5E5AA

Crystal structure of the chromatin-tethering domain of human cytomegalovirus ie1 protein bound to the nucleosome core particle
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
99
structure length
99
Chain Sequence
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (146-MER)
publication title Human cytomegalovirus IE1 protein alters the higher-order chromatin structure by targeting the acidic patch of the nucleosome
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/viral protein/dna
total genus 30
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5e5aA00
5AVCD 4DRAA 1P3OA 3UT9D 1TAFA 1BH8A 2HIOD 3AYWB 5B31C 3MGSC 5CPKD 3MGPA 5CPJA 3O62A 1U35A 3AZJD 4JJNC 1KU5A 1P3FC 4E45A 3UTAC 3B6GD 2CV5C 5B31D 4XUJA 3MNNB 5AV6B 5DNNB 3WTPC 4H9RB 1P3FD 1P3BC 5B0YA 5GT3A 3UTAD 2CV5D 4KUDA 1M19B 3B6FC 1HQ3B 1N1JA 3WTPD 1AOIC 4QLCC 3X1SA 1P3BD 5B40C 1R4VA 5GSUA 4H9QB 4X23B 3MVDC 3KWQB 4WU9C 2NQBC 5JRGB 5B32C 2F8NK 1AOID 4Z5TC 4QLCD 1P3GC 3NQUA 3KUYB 5B33B 5BS7C 3V9RA 3W97A 5B40D 5B2JB 4WU9D 3MVDD 2NQBD 5KDMA 5B32D 5GT0D 3LELC 1P3PC 4H9SC 3AZFB 1P3GD 3B0DB 5B0ZC 5G49B 5AV9B 3AZIB 3UTBA 5AY8B 3AZEB 4UUZA 5CP6B 3LELD 3UT9A 1KX5C 2HIOA 5B0ZD 4YM6D 3WA9B 4H9PA 5CPKA 1P3LA 4CAYA 3WKJB 3AZJA 1KX3C 3MGQA 4ZUXB 1KX5D 4XZQB 3W98C 3B6GA 5F99B 3X1UC 1M1AC 3AV1D 2BYKA 4J8WB 1P3FA 3W98D 3UTAA 2CV5A 5JRGC 1M1AD 3X1UD 3WTPA 3AZLA 3AYWC 1M18A 3W99B 4M6BA 3X1VB 3LZ1B 4QLCA 3AYWD 4J8VB 3C1BB 3MNNC 4WU9A 5AV6C 5DNNC 3LJAB 2NQBA 4J8XB 5B32A 5GT0A 3WAAB 1ZLAA 1P3IB 3KXBA 5BS7A 3A6NB 1M19C 1HQ3C 5BO0A 4Z66B 5BNXA 2F8NB 4R8PA 5BNVA 5DNND 5AV6D 2BYMA 4CSRA 3AZGB 3LELA 5C3IB 4WU8B 4YM6A 2FJ7A 1M19D 1HQ3D 4X23C 3KWQC 5B2IB 1WWSA 3KUYC 2JSSA 5B33C 1BFMA 1P3MB 1WWIA 1TZYB 5B2JC 4X23D 3KWQD 3AZKB 1S32B 3R45B 3AV1A 3REHA 3AZFC 3B0DC 3KUYD 5DNMB 4G92B 5B1MB 5AV9C 3W98A 3AZIC 1EQZB 5B2JD 3NQJB 5AY8C 3AZEC 3MGRD 5E5AB 4ZBJB 5CP6C 3X1UA 3WA9C 5AV9D 3AZID 5AY8D 3AZED 3WKJC 4LD9B 4H9OA 4HGAB 4ZUXC 4XZQC 4WNNA 1B6WA 3AYWA 2AROB 3WA9D 4J8UB 2YFWB 3C1CB 5F99C 3WKJD 1F66B 4J8WC 4ZUXD 4XZQD 3MGSD 3VH6T 3REJB 1B67A 5AVBB 3AZMB 5F99D 5AV6A 5DNNA 4JJND 4J8WD 3W99C 3TU4B 5GXQA 5B1LB 1M19A 3LZ0B 3X1VC 1P3OB 1BH8B 2PYOA 3LZ1C 3W99D 4J8VC 3X1TB 3REKA 3C1BC 5CPJB 2F8NG 3B6FD 4H9QA 3X1VD 3LJAC 4J8XC 2IO5B 4NE6A 4KGCA 3WAAC 3AZHB 1P3IC 3KUYA 4J8VD 3A6NC 3C1BD 4Z66C 5B2JA 3LJAD 3MGRA 4J8XD 3RELB 3AZGC 3WAAD 4Z5TD 5C3IC 4WU8C 5CPIB 1P3ID 3A6ND 5AV9A 4Z66D 2F8ND 3AZEA 3AZNB 3X1SB 4G91B 5B2IC 5FUGA 5AVCA 3AZGD 1P3PD 4WU8D 1P3MC 1TZYC 3WA9A 4Z2MG 3AZKC 1S32C 1JFIB 4EO5B 4G92C 5DNMC 3V9RB 5B1MC 4ZUXA 4XZQA 1P3MD 1TZYD 1EQZC 5B31A 5KDMB 3MGSA 3AZKD 5E5AC 4ZBJC 1S32D 4JJNA 1KX3D 5DNMD 4J8WA 5B1MD 3UTBB 2NZDB 1EQZD 4UUZB 4LD9C 5E5AD 3AFAB 2HIOB 4HGAC 4H9PB 1P3BA 2AROC 4J8UC 1P3LB 4CAYB 3C1CC 3B6FA 3X1VA 5JRGD 3MGQB 4LD9D 1F66C 1AOIA 3B6GB 4J8VA 2AROD 2F8NH 3VH6W 3REJC 5AVBC 5B40A 3C1CD 3AZMC 2CWEA 3VH5T 3MVDA 3LJAA 3WAAA 4Z5TA 4KHAA 3TU4C 1P3IA 1P3GA 5B1LC 3B0CT 3A6NA 1ID3B 4H9NB 3LZ0C 3REJD 1P3OC 5AVBD 3MNND 3AZMD 3AZLB 1M18B 3AZGA 1P3PA 3TU4D 4WU8A 4H9SA 3X1TC 5B1LD 5B0ZA 5CPJC 3LZ0D 1P3OD 2IO5C 3AV2B 1P3AB 3AZHC 3X1TD 3KSYA 5JA4A 3AN2B 1KX5A 5CPJD 1P3MA 1TZYA 4Z2MH 1P34B 5GT0B 3RELC 3AZKA 1ZLAB 3R45A 2RVQC 4WV4B 5CPIC 3KXBB 5B24B 3AZHD 1KX3A 5DNMA 5BO0B 5B33D 5B1MA 4R8PB 5BNVB 3NQJA 3AZNC 3X1SC 3RELD 5E5AA 4G91C 2RVQD 1M1AA 4YM6B 5CPID 2FJ7B 3AZFD 4NE5A 4DRBA 2YFVA 4EO5C 5JRGA 3AZND 3X1SD 4LD9A 5CP6D 1KX4B 2AROA 2YFWA 3W96B 3AV1B 3C1CA 3REHB 1ULYA 3VH6A 2L5AA 4YS3B 2NZDC 3UTBC 2LY8A 1H3OB 4AWLB 3REJA 3MNNA 3AFAC 2HIOC 4H9RA 4NFTA 3REIB 1BH9B 1P3KB 3TU4A 2NZDD 3UTBD 1P3LC 5B1LA 5CHLB 5AV8B 3LZ0A 1HQ3A 5AV5B 3MGQC 3AFAD 4H9OB 1TAFB 3B6GC 4WNNB 3X1TA 4NE3A 1P3LD 3MGPB 3O62B 1U35B 3VH5W 2HUEB 4X23A 3MGQD 3KWQA 3LZ1D 3AZHA 3B0CW 4XUJB 5B33A 1ID3C 3AZLC 3RELA 1M18C 5B0YB 5GXQB 5GT3B 5CPIA 3AZFA 4KUDB 1N1JB 5B32G 1ID3D 5G49A 3AZIA 2PYOB 3AZLD 3AV2C 5AY8A 1P3AC 3AZNA 1M18D 3REKB 5CP6A 3AN2C 5GSUB 1P34C 4KGCB 5GT0C 1ZLAC 3AV2D 1JFIA 1P3AD 3WKJA 3NQUB 3KXBC 5B24C 5B2ID 3W97B 3AN2D 4R8PC 3MGRB 1P34D 1ZLAD 5F99A 4YM6C 3B0BA 5B24D 3KXBD 2FJ7C 2NZDA 4R8PD 5FUGB 5AVCB 3AFAA 3UT9B 1KX4C 2FJ7D 1A7WA 3W99A 5CPKB 3W96C 3AZJB 3REHC 3AV1C 3VH5A 4YS3C 1KX4D 3LZ1A 5B31B 4WZSB 3MGSB 4AWLC 4J8UD 3C1BA 3W96D 3REHD 4JJNB 4J8XA 2BYKB 1P3FB 3REIC 1P3KC 4YS3D 1F66D 3UTAB 2CV5B 5AV8C 1ID3A 4H9NA 5AV5C 4Z66A 3WTPB 2F8NA 1P3BB 3REID 1P3KD 3MGPC 3B6FB 3O62C 5AV8D 1U35C 2HUEC 5AV5D 1AOIB 3AV2A 4QLCB 1P3AA 5B2IA 4XUJC 3MGPD 5B40B 3AN2A 3O62D 4WU9B 1U35D 3MVDB 1Q9CA 2NQBB 1P34A 5B32B 4Z5TB 4KHAB 5GXQC 5B0YC 1S32A 5GT3C 1P3GB 5B24A 4KUDC 4XUJD 5BNXB 2PYOC 1EQZA 2BYMB 4CSRB 1P3PB 3LELB 5GXQD 5B0YD 3REKC 5GT3D 5B0ZB 4KUDD 5GSUC 4KGCC 2PYOD 5JA4B 3REKD 1KX5B 1KX4A 3W97C 5GSUD 3MGRC 4J8UA 4KGCD 3W96A 1KX3B 5BT1C 1HTAA 3WTPE 1F66A 4YS3A 3W98B 3W97D 1H3OA 5AVCC 1M1AB 3X1UB 1F1EA 5AVBA 3UT9C 3AZMA 5BT1D 5B31G 3REIA 1BH9A 1P3KA 5CPKC 2YFVB 5AV8A 3AZJC 4E44A 5AV5A
chains in the Genus database with same CATH superfamily
5AVCD 4DRAA 1P3OA 3UT9D 1TAFA 1BH8A 2HIOD 3AYWB 5B31C 3MGSC 5CPKD 3MGPA 5CPJA 3O62A 1U35A 3AZJD 4JJNC 1KU5A 1P3FC 4E45A 3UTAC 3B6GD 2CV5C 5B31D 2ZY2A 4XUJA 3MNNB 5AV6B 5DNNB 3WTPC 4H9RB 2FFFB 1P3FD 1P3BC 5B0YA 5GT3A 3UTAD 2CV5D 4KUDA 1M19B 3B6FC 1HQ3B 1N1JA 3WTPD 1AOIC 4QLCC 3X1SA 1P3BD 5B40C 1R4VA 5GSUA 4H9QB 4X23B 3MVDC 3KWQB 4WU9C 2NQBC 5JRGB 5B32C 2F8NK 1AOID 4Z5TC 4QLCD 1P3GC 3NQUA 3KUYB 5B33B 5BS7C 3V9RA 3W97A 5B40D 5B2JB 4WU9D 3MVDD 2NQBD 5KDMA 5B32D 5GT0D 3LELC 1P3PC 4H9SC 3AZFB 1P3GD 3B0DB 5B0ZC 5AV9B 5G49B 3AZIB 3UTBA 5AY8B 3AZEB 4UUZA 5CP6B 3LELD 3EPLA 3EPJA 3UT9A 2F2AC 3IP4C 1KX5C 2HIOA 2Y2LA 5B0ZD 4YM6D 3WA9B 4DQYB 4H9PA 5CPKA 1P3LA 4CAYA 3WKJB 3AZJA 1KX3C 3MGQA 4ZUXB 1KX5D 4XZQB 3W98C 3B6GA 5F99B 3X1UC 1M1AC 3AV1D 2BYKA 4J8WB 1P3FA 3W98D 3UTAA 2CV5A 2Y2KA 5JRGC 4WJ3C 1M1AD 3X1UD 3WTPA 3AZLA 3AYWC 1M18A 3W99B 4UPKA 4M6BA 2XD1A 3X1VB 3LZ1B 4QLCA 3AYWD 4J8VB 3C1BB 3MNNC 4WU9A 5AV6C 5DNNC 3LJAB 2NQBA 4J8XB 5B32A 3AL0C 5GT0A 3WAAB 1ZLAA 1P3IB 3A1KA 3KXBA 5BS7A 3A6NB 1M19C 1HQ3C 5BO0A 4Z66B 5BNXA 2F8NB 4R8PA 5BNVA 5DNND 5AV6D 2BYMA 4CSRA 3AZGB 3LELA 5C3IB 4WU8B 4YM6A 2FJ7A 1M19D 1HQ3D 4X23C 3KWQC 2Y2NA 5B2IB 1WWSA 3KUYC 2JSSA 5B33C 1BFMA 1P3MB 1WWIA 1TZYB 5B2JC 4X23D 3KWQD 3AZKB 1S32B 3R45B 3AV1A 3REHA 3AZFC 3B0DC 3KUYD 5DNMB 4G92B 5B1MB 5AV9C 3W98A 3AZIC 1EQZB 5B2JD 3NQJB 5AY8C 3AZEC 2Y2PA 2UWXA 3MGRD 5E5AB 4ZBJB 5CP6C 3X1UA 3WA9C 5AV9D 3AZID 5AY8D 1T3UA 3AZED 3WKJC 4LD9B 1PZRA 4H9OA 4HGAB 4ZUXC 4XZQC 4WNNA 1B6WA 3AYWA 2AROB 3WA9D 4J8UB 2YFWB 3C1CB 5F99C 3P5JB 3WKJD 1F66B 4J8WC 4ZUXD 4XZQD 3MGSD 3VH6T 3REJB 1B67A 5AVBB 3KFUG 3AZMB 5F99D 5AV6A 5DNNA 4JJND 4J8WD 3W99C 3TU4B 5GXQA 2Y2GA 3A1IA 5B1LB 1M19A 3LZ0B 3X1VC 1P3OB 1BH8B 2PYOA 3LZ1C 2BG1A 3W99D 4J8VC 3X1TB 3REKA 3C1BC 5CPJB 2F8NG 3B6FD 4H9QA 3X1VD 3LJAC 4J8XC 2IO5B 4NE6A 4KGCA 3WAAC 3AZHB 1P3IC 3KUYA 4J8VD 3A6NC 3C1BD 4Z66C 5B2JA 3LJAD 3MGRA 4J8XD 3RELB 3AZGC 3WAAD 4Z5TD 5C3IC 4WU8C 5CPIB 1P3ID 3A6ND 5AV9A 4Z66D 2F8ND 3AZEA 3AZNB 3X1SB 4G91B 5B2IC 5FUGA 5AVCA 3AZGD 1P3PD 4WU8D 3FDDA 1P3MC 1TZYC 3WA9A 4Z2MG 3AZKC 1S32C 1JFIB 4EO5B 4G92C 5DNMC 3V9RB 5B1MC 4ZUXA 4XZQA 1P3MD 1TZYD 1EQZC 5B31A 5KDMB 3MGSA 3AZKD 5E5AC 4ZBJC 1S32D 4JJNA 1KX3D 5DNMD 4J8WA 5B1MD 3UTBB 2G5IC 2NZDB 1EQZD 4UUZB 4LD9C 5E5AD 3AFAB 2HIOB 4HGAC 4H9PB 2Y2MA 1P3BA 2AROC 4J8UC 1P3LB 4CAYB 3C1CC 3B6FA 3X1VA 5JRGD 3MGQB 4LD9D 1F66C 1AOIA 3B6GB 4J8VA 2AROD 2F8NH 3VH6W 3REJC 5AVBC 5B40A 3C1CD 3AZMC 2CWEA 3VH5T 3MVDA 3LJAA 3WAAA 4Z5TA 4KHAA 3TU4C 1P3IA 1P3GA 5B1LC 3B0CT 3A6NA 1ID3B 4H9NB 3LZ0C 3REJD 1P3OC 5AVBD 3MNND 3AZMD 3AZLB 1M18B 3AZGA 3F6TA 1P3PA 3TU4D 4WU8A 4H9SA 3X1TC 5B1LD 5B0ZA 3EPKA 5CPJC 3LZ0D 1P3OD 2IO5C 3AV2B 1P3AB 3AZHC 2Y2IA 3X1TD 3KSYA 5JA4A 3AN2B 1KX5A 5CPJD 1P3MA 1TZYA 4Z2MH 1P34B 5GT0B 3RELC 3AZKA 1ZLAB 3R45A 2RVQC 4WV4B 5CPIC 3KXBB 5B24B 3AZHD 1KX3A 5DNMA 5BO0B 5B33D 5B1MA 4R8PB 5BNVB 3NQJA 3AZNC 3X1SC 3RELD 5E5AA 4G91C 2RVQD 1M1AA 4YM6B 5CPID 2FJ7B 3AZFD 4NE5A 4DRBA 2Y2QA 2YFVA 4EO5C 5JRGA 3AZND 3X1SD 4LD9A 5CP6D 1KX4B 2AROA 2YFWA 3W96B 3AV1B 3C1CA 3REHB 1ULYA 3VH6A 2L5AA 4YS3B 2NZDC 3UTBC 2LY8A 1H3OB 4AWLB 3REJA 3MNNA 3AFAC 2HIOC 4H9RA 4NFTA 3REIB 1BH9B 1P3KB 2ZM5A 3TU4A 2NZDD 3UTBD 1P3LC 5B1LA 5CHLB 5AV8B 3LZ0A 1HQ3A 3H0LC 5AV5B 3MGQC 3AFAD 4H9OB 2ZY3A 2VQRA 1TAFB 1W2EA 3B6GC 4WNNB 3X1TA 4NE3A 1P3LD 3MGPB 3O62B 1U35B 2G5HC 3VH5W 2HUEB 4X23A 3MGQD 3KWQA 3LZ1D 3AZHA 3B0CW 4XUJB 5B33A 1ID3C 1Z2CB 3AZLC 3RELA 1M18C 5GXQB 5B0YB 5GT3B 5CPIA 3AZFA 4KUDB 1N1JB 5B32G 1ID3D 5G49A 3AZIA 2PYOB 3AZLD 3AV2C 5AY8A 1P3AC 3AZNA 1M18D 3REKB 5CP6A 3AN2C 5GSUB 1P34C 4KGCB 5GT0C 1ZLAC 3AV2D 1JFIA 1P3AD 3WKJA 3NQUB 3KXBC 5B24C 5B2ID 3W97B 3AN2D 4R8PC 3EG5B 3MGRB 1P34D 1ZLAD 5F99A 4YM6C 3B0BA 5B24D 3KXBD 2FJ7C 2NZDA 4R8PD 5FUGB 5AVCB 3AFAA 3UT9B 3H0RC 1KX4C 2W8SA 2FJ7D 1A7WA 3W99A 5CPKB 3W96C 3AZJB 3REHC 3AV1C 2JE5A 3VH5A 4YS3C 1KX4D 3LZ1A 5B31B 4WZSB 3MGSB 4AWLC 4J8UD 3C1BA 3W96D 3REHD 4JJNB 4J8XA 2BYKB 1P3FB 3REIC 1P3KC 4YS3D 1F66D 3UTAB 2CV5B 5AV8C 1ID3A 4H9NA 5AV5C 4Z66A 3WTPB 2F8NA 2RIQA 1P3BB 3REID 1P3KD 2J8PA 3MGPC 3B6FB 3O62C 5AV8D 1U35C 2Y2OA 2HUEC 5AV5D 1AOIB 3AV2A 4QLCB 1P3AA 2Y2HA 5B2IA 4XUJC 2Y2JA 5B40B 3MGPD 3AN2A 3O62D 4WU9B 1U35D 3MVDB 1Q9CA 3EPHA 2NQBB 1P34A 5B32B 2DF4C 4Z5TB 4KHAB 5GXQC 5B0YC 1S32A 5GT3C 1P3GB 5B24A 4KUDC 4XUJD 2DQNC 5BNXB 2PYOC 3H0MC 2BYMB 4CSRB 1EQZA 2XD5A 3LELB 1P3PB 5GXQD 5B0YD 3REKC 2JCHA 5GT3D 5B0ZB 4KUDD 5GSUC 4KGCC 2ZY4A 2PYOD 5JA4B 3REKD 1KX5B 1KX4A 3W97C 5GSUD 3MGRC 4J8UA 4KGCD 3W96A 1KX3B 5BT1C 1HTAA 3WTPE 1F66A 4YS3A 3W98B 3W97D 1H3OA 5AVCC 1M1AB 3X1UB 5AVBA 1F1EA 3UT9C 3AZMA 5BT1D 5B31G 2ZY5A 1BH9A 3REIA 1P3KA 5CPKC 2YFVB 5AV8A 3AZJC 4E44A 5AV5A
chains in the Genus database with same CATH topology
5AVCD 4DRAA 1P3OA 3UT9D 1TAFA 1BH8A 2HIOD 3AYWB 5B31C 3MGSC 5CPKD 3MGPA 5CPJA 3O62A 1U35A 3AZJD 4JJNC 1KU5A 1P3FC 4E45A 3UTAC 3B6GD 2CV5C 5B31D 2ZY2A 4XUJA 3MNNB 5AV6B 5DNNB 3WTPC 4H9RB 2FFFB 1P3FD 1P3BC 5B0YA 5GT3A 3UTAD 2CV5D 4KUDA 1M19B 3B6FC 1HQ3B 1N1JA 3WTPD 1AOIC 4QLCC 3X1SA 1P3BD 5B40C 1R4VA 5GSUA 4H9QB 4X23B 3MVDC 3KWQB 4WU9C 2NQBC 5JRGB 5B32C 2F8NK 1AOID 4Z5TC 4QLCD 1P3GC 3NQUA 3KUYB 5B33B 5BS7C 3V9RA 3W97A 5B40D 5B2JB 4WU9D 3MVDD 2NQBD 5KDMA 5B32D 5GT0D 3LELC 1P3PC 4H9SC 3AZFB 1P3GD 3B0DB 5B0ZC 5AV9B 5G49B 3AZIB 3UTBA 5AY8B 3AZEB 4UUZA 5CP6B 3LELD 3EPLA 3EPJA 3UT9A 2F2AC 3IP4C 1KX5C 2HIOA 2Y2LA 5B0ZD 4YM6D 3WA9B 4DQYB 4H9PA 5CPKA 1P3LA 4CAYA 3WKJB 3AZJA 1KX3C 3MGQA 4ZUXB 1KX5D 4XZQB 3W98C 3B6GA 5F99B 3X1UC 1M1AC 3AV1D 2BYKA 4J8WB 1P3FA 3W98D 3UTAA 2CV5A 2Y2KA 5JRGC 4WJ3C 1M1AD 3X1UD 3WTPA 3AZLA 3AYWC 1M18A 3W99B 4UPKA 4M6BA 2XD1A 3X1VB 3LZ1B 4QLCA 3AYWD 4J8VB 3C1BB 3MNNC 4WU9A 5AV6C 5DNNC 3LJAB 2NQBA 4J8XB 5B32A 3AL0C 5GT0A 3WAAB 1ZLAA 1P3IB 3A1KA 3KXBA 5BS7A 3A6NB 1M19C 1HQ3C 5BO0A 4Z66B 5BNXA 2F8NB 4R8PA 5BNVA 5DNND 5AV6D 2BYMA 4CSRA 3AZGB 3LELA 5C3IB 4WU8B 4YM6A 2FJ7A 1M19D 1HQ3D 4X23C 3KWQC 2Y2NA 5B2IB 1WWSA 3KUYC 2JSSA 5B33C 1BFMA 1P3MB 1WWIA 1TZYB 5B2JC 4X23D 3KWQD 3AZKB 1S32B 3R45B 3AV1A 3REHA 3AZFC 3B0DC 3KUYD 5DNMB 4G92B 5B1MB 5AV9C 3W98A 3AZIC 1EQZB 5B2JD 3NQJB 5AY8C 3AZEC 2Y2PA 2UWXA 3MGRD 5E5AB 4ZBJB 5CP6C 3X1UA 3WA9C 5AV9D 3AZID 5AY8D 1T3UA 3AZED 3WKJC 4LD9B 1PZRA 4H9OA 4HGAB 4ZUXC 4XZQC 4WNNA 1B6WA 3AYWA 2AROB 3WA9D 4J8UB 2YFWB 3C1CB 5F99C 3P5JB 3WKJD 1F66B 4J8WC 4ZUXD 4XZQD 3MGSD 3VH6T 3REJB 1B67A 5AVBB 3KFUG 3AZMB 5F99D 5AV6A 5DNNA 4JJND 4J8WD 3W99C 3TU4B 5GXQA 2Y2GA 3A1IA 5B1LB 1M19A 3LZ0B 3X1VC 1P3OB 1BH8B 2PYOA 3LZ1C 2BG1A 3W99D 4J8VC 3X1TB 3REKA 3C1BC 5CPJB 2F8NG 3B6FD 4H9QA 3X1VD 3LJAC 4J8XC 2IO5B 4NE6A 4KGCA 3WAAC 3AZHB 1P3IC 3KUYA 4J8VD 3A6NC 3C1BD 4Z66C 5B2JA 3LJAD 3MGRA 4J8XD 3RELB 3AZGC 3WAAD 4Z5TD 5C3IC 4WU8C 5CPIB 1P3ID 3A6ND 5AV9A 4Z66D 2F8ND 3AZEA 3AZNB 3X1SB 4G91B 5B2IC 5FUGA 5AVCA 3AZGD 1P3PD 4WU8D 3FDDA 1P3MC 1TZYC 3WA9A 4Z2MG 3AZKC 1S32C 1JFIB 4EO5B 4G92C 5DNMC 3V9RB 5B1MC 4ZUXA 4XZQA 1P3MD 1TZYD 1EQZC 5B31A 5KDMB 3MGSA 3AZKD 5E5AC 4ZBJC 1S32D 4JJNA 1KX3D 5DNMD 4J8WA 5B1MD 3UTBB 2G5IC 2NZDB 1EQZD 4UUZB 4LD9C 5E5AD 3AFAB 2HIOB 4HGAC 4H9PB 2Y2MA 1P3BA 2AROC 4J8UC 1P3LB 4CAYB 3C1CC 3B6FA 3X1VA 5JRGD 3MGQB 4LD9D 1F66C 1AOIA 3B6GB 4J8VA 2AROD 2F8NH 3VH6W 3REJC 5AVBC 5B40A 3C1CD 3AZMC 2CWEA 3VH5T 3MVDA 3LJAA 3WAAA 4Z5TA 4KHAA 3TU4C 1P3IA 1P3GA 5B1LC 3B0CT 3A6NA 1ID3B 4H9NB 3LZ0C 3REJD 1P3OC 5AVBD 3MNND 3AZMD 3AZLB 1M18B 3AZGA 3F6TA 1P3PA 3TU4D 4WU8A 4H9SA 3X1TC 5B1LD 5B0ZA 3EPKA 5CPJC 3LZ0D 1P3OD 2IO5C 3AV2B 1P3AB 3AZHC 2Y2IA 3X1TD 3KSYA 5JA4A 3AN2B 1KX5A 5CPJD 1P3MA 1TZYA 4Z2MH 1P34B 5GT0B 3RELC 3AZKA 1ZLAB 3R45A 2RVQC 4WV4B 5CPIC 3KXBB 5B24B 3AZHD 1KX3A 5DNMA 5BO0B 5B33D 5B1MA 4R8PB 5BNVB 3NQJA 3AZNC 3X1SC 3RELD 5E5AA 4G91C 2RVQD 1M1AA 4YM6B 5CPID 2FJ7B 3AZFD 4NE5A 4DRBA 2Y2QA 2YFVA 4EO5C 5JRGA 3AZND 3X1SD 4LD9A 5CP6D 1KX4B 2AROA 2YFWA 3W96B 3AV1B 3C1CA 3REHB 1ULYA 3VH6A 2L5AA 4YS3B 2NZDC 3UTBC 2LY8A 1H3OB 4AWLB 3REJA 3MNNA 3AFAC 2HIOC 4H9RA 4NFTA 3REIB 1BH9B 1P3KB 2ZM5A 3TU4A 2NZDD 3UTBD 1P3LC 5B1LA 5CHLB 5AV8B 3LZ0A 1HQ3A 3H0LC 5AV5B 3MGQC 3AFAD 4H9OB 2ZY3A 2VQRA 1TAFB 1W2EA 3B6GC 4WNNB 3X1TA 4NE3A 1P3LD 3MGPB 3O62B 1U35B 2G5HC 3VH5W 2HUEB 4X23A 3MGQD 3KWQA 3LZ1D 3AZHA 3B0CW 4XUJB 5B33A 1ID3C 1Z2CB 3AZLC 3RELA 1M18C 5GXQB 5B0YB 5GT3B 5CPIA 3AZFA 4KUDB 1N1JB 5B32G 1ID3D 5G49A 3AZIA 2PYOB 3AZLD 3AV2C 5AY8A 1P3AC 3AZNA 1M18D 3REKB 5CP6A 3AN2C 5GSUB 1P34C 4KGCB 5GT0C 1ZLAC 3AV2D 1JFIA 1P3AD 3WKJA 3NQUB 3KXBC 5B24C 5B2ID 3W97B 3AN2D 4R8PC 3EG5B 3MGRB 1P34D 1ZLAD 5F99A 4YM6C 3B0BA 5B24D 3KXBD 2FJ7C 2NZDA 4R8PD 5FUGB 5AVCB 3AFAA 3UT9B 3H0RC 1KX4C 2W8SA 2FJ7D 1A7WA 3W99A 5CPKB 3W96C 3AZJB 3REHC 3AV1C 2JE5A 3VH5A 4YS3C 1KX4D 3LZ1A 5B31B 4WZSB 3MGSB 4AWLC 4J8UD 3C1BA 3W96D 3REHD 4JJNB 4J8XA 2BYKB 1P3FB 3REIC 1P3KC 4YS3D 1F66D 3UTAB 2CV5B 5AV8C 1ID3A 4H9NA 5AV5C 4Z66A 3WTPB 2F8NA 2RIQA 1P3BB 3REID 1P3KD 2J8PA 3MGPC 3B6FB 3O62C 5AV8D 1U35C 2Y2OA 2HUEC 5AV5D 1AOIB 3AV2A 4QLCB 1P3AA 2Y2HA 5B2IA 4XUJC 2Y2JA 5B40B 3MGPD 3AN2A 3O62D 4WU9B 1U35D 3MVDB 1Q9CA 3EPHA 2NQBB 1P34A 5B32B 2DF4C 4Z5TB 4KHAB 5GXQC 5B0YC 1S32A 5GT3C 1P3GB 5B24A 4KUDC 4XUJD 2DQNC 5BNXB 2PYOC 3H0MC 2BYMB 4CSRB 1EQZA 2XD5A 3LELB 1P3PB 5GXQD 5B0YD 3REKC 2JCHA 5GT3D 5B0ZB 4KUDD 5GSUC 4KGCC 2ZY4A 2PYOD 5JA4B 3REKD 1KX5B 1KX4A 3W97C 5GSUD 3MGRC 4J8UA 4KGCD 3W96A 1KX3B 5BT1C 1HTAA 3WTPE 1F66A 4YS3A 3W98B 3W97D 1H3OA 5AVCC 1M1AB 3X1UB 5AVBA 1F1EA 3UT9C 3AZMA 5BT1D 5B31G 2ZY5A 1BH9A 3REIA 1P3KA 5CPKC 2YFVB 5AV8A 3AZJC 4E44A 5AV5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AVC D;  4DRA A;  1P3O A;  3UT9 D;  1TAF A;  1BH8 A;  2HIO D;  3AYW B;  5B31 C;  3MGS C;  5CPK D;  3MGP A;  5CPJ A;  3O62 A;  1U35 A;  3AZJ D;  4JJN C;  1KU5 A;  1P3F C;  4E45 A;  3UTA C;  3B6G D;  2CV5 C;  5B31 D;  4XUJ A;  3MNN B;  5AV6 B;  5DNN B;  3WTP C;  4H9R B;  1P3F D;  1P3B C;  5B0Y A;  5GT3 A;  3UTA D;  2CV5 D;  4KUD A;  1M19 B;  3B6F C;  1HQ3 B;  1N1J A;  3WTP D;  1AOI C;  4QLC C;  3X1S A;  1P3B D;  5B40 C;  1R4V A;  5GSU A;  4H9Q B;  4X23 B;  3MVD C;  3KWQ B;  4WU9 C;  2NQB C;  5JRG B;  5B32 C;  2F8N K;  1AOI D;  4Z5T C;  4QLC D;  1P3G C;  3NQU A;  3KUY B;  5B33 B;  5BS7 C;  3V9R A;  3W97 A;  5B40 D;  5B2J B;  4WU9 D;  3MVD D;  2NQB D;  5KDM A;  5B32 D;  5GT0 D;  3LEL C;  1P3P C;  4H9S C;  3AZF B;  1P3G D;  3B0D B;  5B0Z C;  5G49 B;  5AV9 B;  3AZI B;  3UTB A;  5AY8 B;  3AZE B;  4UUZ A;  5CP6 B;  3LEL D;  3UT9 A;  1KX5 C;  2HIO A;  5B0Z D;  4YM6 D;  3WA9 B;  4H9P A;  5CPK A;  1P3L A;  4CAY A;  3WKJ B;  3AZJ A;  1KX3 C;  3MGQ A;  4ZUX B;  1KX5 D;  4XZQ B;  3W98 C;  3B6G A;  5F99 B;  3X1U C;  1M1A C;  3AV1 D;  2BYK A;  4J8W B;  1P3F A;  3W98 D;  3UTA A;  2CV5 A;  5JRG C;  1M1A D;  3X1U D;  3WTP A;  3AZL A;  3AYW C;  1M18 A;  3W99 B;  4M6B A;  3X1V B;  3LZ1 B;  4QLC A;  3AYW D;  4J8V B;  3C1B B;  3MNN C;  4WU9 A;  5AV6 C;  5DNN C;  3LJA B;  2NQB A;  4J8X B;  5B32 A;  5GT0 A;  3WAA B;  1ZLA A;  1P3I B;  3KXB A;  5BS7 A;  3A6N B;  1M19 C;  1HQ3 C;  5BO0 A;  4Z66 B;  5BNX A;  2F8N B;  4R8P A;  5BNV A;  5DNN D;  5AV6 D;  2BYM A;  4CSR A;  3AZG B;  3LEL A;  5C3I B;  4WU8 B;  4YM6 A;  2FJ7 A;  1M19 D;  1HQ3 D;  4X23 C;  3KWQ C;  5B2I B;  1WWS A;  3KUY C;  2JSS A;  5B33 C;  1BFM A;  1P3M B;  1WWI A;  1TZY B;  5B2J C;  4X23 D;  3KWQ D;  3AZK B;  1S32 B;  3R45 B;  3AV1 A;  3REH A;  3AZF C;  3B0D C;  3KUY D;  5DNM B;  4G92 B;  5B1M B;  5AV9 C;  3W98 A;  3AZI C;  1EQZ B;  5B2J D;  3NQJ B;  5AY8 C;  3AZE C;  3MGR D;  5E5A B;  4ZBJ B;  5CP6 C;  3X1U A;  3WA9 C;  5AV9 D;  3AZI D;  5AY8 D;  3AZE D;  3WKJ C;  4LD9 B;  4H9O A;  4HGA B;  4ZUX C;  4XZQ C;  4WNN A;  1B6W A;  3AYW A;  2ARO B;  3WA9 D;  4J8U B;  2YFW B;  3C1C B;  5F99 C;  3WKJ D;  1F66 B;  4J8W C;  4ZUX D;  4XZQ D;  3MGS D;  3VH6 T;  3REJ B;  1B67 A;  5AVB B;  3AZM B;  5F99 D;  5AV6 A;  5DNN A;  4JJN D;  4J8W D;  3W99 C;  3TU4 B;  5GXQ A;  5B1L B;  1M19 A;  3LZ0 B;  3X1V C;  1P3O B;  1BH8 B;  2PYO A;  3LZ1 C;  3W99 D;  4J8V C;  3X1T B;  3REK A;  3C1B C;  5CPJ B;  2F8N G;  3B6F D;  4H9Q A;  3X1V D;  3LJA C;  4J8X C;  2IO5 B;  4NE6 A;  4KGC A;  3WAA C;  3AZH B;  1P3I C;  3KUY A;  4J8V D;  3A6N C;  3C1B D;  4Z66 C;  5B2J A;  3LJA D;  3MGR A;  4J8X D;  3REL B;  3AZG C;  3WAA D;  4Z5T D;  5C3I C;  4WU8 C;  5CPI B;  1P3I D;  3A6N D;  5AV9 A;  4Z66 D;  2F8N D;  3AZE A;  3AZN B;  3X1S B;  4G91 B;  5B2I C;  5FUG A;  5AVC A;  3AZG D;  1P3P D;  4WU8 D;  1P3M C;  1TZY C;  3WA9 A;  4Z2M G;  3AZK C;  1S32 C;  1JFI B;  4EO5 B;  4G92 C;  5DNM C;  3V9R B;  5B1M C;  4ZUX A;  4XZQ A;  1P3M D;  1TZY D;  1EQZ C;  5B31 A;  5KDM B;  3MGS A;  3AZK D;  5E5A C;  4ZBJ C;  1S32 D;  4JJN A;  1KX3 D;  5DNM D;  4J8W A;  5B1M D;  3UTB B;  2NZD B;  1EQZ D;  4UUZ B;  4LD9 C;  5E5A D;  3AFA B;  2HIO B;  4HGA C;  4H9P B;  1P3B A;  2ARO C;  4J8U C;  1P3L B;  4CAY B;  3C1C C;  3B6F A;  3X1V A;  5JRG D;  3MGQ B;  4LD9 D;  1F66 C;  1AOI A;  3B6G B;  4J8V A;  2ARO D;  2F8N H;  3VH6 W;  3REJ C;  5AVB C;  5B40 A;  3C1C D;  3AZM C;  2CWE A;  3VH5 T;  3MVD A;  3LJA A;  3WAA A;  4Z5T A;  4KHA A;  3TU4 C;  1P3I A;  1P3G A;  5B1L C;  3B0C T;  3A6N A;  1ID3 B;  4H9N B;  3LZ0 C;  3REJ D;  1P3O C;  5AVB D;  3MNN D;  3AZM D;  3AZL B;  1M18 B;  3AZG A;  1P3P A;  3TU4 D;  4WU8 A;  4H9S A;  3X1T C;  5B1L D;  5B0Z A;  5CPJ C;  3LZ0 D;  1P3O D;  2IO5 C;  3AV2 B;  1P3A B;  3AZH C;  3X1T D;  3KSY A;  5JA4 A;  3AN2 B;  1KX5 A;  5CPJ D;  1P3M A;  1TZY A;  4Z2M H;  1P34 B;  5GT0 B;  3REL C;  3AZK A;  1ZLA B;  3R45 A;  2RVQ C;  4WV4 B;  5CPI C;  3KXB B;  5B24 B;  3AZH D;  1KX3 A;  5DNM A;  5BO0 B;  5B33 D;  5B1M A;  4R8P B;  5BNV B;  3NQJ A;  3AZN C;  3X1S C;  3REL D;  5E5A A;  4G91 C;  2RVQ D;  1M1A A;  4YM6 B;  5CPI D;  2FJ7 B;  3AZF D;  4NE5 A;  4DRB A;  2YFV A;  4EO5 C;  5JRG A;  3AZN D;  3X1S D;  4LD9 A;  5CP6 D;  1KX4 B;  2ARO A;  2YFW A;  3W96 B;  3AV1 B;  3C1C A;  3REH B;  1ULY A;  3VH6 A;  2L5A A;  4YS3 B;  2NZD C;  3UTB C;  2LY8 A;  1H3O B;  4AWL B;  3REJ A;  3MNN A;  3AFA C;  2HIO C;  4H9R A;  4NFT A;  3REI B;  1BH9 B;  1P3K B;  3TU4 A;  2NZD D;  3UTB D;  1P3L C;  5B1L A;  5CHL B;  5AV8 B;  3LZ0 A;  1HQ3 A;  5AV5 B;  3MGQ C;  3AFA D;  4H9O B;  1TAF B;  3B6G C;  4WNN B;  3X1T A;  4NE3 A;  1P3L D;  3MGP B;  3O62 B;  1U35 B;  3VH5 W;  2HUE B;  4X23 A;  3MGQ D;  3KWQ A;  3LZ1 D;  3AZH A;  3B0C W;  4XUJ B;  5B33 A;  1ID3 C;  3AZL C;  3REL A;  1M18 C;  5B0Y B;  5GXQ B;  5GT3 B;  5CPI A;  3AZF A;  4KUD B;  1N1J B;  5B32 G;  1ID3 D;  5G49 A;  3AZI A;  2PYO B;  3AZL D;  3AV2 C;  5AY8 A;  1P3A C;  3AZN A;  1M18 D;  3REK B;  5CP6 A;  3AN2 C;  5GSU B;  1P34 C;  4KGC B;  5GT0 C;  1ZLA C;  3AV2 D;  1JFI A;  1P3A D;  3WKJ A;  3NQU B;  3KXB C;  5B24 C;  5B2I D;  3W97 B;  3AN2 D;  4R8P C;  3MGR B;  1P34 D;  1ZLA D;  5F99 A;  4YM6 C;  3B0B A;  5B24 D;  3KXB D;  2FJ7 C;  2NZD A;  4R8P D;  5FUG B;  5AVC B;  3AFA A;  3UT9 B;  1KX4 C;  2FJ7 D;  1A7W A;  3W99 A;  5CPK B;  3W96 C;  3AZJ B;  3REH C;  3AV1 C;  3VH5 A;  4YS3 C;  1KX4 D;  3LZ1 A;  5B31 B;  4WZS B;  3MGS B;  4AWL C;  4J8U D;  3C1B A;  3W96 D;  3REH D;  4JJN B;  4J8X A;  2BYK B;  1P3F B;  3REI C;  1P3K C;  4YS3 D;  1F66 D;  3UTA B;  2CV5 B;  5AV8 C;  1ID3 A;  4H9N A;  5AV5 C;  4Z66 A;  3WTP B;  2F8N A;  1P3B B;  3REI D;  1P3K D;  3MGP C;  3B6F B;  3O62 C;  5AV8 D;  1U35 C;  2HUE C;  5AV5 D;  1AOI B;  3AV2 A;  4QLC B;  1P3A A;  5B2I A;  4XUJ C;  3MGP D;  5B40 B;  3AN2 A;  3O62 D;  4WU9 B;  1U35 D;  3MVD B;  1Q9C A;  2NQB B;  1P34 A;  5B32 B;  4Z5T B;  4KHA B;  5GXQ C;  5B0Y C;  1S32 A;  5GT3 C;  1P3G B;  5B24 A;  4KUD C;  4XUJ D;  5BNX B;  2PYO C;  1EQZ A;  2BYM B;  4CSR B;  1P3P B;  3LEL B;  5GXQ D;  5B0Y D;  3REK C;  5GT3 D;  5B0Z B;  4KUD D;  5GSU C;  4KGC C;  2PYO D;  5JA4 B;  3REK D;  1KX5 B;  1KX4 A;  3W97 C;  5GSU D;  3MGR C;  4J8U A;  4KGC D;  3W96 A;  1KX3 B;  5BT1 C;  1HTA A;  3WTP E;  1F66 A;  4YS3 A;  3W98 B;  3W97 D;  1H3O A;  5AVC C;  1M1A B;  3X1U B;  1F1E A;  5AVB A;  3UT9 C;  3AZM A;  5BT1 D;  5B31 G;  3REI A;  1BH9 A;  1P3K A;  5CPK C;  2YFV B;  5AV8 A;  3AZJ C;  4E44 A;  5AV5 A; 
#chains in the Genus database with same CATH topology
 5AVC D;  4DRA A;  1P3O A;  3UT9 D;  1TAF A;  1BH8 A;  2HIO D;  3AYW B;  5B31 C;  3MGS C;  5CPK D;  3MGP A;  5CPJ A;  3O62 A;  1U35 A;  3AZJ D;  4JJN C;  1KU5 A;  1P3F C;  4E45 A;  3UTA C;  3B6G D;  2CV5 C;  5B31 D;  2ZY2 A;  4XUJ A;  3MNN B;  5AV6 B;  5DNN B;  3WTP C;  4H9R B;  2FFF B;  1P3F D;  1P3B C;  5B0Y A;  5GT3 A;  3UTA D;  2CV5 D;  4KUD A;  1M19 B;  3B6F C;  1HQ3 B;  1N1J A;  3WTP D;  1AOI C;  4QLC C;  3X1S A;  1P3B D;  5B40 C;  1R4V A;  5GSU A;  4H9Q B;  4X23 B;  3MVD C;  3KWQ B;  4WU9 C;  2NQB C;  5JRG B;  5B32 C;  2F8N K;  1AOI D;  4Z5T C;  4QLC D;  1P3G C;  3NQU A;  3KUY B;  5B33 B;  5BS7 C;  3V9R A;  3W97 A;  5B40 D;  5B2J B;  4WU9 D;  3MVD D;  2NQB D;  5KDM A;  5B32 D;  5GT0 D;  3LEL C;  1P3P C;  4H9S C;  3AZF B;  1P3G D;  3B0D B;  5B0Z C;  5AV9 B;  5G49 B;  3AZI B;  3UTB A;  5AY8 B;  3AZE B;  4UUZ A;  5CP6 B;  3LEL D;  3EPL A;  3EPJ A;  3UT9 A;  2F2A C;  3IP4 C;  1KX5 C;  2HIO A;  2Y2L A;  5B0Z D;  4YM6 D;  3WA9 B;  4DQY B;  4H9P A;  5CPK A;  1P3L A;  4CAY A;  3WKJ B;  3AZJ A;  1KX3 C;  3MGQ A;  4ZUX B;  1KX5 D;  4XZQ B;  3W98 C;  3B6G A;  5F99 B;  3X1U C;  1M1A C;  3AV1 D;  2BYK A;  4J8W B;  1P3F A;  3W98 D;  3UTA A;  2CV5 A;  2Y2K A;  5JRG C;  4WJ3 C;  1M1A D;  3X1U D;  3WTP A;  3AZL A;  3AYW C;  1M18 A;  3W99 B;  4UPK A;  4M6B A;  2XD1 A;  3X1V B;  3LZ1 B;  4QLC A;  3AYW D;  4J8V B;  3C1B B;  3MNN C;  4WU9 A;  5AV6 C;  5DNN C;  3LJA B;  2NQB A;  4J8X B;  5B32 A;  3AL0 C;  5GT0 A;  3WAA B;  1ZLA A;  1P3I B;  3A1K A;  3KXB A;  5BS7 A;  3A6N B;  1M19 C;  1HQ3 C;  5BO0 A;  4Z66 B;  5BNX A;  2F8N B;  4R8P A;  5BNV A;  5DNN D;  5AV6 D;  2BYM A;  4CSR A;  3AZG B;  3LEL A;  5C3I B;  4WU8 B;  4YM6 A;  2FJ7 A;  1M19 D;  1HQ3 D;  4X23 C;  3KWQ C;  2Y2N A;  5B2I B;  1WWS A;  3KUY C;  2JSS A;  5B33 C;  1BFM A;  1P3M B;  1WWI A;  1TZY B;  5B2J C;  4X23 D;  3KWQ D;  3AZK B;  1S32 B;  3R45 B;  3AV1 A;  3REH A;  3AZF C;  3B0D C;  3KUY D;  5DNM B;  4G92 B;  5B1M B;  5AV9 C;  3W98 A;  3AZI C;  1EQZ B;  5B2J D;  3NQJ B;  5AY8 C;  3AZE C;  2Y2P A;  2UWX A;  3MGR D;  5E5A B;  4ZBJ B;  5CP6 C;  3X1U A;  3WA9 C;  5AV9 D;  3AZI D;  5AY8 D;  1T3U A;  3AZE D;  3WKJ C;  4LD9 B;  1PZR A;  4H9O A;  4HGA B;  4ZUX C;  4XZQ C;  4WNN A;  1B6W A;  3AYW A;  2ARO B;  3WA9 D;  4J8U B;  2YFW B;  3C1C B;  5F99 C;  3P5J B;  3WKJ D;  1F66 B;  4J8W C;  4ZUX D;  4XZQ D;  3MGS D;  3VH6 T;  3REJ B;  1B67 A;  5AVB B;  3KFU G;  3AZM B;  5F99 D;  5AV6 A;  5DNN A;  4JJN D;  4J8W D;  3W99 C;  3TU4 B;  5GXQ A;  2Y2G A;  3A1I A;  5B1L B;  1M19 A;  3LZ0 B;  3X1V C;  1P3O B;  1BH8 B;  2PYO A;  3LZ1 C;  2BG1 A;  3W99 D;  4J8V C;  3X1T B;  3REK A;  3C1B C;  5CPJ B;  2F8N G;  3B6F D;  4H9Q A;  3X1V D;  3LJA C;  4J8X C;  2IO5 B;  4NE6 A;  4KGC A;  3WAA C;  3AZH B;  1P3I C;  3KUY A;  4J8V D;  3A6N C;  3C1B D;  4Z66 C;  5B2J A;  3LJA D;  3MGR A;  4J8X D;  3REL B;  3AZG C;  3WAA D;  4Z5T D;  5C3I C;  4WU8 C;  5CPI B;  1P3I D;  3A6N D;  5AV9 A;  4Z66 D;  2F8N D;  3AZE A;  3AZN B;  3X1S B;  4G91 B;  5B2I C;  5FUG A;  5AVC A;  3AZG D;  1P3P D;  4WU8 D;  3FDD A;  1P3M C;  1TZY C;  3WA9 A;  4Z2M G;  3AZK C;  1S32 C;  1JFI B;  4EO5 B;  4G92 C;  5DNM C;  3V9R B;  5B1M C;  4ZUX A;  4XZQ A;  1P3M D;  1TZY D;  1EQZ C;  5B31 A;  5KDM B;  3MGS A;  3AZK D;  5E5A C;  4ZBJ C;  1S32 D;  4JJN A;  1KX3 D;  5DNM D;  4J8W A;  5B1M D;  3UTB B;  2G5I C;  2NZD B;  1EQZ D;  4UUZ B;  4LD9 C;  5E5A D;  3AFA B;  2HIO B;  4HGA C;  4H9P B;  2Y2M A;  1P3B A;  2ARO C;  4J8U C;  1P3L B;  4CAY B;  3C1C C;  3B6F A;  3X1V A;  5JRG D;  3MGQ B;  4LD9 D;  1F66 C;  1AOI A;  3B6G B;  4J8V A;  2ARO D;  2F8N H;  3VH6 W;  3REJ C;  5AVB C;  5B40 A;  3C1C D;  3AZM C;  2CWE A;  3VH5 T;  3MVD A;  3LJA A;  3WAA A;  4Z5T A;  4KHA A;  3TU4 C;  1P3I A;  1P3G A;  5B1L C;  3B0C T;  3A6N A;  1ID3 B;  4H9N B;  3LZ0 C;  3REJ D;  1P3O C;  5AVB D;  3MNN D;  3AZM D;  3AZL B;  1M18 B;  3AZG A;  3F6T A;  1P3P A;  3TU4 D;  4WU8 A;  4H9S A;  3X1T C;  5B1L D;  5B0Z A;  3EPK A;  5CPJ C;  3LZ0 D;  1P3O D;  2IO5 C;  3AV2 B;  1P3A B;  3AZH C;  2Y2I A;  3X1T D;  3KSY A;  5JA4 A;  3AN2 B;  1KX5 A;  5CPJ D;  1P3M A;  1TZY A;  4Z2M H;  1P34 B;  5GT0 B;  3REL C;  3AZK A;  1ZLA B;  3R45 A;  2RVQ C;  4WV4 B;  5CPI C;  3KXB B;  5B24 B;  3AZH D;  1KX3 A;  5DNM A;  5BO0 B;  5B33 D;  5B1M A;  4R8P B;  5BNV B;  3NQJ A;  3AZN C;  3X1S C;  3REL D;  5E5A A;  4G91 C;  2RVQ D;  1M1A A;  4YM6 B;  5CPI D;  2FJ7 B;  3AZF D;  4NE5 A;  4DRB A;  2Y2Q A;  2YFV A;  4EO5 C;  5JRG A;  3AZN D;  3X1S D;  4LD9 A;  5CP6 D;  1KX4 B;  2ARO A;  2YFW A;  3W96 B;  3AV1 B;  3C1C A;  3REH B;  1ULY A;  3VH6 A;  2L5A A;  4YS3 B;  2NZD C;  3UTB C;  2LY8 A;  1H3O B;  4AWL B;  3REJ A;  3MNN A;  3AFA C;  2HIO C;  4H9R A;  4NFT A;  3REI B;  1BH9 B;  1P3K B;  2ZM5 A;  3TU4 A;  2NZD D;  3UTB D;  1P3L C;  5B1L A;  5CHL B;  5AV8 B;  3LZ0 A;  1HQ3 A;  3H0L C;  5AV5 B;  3MGQ C;  3AFA D;  4H9O B;  2ZY3 A;  2VQR A;  1TAF B;  1W2E A;  3B6G C;  4WNN B;  3X1T A;  4NE3 A;  1P3L D;  3MGP B;  3O62 B;  1U35 B;  2G5H C;  3VH5 W;  2HUE B;  4X23 A;  3MGQ D;  3KWQ A;  3LZ1 D;  3AZH A;  3B0C W;  4XUJ B;  5B33 A;  1ID3 C;  1Z2C B;  3AZL C;  3REL A;  1M18 C;  5GXQ B;  5B0Y B;  5GT3 B;  5CPI A;  3AZF A;  4KUD B;  1N1J B;  5B32 G;  1ID3 D;  5G49 A;  3AZI A;  2PYO B;  3AZL D;  3AV2 C;  5AY8 A;  1P3A C;  3AZN A;  1M18 D;  3REK B;  5CP6 A;  3AN2 C;  5GSU B;  1P34 C;  4KGC B;  5GT0 C;  1ZLA C;  3AV2 D;  1JFI A;  1P3A D;  3WKJ A;  3NQU B;  3KXB C;  5B24 C;  5B2I D;  3W97 B;  3AN2 D;  4R8P C;  3EG5 B;  3MGR B;  1P34 D;  1ZLA D;  5F99 A;  4YM6 C;  3B0B A;  5B24 D;  3KXB D;  2FJ7 C;  2NZD A;  4R8P D;  5FUG B;  5AVC B;  3AFA A;  3UT9 B;  3H0R C;  1KX4 C;  2W8S A;  2FJ7 D;  1A7W A;  3W99 A;  5CPK B;  3W96 C;  3AZJ B;  3REH C;  3AV1 C;  2JE5 A;  3VH5 A;  4YS3 C;  1KX4 D;  3LZ1 A;  5B31 B;  4WZS B;  3MGS B;  4AWL C;  4J8U D;  3C1B A;  3W96 D;  3REH D;  4JJN B;  4J8X A;  2BYK B;  1P3F B;  3REI C;  1P3K C;  4YS3 D;  1F66 D;  3UTA B;  2CV5 B;  5AV8 C;  1ID3 A;  4H9N A;  5AV5 C;  4Z66 A;  3WTP B;  2F8N A;  2RIQ A;  1P3B B;  3REI D;  1P3K D;  2J8P A;  3MGP C;  3B6F B;  3O62 C;  5AV8 D;  1U35 C;  2Y2O A;  2HUE C;  5AV5 D;  1AOI B;  3AV2 A;  4QLC B;  1P3A A;  2Y2H A;  5B2I A;  4XUJ C;  2Y2J A;  5B40 B;  3MGP D;  3AN2 A;  3O62 D;  4WU9 B;  1U35 D;  3MVD B;  1Q9C A;  3EPH A;  2NQB B;  1P34 A;  5B32 B;  2DF4 C;  4Z5T B;  4KHA B;  5GXQ C;  5B0Y C;  1S32 A;  5GT3 C;  1P3G B;  5B24 A;  4KUD C;  4XUJ D;  2DQN C;  5BNX B;  2PYO C;  3H0M C;  2BYM B;  4CSR B;  1EQZ A;  2XD5 A;  3LEL B;  1P3P B;  5GXQ D;  5B0Y D;  3REK C;  2JCH A;  5GT3 D;  5B0Z B;  4KUD D;  5GSU C;  4KGC C;  2ZY4 A;  2PYO D;  5JA4 B;  3REK D;  1KX5 B;  1KX4 A;  3W97 C;  5GSU D;  3MGR C;  4J8U A;  4KGC D;  3W96 A;  1KX3 B;  5BT1 C;  1HTA A;  3WTP E;  1F66 A;  4YS3 A;  3W98 B;  3W97 D;  1H3O A;  5AVC C;  1M1A B;  3X1U B;  5AVB A;  1F1E A;  3UT9 C;  3AZM A;  5BT1 D;  5B31 G;  2ZY5 A;  1BH9 A;  3REI A;  1P3K A;  5CPK C;  2YFV B;  5AV8 A;  3AZJ C;  4E44 A;  5AV5 A; 
#chains in the Genus database with same CATH homology
 5AVC D;  4DRA A;  1P3O A;  3UT9 D;  1TAF A;  1BH8 A;  2HIO D;  3AYW B;  5B31 C;  3MGS C;  5CPK D;  3MGP A;  5CPJ A;  3O62 A;  1U35 A;  3AZJ D;  4JJN C;  1KU5 A;  1P3F C;  4E45 A;  3UTA C;  3B6G D;  2CV5 C;  5B31 D;  2ZY2 A;  4XUJ A;  3MNN B;  5AV6 B;  5DNN B;  3WTP C;  4H9R B;  2FFF B;  1P3F D;  1P3B C;  5B0Y A;  5GT3 A;  3UTA D;  2CV5 D;  4KUD A;  1M19 B;  3B6F C;  1HQ3 B;  1N1J A;  3WTP D;  1AOI C;  4QLC C;  3X1S A;  1P3B D;  5B40 C;  1R4V A;  5GSU A;  4H9Q B;  4X23 B;  3MVD C;  3KWQ B;  4WU9 C;  2NQB C;  5JRG B;  5B32 C;  2F8N K;  1AOI D;  4Z5T C;  4QLC D;  1P3G C;  3NQU A;  3KUY B;  5B33 B;  5BS7 C;  3V9R A;  3W97 A;  5B40 D;  5B2J B;  4WU9 D;  3MVD D;  2NQB D;  5KDM A;  5B32 D;  5GT0 D;  3LEL C;  1P3P C;  4H9S C;  3AZF B;  1P3G D;  3B0D B;  5B0Z C;  5AV9 B;  5G49 B;  3AZI B;  3UTB A;  5AY8 B;  3AZE B;  4UUZ A;  5CP6 B;  3LEL D;  3EPL A;  3EPJ A;  3UT9 A;  2F2A C;  3IP4 C;  1KX5 C;  2HIO A;  2Y2L A;  5B0Z D;  4YM6 D;  3WA9 B;  4DQY B;  4H9P A;  5CPK A;  1P3L A;  4CAY A;  3WKJ B;  3AZJ A;  1KX3 C;  3MGQ A;  4ZUX B;  1KX5 D;  4XZQ B;  3W98 C;  3B6G A;  5F99 B;  3X1U C;  1M1A C;  3AV1 D;  2BYK A;  4J8W B;  1P3F A;  3W98 D;  3UTA A;  2CV5 A;  2Y2K A;  5JRG C;  4WJ3 C;  1M1A D;  3X1U D;  3WTP A;  3AZL A;  3AYW C;  1M18 A;  3W99 B;  4UPK A;  4M6B A;  2XD1 A;  3X1V B;  3LZ1 B;  4QLC A;  3AYW D;  4J8V B;  3C1B B;  3MNN C;  4WU9 A;  5AV6 C;  5DNN C;  3LJA B;  2NQB A;  4J8X B;  5B32 A;  3AL0 C;  5GT0 A;  3WAA B;  1ZLA A;  1P3I B;  3A1K A;  3KXB A;  5BS7 A;  3A6N B;  1M19 C;  1HQ3 C;  5BO0 A;  4Z66 B;  5BNX A;  2F8N B;  4R8P A;  5BNV A;  5DNN D;  5AV6 D;  2BYM A;  4CSR A;  3AZG B;  3LEL A;  5C3I B;  4WU8 B;  4YM6 A;  2FJ7 A;  1M19 D;  1HQ3 D;  4X23 C;  3KWQ C;  2Y2N A;  5B2I B;  1WWS A;  3KUY C;  2JSS A;  5B33 C;  1BFM A;  1P3M B;  1WWI A;  1TZY B;  5B2J C;  4X23 D;  3KWQ D;  3AZK B;  1S32 B;  3R45 B;  3AV1 A;  3REH A;  3AZF C;  3B0D C;  3KUY D;  5DNM B;  4G92 B;  5B1M B;  5AV9 C;  3W98 A;  3AZI C;  1EQZ B;  5B2J D;  3NQJ B;  5AY8 C;  3AZE C;  2Y2P A;  2UWX A;  3MGR D;  5E5A B;  4ZBJ B;  5CP6 C;  3X1U A;  3WA9 C;  5AV9 D;  3AZI D;  5AY8 D;  1T3U A;  3AZE D;  3WKJ C;  4LD9 B;  1PZR A;  4H9O A;  4HGA B;  4ZUX C;  4XZQ C;  4WNN A;  1B6W A;  3AYW A;  2ARO B;  3WA9 D;  4J8U B;  2YFW B;  3C1C B;  5F99 C;  3P5J B;  3WKJ D;  1F66 B;  4J8W C;  4ZUX D;  4XZQ D;  3MGS D;  3VH6 T;  3REJ B;  1B67 A;  5AVB B;  3KFU G;  3AZM B;  5F99 D;  5AV6 A;  5DNN A;  4JJN D;  4J8W D;  3W99 C;  3TU4 B;  5GXQ A;  2Y2G A;  3A1I A;  5B1L B;  1M19 A;  3LZ0 B;  3X1V C;  1P3O B;  1BH8 B;  2PYO A;  3LZ1 C;  2BG1 A;  3W99 D;  4J8V C;  3X1T B;  3REK A;  3C1B C;  5CPJ B;  2F8N G;  3B6F D;  4H9Q A;  3X1V D;  3LJA C;  4J8X C;  2IO5 B;  4NE6 A;  4KGC A;  3WAA C;  3AZH B;  1P3I C;  3KUY A;  4J8V D;  3A6N C;  3C1B D;  4Z66 C;  5B2J A;  3LJA D;  3MGR A;  4J8X D;  3REL B;  3AZG C;  3WAA D;  4Z5T D;  5C3I C;  4WU8 C;  5CPI B;  1P3I D;  3A6N D;  5AV9 A;  4Z66 D;  2F8N D;  3AZE A;  3AZN B;  3X1S B;  4G91 B;  5B2I C;  5FUG A;  5AVC A;  3AZG D;  1P3P D;  4WU8 D;  3FDD A;  1P3M C;  1TZY C;  3WA9 A;  4Z2M G;  3AZK C;  1S32 C;  1JFI B;  4EO5 B;  4G92 C;  5DNM C;  3V9R B;  5B1M C;  4ZUX A;  4XZQ A;  1P3M D;  1TZY D;  1EQZ C;  5B31 A;  5KDM B;  3MGS A;  3AZK D;  5E5A C;  4ZBJ C;  1S32 D;  4JJN A;  1KX3 D;  5DNM D;  4J8W A;  5B1M D;  3UTB B;  2G5I C;  2NZD B;  1EQZ D;  4UUZ B;  4LD9 C;  5E5A D;  3AFA B;  2HIO B;  4HGA C;  4H9P B;  2Y2M A;  1P3B A;  2ARO C;  4J8U C;  1P3L B;  4CAY B;  3C1C C;  3B6F A;  3X1V A;  5JRG D;  3MGQ B;  4LD9 D;  1F66 C;  1AOI A;  3B6G B;  4J8V A;  2ARO D;  2F8N H;  3VH6 W;  3REJ C;  5AVB C;  5B40 A;  3C1C D;  3AZM C;  2CWE A;  3VH5 T;  3MVD A;  3LJA A;  3WAA A;  4Z5T A;  4KHA A;  3TU4 C;  1P3I A;  1P3G A;  5B1L C;  3B0C T;  3A6N A;  1ID3 B;  4H9N B;  3LZ0 C;  3REJ D;  1P3O C;  5AVB D;  3MNN D;  3AZM D;  3AZL B;  1M18 B;  3AZG A;  3F6T A;  1P3P A;  3TU4 D;  4WU8 A;  4H9S A;  3X1T C;  5B1L D;  5B0Z A;  3EPK A;  5CPJ C;  3LZ0 D;  1P3O D;  2IO5 C;  3AV2 B;  1P3A B;  3AZH C;  2Y2I A;  3X1T D;  3KSY A;  5JA4 A;  3AN2 B;  1KX5 A;  5CPJ D;  1P3M A;  1TZY A;  4Z2M H;  1P34 B;  5GT0 B;  3REL C;  3AZK A;  1ZLA B;  3R45 A;  2RVQ C;  4WV4 B;  5CPI C;  3KXB B;  5B24 B;  3AZH D;  1KX3 A;  5DNM A;  5BO0 B;  5B33 D;  5B1M A;  4R8P B;  5BNV B;  3NQJ A;  3AZN C;  3X1S C;  3REL D;  5E5A A;  4G91 C;  2RVQ D;  1M1A A;  4YM6 B;  5CPI D;  2FJ7 B;  3AZF D;  4NE5 A;  4DRB A;  2Y2Q A;  2YFV A;  4EO5 C;  5JRG A;  3AZN D;  3X1S D;  4LD9 A;  5CP6 D;  1KX4 B;  2ARO A;  2YFW A;  3W96 B;  3AV1 B;  3C1C A;  3REH B;  1ULY A;  3VH6 A;  2L5A A;  4YS3 B;  2NZD C;  3UTB C;  2LY8 A;  1H3O B;  4AWL B;  3REJ A;  3MNN A;  3AFA C;  2HIO C;  4H9R A;  4NFT A;  3REI B;  1BH9 B;  1P3K B;  2ZM5 A;  3TU4 A;  2NZD D;  3UTB D;  1P3L C;  5B1L A;  5CHL B;  5AV8 B;  3LZ0 A;  1HQ3 A;  3H0L C;  5AV5 B;  3MGQ C;  3AFA D;  4H9O B;  2ZY3 A;  2VQR A;  1TAF B;  1W2E A;  3B6G C;  4WNN B;  3X1T A;  4NE3 A;  1P3L D;  3MGP B;  3O62 B;  1U35 B;  2G5H C;  3VH5 W;  2HUE B;  4X23 A;  3MGQ D;  3KWQ A;  3LZ1 D;  3AZH A;  3B0C W;  4XUJ B;  5B33 A;  1ID3 C;  1Z2C B;  3AZL C;  3REL A;  1M18 C;  5GXQ B;  5B0Y B;  5GT3 B;  5CPI A;  3AZF A;  4KUD B;  1N1J B;  5B32 G;  1ID3 D;  5G49 A;  3AZI A;  2PYO B;  3AZL D;  3AV2 C;  5AY8 A;  1P3A C;  3AZN A;  1M18 D;  3REK B;  5CP6 A;  3AN2 C;  5GSU B;  1P34 C;  4KGC B;  5GT0 C;  1ZLA C;  3AV2 D;  1JFI A;  1P3A D;  3WKJ A;  3NQU B;  3KXB C;  5B24 C;  5B2I D;  3W97 B;  3AN2 D;  4R8P C;  3EG5 B;  3MGR B;  1P34 D;  1ZLA D;  5F99 A;  4YM6 C;  3B0B A;  5B24 D;  3KXB D;  2FJ7 C;  2NZD A;  4R8P D;  5FUG B;  5AVC B;  3AFA A;  3UT9 B;  3H0R C;  1KX4 C;  2W8S A;  2FJ7 D;  1A7W A;  3W99 A;  5CPK B;  3W96 C;  3AZJ B;  3REH C;  3AV1 C;  2JE5 A;  3VH5 A;  4YS3 C;  1KX4 D;  3LZ1 A;  5B31 B;  4WZS B;  3MGS B;  4AWL C;  4J8U D;  3C1B A;  3W96 D;  3REH D;  4JJN B;  4J8X A;  2BYK B;  1P3F B;  3REI C;  1P3K C;  4YS3 D;  1F66 D;  3UTA B;  2CV5 B;  5AV8 C;  1ID3 A;  4H9N A;  5AV5 C;  4Z66 A;  3WTP B;  2F8N A;  2RIQ A;  1P3B B;  3REI D;  1P3K D;  2J8P A;  3MGP C;  3B6F B;  3O62 C;  5AV8 D;  1U35 C;  2Y2O A;  2HUE C;  5AV5 D;  1AOI B;  3AV2 A;  4QLC B;  1P3A A;  2Y2H A;  5B2I A;  4XUJ C;  2Y2J A;  5B40 B;  3MGP D;  3AN2 A;  3O62 D;  4WU9 B;  1U35 D;  3MVD B;  1Q9C A;  3EPH A;  2NQB B;  1P34 A;  5B32 B;  2DF4 C;  4Z5T B;  4KHA B;  5GXQ C;  5B0Y C;  1S32 A;  5GT3 C;  1P3G B;  5B24 A;  4KUD C;  4XUJ D;  2DQN C;  5BNX B;  2PYO C;  3H0M C;  2BYM B;  4CSR B;  1EQZ A;  2XD5 A;  3LEL B;  1P3P B;  5GXQ D;  5B0Y D;  3REK C;  2JCH A;  5GT3 D;  5B0Z B;  4KUD D;  5GSU C;  4KGC C;  2ZY4 A;  2PYO D;  5JA4 B;  3REK D;  1KX5 B;  1KX4 A;  3W97 C;  5GSU D;  3MGR C;  4J8U A;  4KGC D;  3W96 A;  1KX3 B;  5BT1 C;  1HTA A;  3WTP E;  1F66 A;  4YS3 A;  3W98 B;  3W97 D;  1H3O A;  5AVC C;  1M1A B;  3X1U B;  5AVB A;  1F1E A;  3UT9 C;  3AZM A;  5BT1 D;  5B31 G;  2ZY5 A;  1BH9 A;  3REI A;  1P3K A;  5CPK C;  2YFV B;  5AV8 A;  3AZJ C;  4E44 A;  5AV5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...