 A;  3LZ0 A;  3AZG B;  5AV5 A;  4NE3 A;  4YM6 B;  1AOI D;  1KX3 C;  3AZJ A;  4ZUX D;  2PYO C;  5JRG C;  1S32 B;  3LZ0 B;  5AV5 B;  5B32 G;  1P3M C;  1TZY D;  4WZS B;  3AZN D;  4Z5T C;  1BH9 A;  4JJN A;  1M1A D;  4R8P A;  3REI D;  3X1S A;  3LEL D;  3REK D;  1BH9 B;  5CHL B;  5B1L C;  4J8W D;  3MGS C;  5B31 G;  5E5A A;  4JJN B;  3AZG C;  5JA4 B;  5B1M D;  3X1S B;  2FJ7 A;  4WU8 D;  1HTA A;  4NFT A;  1S32 C;  4WNN A;  5GXQ D;  3LZ0 C;  3KUY B;  5AV5 C;  3W96 A;  4M6B A;  4HGA C;  3AZJ C;  2FJ7 B;  1N1J A;  3B0D B;  4WNN B;  1EQZ A;  2ARO A;  3REL D;  5GT3 A;  1HQ3 B;  4NE5 A;  1WWS A;  4H9O B;  3KXB A;  4JJN C;  2ARO B;  4R8P C;  3X1S C;  5CPI A;  3KXB B;  3O62 D;  4J8U A;  1KX4 A;  5E5A C;  2FJ7 C;  1ID3 D;  5CPI B;  3B0D C;  4XZQ A;  3MNN A;  4J8U B;  5AY8 B;  3W96 C;  1KX5 D;  3WTP E;  3MNN B;  1EQZ C;  3UT9 D;  4KGC D;  2ARO C;  3WKJ D;  3AZE A;  5GT3 C;  2CV5 C;  5B32 B;  3KXB C;  3AZM D;  1P3K D;  2NQB A;  3LZ1 A;  3AYW A;  3AFA B;  3AV2 A;  3AZE B;  2F8N K;  5CPI C;  5FUG A;  1KX4 C;  4J8U C;  2BYM A;  3LZ1 B;  4KUD D;  3AV2 B;  2NQB B;  3B0B A;  3WTP D;  1BFM A;  4H9Q A;  4XZQ C;  3MNN C;  3WA9 A;  4LD9 A;  5AVB D;  2BYM B;  5B40 D;  3UTA D;  4KHA A;  4WU9 A;  4H9Q B;  2HIO D;  2F8N A;  4UUZ A;  4KHA B;  3MVD A;  3AZE C;  2F8N B;  3UTB D;  4UUZ B;  2NQB C;  3AYW C;  2RVQ C;  3AV2 C;  3REJ D;  5C3I B;  1P3I D;  4Z2M H;  1M18 A;  5DNN A;  4EO5 B;  4LD9 C;  3WA9 C;  5DNN B;  5GT0 D;  4WU9 C;  5CP6 B;  4J8V A;  4Z66 A;  1M19 D;  5KDM A;  3MVD C;  1P3O D;  5B2J A;  1P34 D;  1P3P B;  4Z66 B;  1ZLA A;  3MGR B;  1F66 D;  3C1B D;  5B2J B;  1TZY A;  4H9P A;  4QLC D;  1AOI B;  4ZUX B;  3WAA D;  1M18 C;  5B33 D;  5DNN C;  3MGP A;  4YS3 A;  4CSR A;  5AV9 A;  1TZY B;  4H9P B;  3AZN B;  4NE6 A;  2YFV A;  4YS3 B;  3LJA D;  4J8V C;  3NQJ A;  4Z66 C;  2JSS A;  5AVC A;  4J8X D;  3REI B;  4H9S A;  3LEL B;  4YM6 A;  3REK B;  2YFV B;  3REH D;  5GXQ A;  5B2J C;  3NQJ B;  5B0Y D;  1ZLA C;  5AVC B;  5B1M B;  3VH6 W;  4WU8 B;  5GXQ B;  5F99 A;  4X23 D;  3VH5 W;  3W98 D;  3W99 D;  5B0Z D;  1BH8 A;  3MGP C;  3C1C A;  4YS3 C;  5F99 B;  5AV9 C;  4H9N A;  3AZK D;  3B6G D;  5AV8 D;  1BH8 B;  5JA4 A;  2HUE B;  3C1C B;  1U35 A;  4H9N B;  4H9R B;  5AVC C;  3KUY A;  4H9S C;  1ID3 A;  4YM6 C;  3AZL A;  3NQU A;  3W97 D;  1U35 B;  5GXQ C;  1KX5 A;  5GSU D;  1P3F D;  1ID3 B;  3AZL B;  3NQU B;  3X1U D;  1KX3 D;  4AWL B;  2PYO D;  5F99 C;  1KX5 B;  1HQ3 A;  3KWQ D;  4H9O A;  3VH6 T;  2HUE C;  4Z5T D;  4CAY A;  3C1C C;  3UT9 B;  1P3K A;  1P3G D;  4KGC B;  3V9R B;  3AZI A;  5AV6 D;  4CAY B;  3AZM B;  1P3K B;  1U35 C;  5B1L D;  3MGS D;  4KUD A;  5AY8 A;  3KUY C;  3AZI B;  1ID3 C;  4XUJ A;  3AZL C;  4AWL C;  5B40 A;  1S32 D;  4KUD B;  1KX5 C;  4DRA A;  3LZ0 D;  3WTP B;  3UTA A;  5AV5 D;  4XUJ B;  3AZJ D;  5B40 B;  3A6N D;  5CPJ A;  1HQ3 C;  3AZF D;  3UTA B;  5B32 A;  5DNM A;  1P3A D;  3AFA A;  5BT1 C;  1F1E A;  3UTB A;  1P3K C;  5CPJ B;  5DNM B;  2F8N H;  1JFI A;  5B2I A;  3AZI C;  4R8P D;  3X1S D;  1P3I A;  1H3O A;  3UTB B;  3AN2 A;  4E45 A;  5B31 A;  4KUD C;  5E5A D;  1JFI B;  5AY8 C;  5B2I B;  3REJ B;  4XUJ C;  1P3I B;  2FJ7 D;  1H3O B;  3AN2 B;  5B40 C;  5B31 B;  3TU4 D;  3UTA C;  3W96 D;  2NZD A;  5BNV A;  1M19 A;  5CPJ C;  1EQZ D;  5B32 C;  5DNM C;  2NZD B;  5BNV B;  2ARO D;  1M19 B;  4Z2M G;  3AFA C;  5GT3 D;  2CV5 D;  3UTB C;  5B2I C;  3LZ1 C;  5BO0 B;  1P3I C;  3AN2 C;  5B31 C;  3C1B B;  1KX4 D;  5BNX B;  3MGQ D;  4QLC B;  3WAA B;  4XZQ D;  5CP6 A;  2CWE A;  3MNN D;  2NZD C;  1M19 C;  1P3P A;  3REH A;  3LJA B;  3MGR A;  4G92 B;  5B24 A;  4J8X B;  3AV1 D;  5C3I C;  1AOI A;  3REH B;  3B0C W;  4ZUX A;  3AZH D;  3AYW D;  2RVQ D;  5B0Y B;  5B24 B;  1P3B D;  3W98 A;  4EO5 C;  3R45 A;  3AZN A;  4X23 B;  3AZK A;  3W98 B;  3R45 B;  4LD9 D;  5CP6 C;  1M1A A;  3WA9 D;  3REI A;  3LEL A;  3REK A;  5BS7 A;  3AZK B;  2LY8 A;  4WU9 D;  4J8W A;  3B6G B;  2F8N D;  4E44 A;  1P3P C;  1M1A B;  5B1M A;  3REH C;  1A7W A;  3X1T D;  3MGR C;  4WU8 A;  3MVD D;  4J8W B;  5B24 C;  5GSU A;  1P3F A;  4ZBJ B;  1AOI C;  3X1U A;  4ZUX C;  5GSU B;  3KWQ A;  1P3F B;  3B6F D;  3W98 C;  1TZY C;  3X1U B;  3REL A;  3AZN C;  1M18 D;  5DNN D;  1P3L D;  1P3G A;  3KWQ B;  3AZK C;  4H9R A;  5AV6 A;  3REL B;  3REI C;  3X1V D;  1M1A C;  1TAF A;  3LEL C;  3REK C;  1P3G B;  5BS7 C;  4J8W C;  3O62 A;  5CPK D;  4ZBJ C;  4J8V D;  2YFW B;  5AV6 B;  1TAF B;  5B1M C;  4WU8 C;  3O62 B;  5GSU C;  1P3F C;  5B2J D;  1ZLA D;  3VH6 A;  3X1U C;  3A6N A;  3AZF A;  3KWQ C;  3UT9 A;  5JRG D;  4HGA B;  1P3A A;  4KGC A;  3VH5 A;  3AZJ B;  1P3M D;  3REL C;  3WKJ A;  3V9R A;  3A6N B;  3MGP D;  3AZF B;  1P3G C;  4YS3 D;  3AZM A;  5AV9 D;  1ULY A;  1P3A B;  1WWI A;  5AV6 C;  3WKJ B;  3VH5 T;  3O62 C;  5AVC D;  4R8P B;  3WTP A;  5G49 A;  3AZG D;  4YM6 D;  3TU4 A;  5E5A B;  5AVB A;  2IO5 B;  2BYK A;  5G49 B;  2HIO A;  3A6N C;  2F8N G;  3TU4 B;  3AZF C;  5AVB B;  3UT9 C;  5F99 D;  3W96 B;  1P3A C;  4KGC C;  2BYK B;  1N1J B;  1R4V A;  2HIO B;  2CV5 A;  3WKJ C;  1EQZ B;  3C1C D;  3AZM C;  4JJN D;  5GT3 B;  2CV5 B;  3REJ A;  1U35 D;  3MGQ A;  2IO5 C;  3WTP C;  3KUY D;  3AZL D;  1KX4 B;  3TU4 C;  5AVB C;  3MGQ B;  5GT0 A;  2HIO C;  4XZQ B;  1HQ3 D;  5GT0 B;  1P3O A;  1P34 A;  3AV1 A; 
#chains in the Genus database with same CATH topology
 5BT1 D;  5BO0 A;  2Y2I A;  3AZH A;  3KXB D;  1P3B A;  1B67 A;  3C1B A;  1P3O B;  1F66 A;  1P34 B;  5BNX A;  3REJ C;  3AZI D;  3AV1 B;  4QLC A;  5CPI D;  3WAA A;  5B33 A;  3AZH B;  3AYW B;  3MGQ C;  1P3B B;  4J8U D;  1F66 B;  5AY8 D;  4XUJ D;  5FUG B;  1B6W A;  3KSY A;  4DRB A;  5B33 B;  5GT0 C;  3LJA A;  4LD9 B;  3WA9 B;  4J8X A;  3X1T A;  4G91 B;  5CPJ D;  2J8P A;  5B32 D;  5DNM D;  4WU9 B;  1P3O C;  1P34 C;  5B0Y A;  3AFA D;  3AV1 C;  3AZE D;  3H0M C;  2XD5 A;  3X1T B;  3A1K A;  3MVD B;  3AZH C;  1P3B C;  3C1B C;  1F66 C;  3B6F A;  5B2I D;  2NQB D;  3LZ1 D;  3AV2 D;  4QLC C;  4X23 A;  2ZY2 A;  3W99 A;  3WAA C;  5B0Z A;  5B33 C;  3AN2 D;  1P3L A;  5B31 D;  3B6F B;  1KU5 A;  3X1V A;  3B6G A;  3W99 B;  1M18 B;  5AV8 A;  5B0Z B;  1P3L B;  4G91 C;  3LJA C;  4G92 C;  5CPK A;  2NZD D;  3X1V B;  4J8X C;  5AV8 B;  3X1T C;  2ZM5 A;  3W97 A;  5CPK B;  4J8V B;  5B0Y C;  2L5A A;  5KDM B;  1KX3 A;  3W97 B;  3AL0 C;  3B6F C;  2PYO A;  5JRG A;  1ZLA B;  1Q9C A;  3F6T A;  4X23 C;  1P3M A;  2Y2M A;  4WV4 B;  3W99 C;  5B0Z C;  1P3L C;  1KX3 B;  2ZY3 A;  3B0C T;  4Z5T A;  2PYO B;  5JRG B;  1PZR A;  3X1V C;  1P3M B;  3B6G C;  5CP6 D;  5AV8 C;  2YFW A;  3MGP B;  4Z5T B;  4CSR B;  5AV9 B;  5CPK C;  5B1L A;  3MGS A;  3AZG A;  1P3P D;  4Z66 D;  3MGR D;  3W97 C;  2ZY5 A;  5B1L B;  3MGS B;  5B24 D;  1S32 A;  3LZ0 A;  3AZG B;  1W2E A;  1Z2C B;  4NE3 A;  5AV5 A;  4YM6 B;  1AOI D;  1KX3 C;  3AZJ A;  4ZUX D;  2PYO C;  5JRG C;  1S32 B;  3LZ0 B;  5AV5 B;  5B32 G;  1P3M C;  1TZY D;  4WZS B;  3AZN D;  4Z5T C;  1BH9 A;  3EPL A;  4JJN A;  1M1A D;  4R8P A;  3REI D;  3X1S A;  3LEL D;  3REK D;  1BH9 B;  5CHL B;  5B1L C;  4J8W D;  3MGS C;  3FDD A;  5B31 G;  5E5A A;  4JJN B;  3AZG C;  5JA4 B;  5B1M D;  3X1S B;  2FJ7 A;  4WU8 D;  1HTA A;  4NFT A;  1S32 C;  2Y2P A;  4WNN A;  5GXQ D;  3LZ0 C;  3KUY B;  5AV5 C;  3W96 A;  4M6B A;  4HGA C;  3AZJ C;  2FJ7 B;  1N1J A;  3B0D B;  4WNN B;  1EQZ A;  2ARO A;  3REL D;  5GT3 A;  1HQ3 B;  4NE5 A;  1WWS A;  4H9O B;  3KXB A;  4JJN C;  2ARO B;  4R8P C;  3X1S C;  5CPI A;  3A1I A;  3KXB B;  3O62 D;  4J8U A;  1KX4 A;  5E5A C;  4DQY B;  2FJ7 C;  1ID3 D;  5CPI B;  3B0D C;  4XZQ A;  3MNN A;  4J8U B;  5AY8 B;  3W96 C;  1KX5 D;  3WTP E;  3MNN B;  1EQZ C;  3UT9 D;  4KGC D;  2ARO C;  3WKJ D;  3AZE A;  4UPK A;  5GT3 C;  2CV5 C;  5B32 B;  3KXB C;  3AZM D;  1P3K D;  2NQB A;  3LZ1 A;  3AYW A;  3AFA B;  3AV2 A;  3AZE B;  2F8N K;  5CPI C;  5FUG A;  1KX4 C;  4J8U C;  2BYM A;  3LZ1 B;  4KUD D;  3AV2 B;  2NQB B;  3B0B A;  3WTP D;  1BFM A;  4H9Q A;  4XZQ C;  3MNN C;  3WA9 A;  4LD9 A;  2G5H C;  5AVB D;  2BYM B;  5B40 D;  3UTA D;  4KHA A;  4WU9 A;  2XD1 A;  4H9Q B;  2HIO D;  2F8N A;  2FFF B;  4UUZ A;  4KHA B;  3MVD A;  2Y2O A;  3AZE C;  2F8N B;  3UTB D;  4UUZ B;  2NQB C;  3AYW C;  2RVQ C;  3AV2 C;  3REJ D;  5C3I B;  1P3I D;  4Z2M H;  1M18 A;  5DNN A;  4EO5 B;  4LD9 C;  3WA9 C;  5DNN B;  5GT0 D;  4WU9 C;  2W8S A;  5CP6 B;  4J8V A;  4Z66 A;  1M19 D;  5KDM A;  2Y2G A;  3MVD C;  3KFU G;  2JCH A;  1P3O D;  5B2J A;  1P34 D;  1P3P B;  4Z66 B;  1ZLA A;  3MGR B;  1F66 D;  3C1B D;  5B2J B;  1TZY A;  4H9P A;  4QLC D;  1AOI B;  4ZUX B;  3WAA D;  1M18 C;  5B33 D;  5DNN C;  3MGP A;  4YS3 A;  4CSR A;  5AV9 A;  1TZY B;  4H9P B;  3AZN B;  4NE6 A;  2YFV A;  4YS3 B;  3LJA D;  4J8V C;  3NQJ A;  4Z66 C;  2JSS A;  5AVC A;  4J8X D;  3REI B;  4H9S A;  3LEL B;  4YM6 A;  3REK B;  2YFV B;  3REH D;  5GXQ A;  5B2J C;  3NQJ B;  5B0Y D;  1ZLA C;  5AVC B;  5B1M B;  3VH6 W;  4WU8 B;  5GXQ B;  5F99 A;  4X23 D;  3VH5 W;  3W98 D;  3W99 D;  5B0Z D;  1BH8 A;  3MGP C;  3C1C A;  4YS3 C;  5F99 B;  5AV9 C;  4H9N A;  3AZK D;  3B6G D;  5AV8 D;  1BH8 B;  5JA4 A;  2HUE B;  3C1C B;  1U35 A;  4H9N B;  4H9R B;  5AVC C;  2VQR A;  3KUY A;  2Y2N A;  4H9S C;  1ID3 A;  4YM6 C;  3AZL A;  3NQU A;  3W97 D;  1U35 B;  5GXQ C;  1KX5 A;  5GSU D;  1P3F D;  2Y2Q A;  1ID3 B;  3AZL B;  3NQU B;  3X1U D;  1KX3 D;  4AWL B;  2PYO D;  5F99 C;  1KX5 B;  1HQ3 A;  3KWQ D;  4H9O A;  3VH6 T;  2HUE C;  4Z5T D;  4CAY A;  3C1C C;  3UT9 B;  1P3K A;  2Y2J A;  1P3G D;  4KGC B;  3V9R B;  3AZI A;  5AV6 D;  4CAY B;  3AZM B;  1P3K B;  1U35 C;  2G5I C;  5B1L D;  3MGS D;  4KUD A;  2BG1 A;  5AY8 A;  3KUY C;  3AZI B;  1ID3 C;  4XUJ A;  3AZL C;  4AWL C;  5B40 A;  1S32 D;  4KUD B;  1KX5 C;  4DRA A;  3LZ0 D;  3WTP B;  3UTA A;  5AV5 D;  4XUJ B;  3AZJ D;  5B40 B;  3A6N D;  5CPJ A;  1HQ3 C;  3AZF D;  3UTA B;  5B32 A;  5DNM A;  1P3A D;  3AFA A;  5BT1 C;  1F1E A;  3UTB A;  1P3K C;  5CPJ B;  5DNM B;  2F8N H;  1JFI A;  5B2I A;  3AZI C;  4R8P D;  3X1S D;  1P3I A;  1H3O A;  3UTB B;  3AN2 A;  4E45 A;  5B31 A;  4KUD C;  5E5A D;  3H0R C;  1JFI B;  5AY8 C;  5B2I B;  3REJ B;  4WJ3 C;  4XUJ C;  1P3I B;  2FJ7 D;  1H3O B;  3AN2 B;  3EPK A;  5B40 C;  5B31 B;  3TU4 D;  3UTA C;  3W96 D;  2NZD A;  5BNV A;  1M19 A;  5CPJ C;  1EQZ D;  5B32 C;  5DNM C;  2NZD B;  5BNV B;  2ARO D;  1M19 B;  4Z2M G;  3AFA C;  5GT3 D;  2CV5 D;  3UTB C;  5B2I C;  3LZ1 C;  5BO0 B;  1P3I C;  3AN2 C;  5B31 C;  3C1B B;  1KX4 D;  5BNX B;  3MGQ D;  4QLC B;  2DQN C;  3WAA B;  4XZQ D;  5CP6 A;  2CWE A;  3MNN D;  1T3U A;  2NZD C;  1M19 C;  1P3P A;  3EG5 B;  3REH A;  3LJA B;  3MGR A;  4G92 B;  5B24 A;  4J8X B;  3AV1 D;  5C3I C;  1AOI A;  3REH B;  3B0C W;  4ZUX A;  2RIQ A;  2Y2H A;  3AZH D;  3AYW D;  2RVQ D;  5B0Y B;  5B24 B;  1P3B D;  3W98 A;  4EO5 C;  3R45 A;  3AZN A;  4X23 B;  2UWX A;  3AZK A;  3W98 B;  3R45 B;  4LD9 D;  5CP6 C;  1M1A A;  3WA9 D;  3REI A;  3H0L C;  3LEL A;  3REK A;  5BS7 A;  3AZK B;  2LY8 A;  4WU9 D;  4J8W A;  3B6G B;  2F8N D;  4E44 A;  1P3P C;  1M1A B;  5B1M A;  3REH C;  1A7W A;  3X1T D;  3MGR C;  4WU8 A;  3MVD D;  4J8W B;  5B24 C;  5GSU A;  1P3F A;  4ZBJ B;  1AOI C;  2Y2L A;  3X1U A;  3P5J B;  4ZUX C;  5GSU B;  3KWQ A;  1P3F B;  3B6F D;  3EPH A;  3W98 C;  1TZY C;  3X1U B;  3REL A;  3AZN C;  1M18 D;  5DNN D;  1P3L D;  1P3G A;  3KWQ B;  3AZK C;  4H9R A;  5AV6 A;  3REL B;  3REI C;  3X1V D;  1M1A C;  1TAF A;  3LEL C;  3REK C;  1P3G B;  5BS7 C;  4J8W C;  3O62 A;  5CPK D;  4ZBJ C;  4J8V D;  2YFW B;  5AV6 B;  1TAF B;  5B1M C;  4WU8 C;  3O62 B;  2JE5 A;  5GSU C;  1P3F C;  5B2J D;  1ZLA D;  3VH6 A;  3X1U C;  2DF4 C;  3A6N A;  3AZF A;  3KWQ C;  3UT9 A;  5JRG D;  2F2A C;  4HGA B;  1P3A A;  4KGC A;  3VH5 A;  3AZJ B;  1P3M D;  3REL C;  3WKJ A;  3EPJ A;  3V9R A;  3A6N B;  3MGP D;  3AZF B;  1P3G C;  4YS3 D;  3AZM A;  5AV9 D;  1ULY A;  1P3A B;  1WWI A;  5AV6 C;  3WKJ B;  3VH5 T;  3O62 C;  5AVC D;  4R8P B;  3WTP A;  5G49 A;  3AZG D;  4YM6 D;  3TU4 A;  5E5A B;  5AVB A;  2IO5 B;  2BYK A;  5G49 B;  2HIO A;  2Y2K A;  3A6N C;  2F8N G;  3IP4 C;  3TU4 B;  3AZF C;  5AVB B;  3UT9 C;  5F99 D;  3W96 B;  1P3A C;  4KGC C;  2BYK B;  1N1J B;  1R4V A;  2HIO B;  2CV5 A;  3WKJ C;  1EQZ B;  3C1C D;  3AZM C;  4JJN D;  5GT3 B;  2CV5 B;  3REJ A;  1U35 D;  3MGQ A;  2IO5 C;  3WTP C;  3KUY D;  3AZL D;  1KX4 B;  3TU4 C;  5AVB C;  3MGQ B;  5GT0 A;  2HIO C;  4XZQ B;  2ZY4 A;  1HQ3 D;  5GT0 B;  1P3O A;  1P34 A;  3AV1 A; 
#chains in the Genus database with same CATH homology
 5BT1 D;  5BO0 A;  2Y2I A;  3AZH A;  3KXB D;  1P3B A;  1B67 A;  3C1B A;  1P3O B;  1F66 A;  1P34 B;  5BNX A;  3REJ C;  3AZI D;  3AV1 B;  4QLC A;  5CPI D;  3WAA A;  5B33 A;  3AZH B;  3AYW B;  3MGQ C;  1P3B B;  4J8U D;  1F66 B;  5AY8 D;  4XUJ D;  5FUG B;  1B6W A;  3KSY A;  4DRB A;  5B33 B;  5GT0 C;  3LJA A;  4LD9 B;  3WA9 B;  4J8X A;  3X1T A;  4G91 B;  5CPJ D;  2J8P A;  5B32 D;  5DNM D;  4WU9 B;  1P3O C;  1P34 C;  5B0Y A;  3AFA D;  3AV1 C;  3AZE D;  3H0M C;  2XD5 A;  3X1T B;  3A1K A;  3MVD B;  3AZH C;  1P3B C;  3C1B C;  1F66 C;  3B6F A;  5B2I D;  2NQB D;  3LZ1 D;  3AV2 D;  4QLC C;  4X23 A;  2ZY2 A;  3W99 A;  3WAA C;  5B0Z A;  5B33 C;  3AN2 D;  1P3L A;  5B31 D;  3B6F B;  1KU5 A;  3X1V A;  3B6G A;  3W99 B;  1M18 B;  5AV8 A;  5B0Z B;  1P3L B;  4G91 C;  3LJA C;  4G92 C;  5CPK A;  2NZD D;  3X1V B;  4J8X C;  5AV8 B;  3X1T C;  2ZM5 A;  3W97 A;  5CPK B;  4J8V B;  5B0Y C;  2L5A A;  5KDM B;  1KX3 A;  3W97 B;  3AL0 C;  3B6F C;  2PYO A;  5JRG A;  1ZLA B;  1Q9C A;  3F6T A;  4X23 C;  1P3M A;  2Y2M A;  4WV4 B;  3W99 C;  5B0Z C;  1P3L C;  1KX3 B;  2ZY3 A;  3B0C T;  4Z5T A;  2PYO B;  5JRG B;  1PZR A;  3X1V C;  1P3M B;  3B6G C;  5CP6 D;  5AV8 C;  2YFW A;  3MGP B;  4Z5T B;  4CSR B;  5AV9 B;  5CPK C;  5B1L A;  3MGS A;  3AZG A;  1P3P D;  4Z66 D;  3MGR D;  3W97 C;  2ZY5 A;  5B1L B;  3MGS B;  5B24 D;  1S32 A;  3LZ0 A;  3AZG B;  1W2E A;  1Z2C B;  4NE3 A;  5AV5 A;  4YM6 B;  1AOI D;  1KX3 C;  3AZJ A;  4ZUX D;  2PYO C;  5JRG C;  1S32 B;  3LZ0 B;  5AV5 B;  5B32 G;  1P3M C;  1TZY D;  4WZS B;  3AZN D;  4Z5T C;  1BH9 A;  3EPL A;  4JJN A;  1M1A D;  4R8P A;  3REI D;  3X1S A;  3LEL D;  3REK D;  1BH9 B;  5CHL B;  5B1L C;  4J8W D;  3MGS C;  3FDD A;  5B31 G;  5E5A A;  4JJN B;  3AZG C;  5JA4 B;  5B1M D;  3X1S B;  2FJ7 A;  4WU8 D;  1HTA A;  4NFT A;  1S32 C;  2Y2P A;  4WNN A;  5GXQ D;  3LZ0 C;  3KUY B;  5AV5 C;  3W96 A;  4M6B A;  4HGA C;  3AZJ C;  2FJ7 B;  1N1J A;  3B0D B;  4WNN B;  1EQZ A;  2ARO A;  3REL D;  5GT3 A;  1HQ3 B;  4NE5 A;  1WWS A;  4H9O B;  3KXB A;  4JJN C;  2ARO B;  4R8P C;  3X1S C;  5CPI A;  3A1I A;  3KXB B;  3O62 D;  4J8U A;  1KX4 A;  5E5A C;  4DQY B;  2FJ7 C;  1ID3 D;  5CPI B;  3B0D C;  4XZQ A;  3MNN A;  4J8U B;  5AY8 B;  3W96 C;  1KX5 D;  3WTP E;  3MNN B;  1EQZ C;  3UT9 D;  4KGC D;  2ARO C;  3WKJ D;  3AZE A;  4UPK A;  5GT3 C;  2CV5 C;  5B32 B;  3KXB C;  3AZM D;  1P3K D;  2NQB A;  3LZ1 A;  3AYW A;  3AFA B;  3AV2 A;  3AZE B;  2F8N K;  5CPI C;  5FUG A;  1KX4 C;  4J8U C;  2BYM A;  3LZ1 B;  4KUD D;  3AV2 B;  2NQB B;  3B0B A;  3WTP D;  1BFM A;  4H9Q A;  4XZQ C;  3MNN C;  3WA9 A;  4LD9 A;  2G5H C;  5AVB D;  2BYM B;  5B40 D;  3UTA D;  4KHA A;  4WU9 A;  2XD1 A;  4H9Q B;  2HIO D;  2F8N A;  2FFF B;  4UUZ A;  4KHA B;  3MVD A;  2Y2O A;  3AZE C;  2F8N B;  3UTB D;  4UUZ B;  2NQB C;  3AYW C;  2RVQ C;  3AV2 C;  3REJ D;  5C3I B;  1P3I D;  4Z2M H;  1M18 A;  5DNN A;  4EO5 B;  4LD9 C;  3WA9 C;  5DNN B;  5GT0 D;  4WU9 C;  2W8S A;  5CP6 B;  4J8V A;  4Z66 A;  1M19 D;  5KDM A;  2Y2G A;  3MVD C;  3KFU G;  2JCH A;  1P3O D;  5B2J A;  1P34 D;  1P3P B;  4Z66 B;  1ZLA A;  3MGR B;  1F66 D;  3C1B D;  5B2J B;  1TZY A;  4H9P A;  4QLC D;  1AOI B;  4ZUX B;  3WAA D;  1M18 C;  5B33 D;  5DNN C;  3MGP A;  4YS3 A;  4CSR A;  5AV9 A;  1TZY B;  4H9P B;  3AZN B;  4NE6 A;  2YFV A;  4YS3 B;  3LJA D;  4J8V C;  3NQJ A;  4Z66 C;  2JSS A;  5AVC A;  4J8X D;  3REI B;  4H9S A;  3LEL B;  4YM6 A;  3REK B;  2YFV B;  3REH D;  5GXQ A;  5B2J C;  3NQJ B;  5B0Y D;  1ZLA C;  5AVC B;  5B1M B;  3VH6 W;  4WU8 B;  5GXQ B;  5F99 A;  4X23 D;  3VH5 W;  3W98 D;  3W99 D;  5B0Z D;  1BH8 A;  3MGP C;  3C1C A;  4YS3 C;  5F99 B;  5AV9 C;  4H9N A;  3AZK D;  3B6G D;  5AV8 D;  1BH8 B;  5JA4 A;  2HUE B;  3C1C B;  1U35 A;  4H9N B;  4H9R B;  5AVC C;  2VQR A;  3KUY A;  2Y2N A;  4H9S C;  1ID3 A;  4YM6 C;  3AZL A;  3NQU A;  3W97 D;  1U35 B;  5GXQ C;  1KX5 A;  5GSU D;  1P3F D;  2Y2Q A;  1ID3 B;  3AZL B;  3NQU B;  3X1U D;  1KX3 D;  4AWL B;  2PYO D;  5F99 C;  1KX5 B;  1HQ3 A;  3KWQ D;  4H9O A;  3VH6 T;  2HUE C;  4Z5T D;  4CAY A;  3C1C C;  3UT9 B;  1P3K A;  2Y2J A;  1P3G D;  4KGC B;  3V9R B;  3AZI A;  5AV6 D;  4CAY B;  3AZM B;  1P3K B;  1U35 C;  2G5I C;  5B1L D;  3MGS D;  4KUD A;  2BG1 A;  5AY8 A;  3KUY C;  3AZI B;  1ID3 C;  4XUJ A;  3AZL C;  4AWL C;  5B40 A;  1S32 D;  4KUD B;  1KX5 C;  4DRA A;  3LZ0 D;  3WTP B;  3UTA A;  5AV5 D;  4XUJ B;  3AZJ D;  5B40 B;  3A6N D;  5CPJ A;  1HQ3 C;  3AZF D;  3UTA B;  5B32 A;  5DNM A;  1P3A D;  3AFA A;  5BT1 C;  1F1E A;  3UTB A;  1P3K C;  5CPJ B;  5DNM B;  2F8N H;  1JFI A;  5B2I A;  3AZI C;  4R8P D;  3X1S D;  1P3I A;  1H3O A;  3UTB B;  3AN2 A;  4E45 A;  5B31 A;  4KUD C;  5E5A D;  3H0R C;  1JFI B;  5AY8 C;  5B2I B;  3REJ B;  4WJ3 C;  4XUJ C;  1P3I B;  2FJ7 D;  1H3O B;  3AN2 B;  3EPK A;  5B40 C;  5B31 B;  3TU4 D;  3UTA C;  3W96 D;  2NZD A;  5BNV A;  1M19 A;  5CPJ C;  1EQZ D;  5B32 C;  5DNM C;  2NZD B;  5BNV B;  2ARO D;  1M19 B;  4Z2M G;  3AFA C;  5GT3 D;  2CV5 D;  3UTB C;  5B2I C;  3LZ1 C;  5BO0 B;  1P3I C;  3AN2 C;  5B31 C;  3C1B B;  1KX4 D;  5BNX B;  3MGQ D;  4QLC B;  2DQN C;  3WAA B;  4XZQ D;  5CP6 A;  2CWE A;  3MNN D;  1T3U A;  2NZD C;  1M19 C;  1P3P A;  3EG5 B;  3REH A;  3LJA B;  3MGR A;  4G92 B;  5B24 A;  4J8X B;  3AV1 D;  5C3I C;  1AOI A;  3REH B;  3B0C W;  4ZUX A;  2RIQ A;  2Y2H A;  3AZH D;  3AYW D;  2RVQ D;  5B0Y B;  5B24 B;  1P3B D;  3W98 A;  4EO5 C;  3R45 A;  3AZN A;  4X23 B;  2UWX A;  3AZK A;  3W98 B;  3R45 B;  4LD9 D;  5CP6 C;  1M1A A;  3WA9 D;  3REI A;  3H0L C;  3LEL A;  3REK A;  5BS7 A;  3AZK B;  2LY8 A;  4WU9 D;  4J8W A;  3B6G B;  2F8N D;  4E44 A;  1P3P C;  1M1A B;  5B1M A;  3REH C;  1A7W A;  3X1T D;  3MGR C;  4WU8 A;  3MVD D;  4J8W B;  5B24 C;  5GSU A;  1P3F A;  4ZBJ B;  1AOI C;  2Y2L A;  3X1U A;  3P5J B;  4ZUX C;  5GSU B;  3KWQ A;  1P3F B;  3B6F D;  3EPH A;  3W98 C;  1TZY C;  3X1U B;  3REL A;  3AZN C;  1M18 D;  5DNN D;  1P3L D;  1P3G A;  3KWQ B;  3AZK C;  4H9R A;  5AV6 A;  3REL B;  3REI C;  3X1V D;  1M1A C;  1TAF A;  3LEL C;  3REK C;  1P3G B;  5BS7 C;  4J8W C;  3O62 A;  5CPK D;  4ZBJ C;  4J8V D;  2YFW B;  5AV6 B;  1TAF B;  5B1M C;  4WU8 C;  3O62 B;  2JE5 A;  5GSU C;  1P3F C;  5B2J D;  1ZLA D;  3VH6 A;  3X1U C;  2DF4 C;  3A6N A;  3AZF A;  3KWQ C;  3UT9 A;  5JRG D;  2F2A C;  4HGA B;  1P3A A;  4KGC A;  3VH5 A;  3AZJ B;  1P3M D;  3REL C;  3WKJ A;  3EPJ A;  3V9R A;  3A6N B;  3MGP D;  3AZF B;  1P3G C;  4YS3 D;  3AZM A;  5AV9 D;  1ULY A;  1P3A B;  1WWI A;  5AV6 C;  3WKJ B;  3VH5 T;  3O62 C;  5AVC D;  4R8P B;  3WTP A;  5G49 A;  3AZG D;  4YM6 D;  3TU4 A;  5E5A B;  5AVB A;  2IO5 B;  2BYK A;  5G49 B;  2HIO A;  2Y2K A;  3A6N C;  2F8N G;  3IP4 C;  3TU4 B;  3AZF C;  5AVB B;  3UT9 C;  5F99 D;  3W96 B;  1P3A C;  4KGC C;  2BYK B;  1N1J B;  1R4V A;  2HIO B;  2CV5 A;  3WKJ C;  1EQZ B;  3C1C D;  3AZM C;  4JJN D;  5GT3 B;  2CV5 B;  3REJ A;  1U35 D;  3MGQ A;  2IO5 C;  3WTP C;  3KUY D;  3AZL D;  1KX4 B;  3TU4 C;  5AVB C;  3MGQ B;  5GT0 A;  2HIO C;  4XZQ B;  2ZY4 A;  1HQ3 D;  5GT0 B;  1P3O A;  1P34 A;  3AV1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...