5E5AA

Crystal structure of the chromatin-tethering domain of human cytomegalovirus ie1 protein bound to the nucleosome core particle
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
99
structure length
99
Chain Sequence
b'KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (146-MER)
publication title Human cytomegalovirus IE1 protein alters the higher-order chromatin structure by targeting the acidic patch of the nucleosome
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/viral protein/dna
total genus 30
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5e5aA00
4UUZB 5BO0A 3C1BD 1P3LB 2F8NB 1P3PC 2AROC 3AZKD 3UTAC 3AN2C 3WKJD 3KUYD 3AZMC 4YS3D 5AV9B 2NZDB 3REHC 4WU8D 3X1TC 1P3PD 4WZSB 1Q9CA 3C1BA 5E5AC 2AROD 4ZUXC 3UTAD 3AZND 3AZMD 3AZKA 5AY8D 1A7WA 3WKJA 3KUYA 3AYWC 3NQJB 3MGRC 2PYOC 3A6NB 4WU8A 5E5AD 2IO5C 1P3PA 3TU4D 2AROA 5AVCC 3UTAA 3MGQB 3REIC 5B0ZC 3AZNA 3AZMA 5AY8A 3MGRD 3WAAB 3X1TA 3VH5W 5E5AA 5JA4B 3LELC 5GT3B 4ZUXA 5AVCD 3REID 5B0ZD 1P3MD 5DNNB 5B31B 3MGRA 2PYOA 4H9RA 5B1MC 3LELD 3REJC 5CPID 1P3LC 3VH5A 5AVCA 1WWSA 1H3OB 3REIA 5B0ZA 1P3MA 4DRAA 3MVDD 1M19D 5B40D 1B67A 5B1MD 3X1VB 5AV9C 1EQZB 3REJD 1KX5B 2NZDC 2F8ND 3LELA 5AVBB 4J8VB 4KGCB 4QLCD 1P3AB 2F8NG 3LZ0B 3MVDA 1M19A 5AV9D 5B1MA 5CP6B 3A6NC 2BYMB 3REJA 4UUZA 1P3LA 2F8NA 3KXBB 2LY8A 3W99D 4JJND 4QLCA 3MGQC 5AV9A 3A6ND 2NZDA 3WAAC 4ZBJB 5GT3C 1M1AB 5B24D 5DNNC 5B31C 3NQJA 2HUEB 3A6NA 5F99B 5GT3D 4CAYB 4LD9B 4YS3B 5CPKB 3B0CT 4WU9C 4WU8B 3LJAD 3X1VC 4NE6A 1EQZC 3AZNB 2RVQC 1KX5C 1TAFA 5AY8B 5JA4A 4G91B 5GT3A 2JSSA 4WU9D 5AVBC 4J8VC 4KGCC 5DNNA 4J8UB 1P3AC 3R45B 3LZ0C 3X1VD 1EQZD 5AV8B 3TU4B 1HTAA 3O62D 5CP6C 4H9SC 5AVBD 3KXBC 4J8VD 5FUGB 1H3OA 4WU9A 3LZ0D 3X1VA 1EQZA 1P3MB 4ZBJC 3KXBD 5AVBA 3NQUB 4J8VA 1S32B 4J8WD 3AZEB 1M1AC 1P3AA 3LZ0A 5B32D 5CPIB 3AZIB 2HUEC 4H9NB 2BYMA 4H9SA 5CP6A 5F99C 3MVDB 5B32G 3KXBA 1M19B 5B40B 4Z5TB 4LD9C 4YS3C 4J8WA 5CPKC 4WU8C 1P3BB 5BS7A 5B32A 4NE3A 3AFAB 4QLCB 5F99D 3VH6W 3AZNC 3B0DB 5AY8C 4LD9D 4G91C 5CPKD 1M1AA 4J8UC 3AZFB 3W99B 5AV8C 4JJNB 3TU4C 5F99A 4CAYA 3VH6A 4LD9A 4YS3A 1N1JB 5CPKA 4J8UD 5AV8D 1KX3D 1P3MC 5AV6B 5B24B 1ULYA 4XZQD 5G49B 3AV1B 1S32C 1TAFB 1R4VA 3AZEC 4J8UA 3R45A 5CPIC 5AV8A 3TU4A 5CPJD 4HGAB 3AZIC 3LJAB 3MVDC 1M19C 5B40C 5FUGA 1S32D 4Z5TC 3AZED 4H9QB 4KUDB 5JRGB 1P3BC 4WU9B 3AZID 3AFAC 1P3OB 1ID3B 4QLCC 4J8XB 1B6WA 5BNVB 3B0DC 4Z5TD 3NQUA 2YFVB 1S32A 5DNMB 3AZEA 3O62B 5BNXB 1P3BD 1BH8A 5CPIA 3AFAD 3AZFC 3W99C 3AZIA 4H9NA 4JJNC 1P3KB 4NE5A 5B40A 4Z5TA 4H9PA 3W97D 1P3BA 3AZFD 3AFAA 4J8WB 1M18D 3AV2D 2BYKB 5B32B 5AV6C 5B24C 2NQBD 3REKD 3AV1C 3AZFA 3W99A 5AV5B 2F8NK 4JJNA 5B33D 5AV6D 4HGAC 3LJAC 2NQBA 3AV1D 1N1JA 3X1SB 1JFIA 3LZ1B 3REKA 4KUDC 5JRGC 5GT0D 1P3OC 1ID3C 5B33A 5AV6A 4J8XC 5B24A 5G49A 3AV1A 4KUDD 5DNMC 5JRGD 3O62C 3AZLD 1P3OD 1ID3D 3MNNB 3B6FB 3AZJB 4J8XD 4Z66B 3B6GB 3LJAA 1P3KC 3KWQB 5C3IB 5DNMD 1KX3B 4H9QA 4KUDA 5JRGA 3W98B 3AZLA 4KHAA 4XZQB 1P3OA 1ID3A 4J8WC 4J8XA 3AZHB 1P3KD 1KX4B 1U35D 5BNVA 5BS7C 5B32C 3C1CD 2YFVA 3RELD 5DNMA 3O62A 5CPJB 5BNXA 1TZYB 3WA9B 5GXQD 5AV5C 1F66D 1P3KA 1BH8B 1U35A 3MGPD 1P3FB 3RELA 3X1SC 4H9OB 3LZ1C 4R8PD 4H9PB 5AV5D 1P3GB 1P3IB 5B2IB 5GXQA 1F66A 3VH5T 2BYKA 4G92B 3MGPA 3MGSD 3X1SD 5BT1C 3X1UB 4AWLB 3LZ1D 2YFWA 4R8PA 3V9RA 5AV5A 3B0CW 3B6FC 3MNNC 3W97B 3AZJC 4Z66C 3B6GC 5BT1D 5KDMA 3MGSA 3KWQC 2HIOB 3X1SA 5C3IC 1M18B 4YM6B 2L5AA 1KX3C 3LZ1A 5B0YB 3AV2B 3W98C 3B6FD 3MNND 2NQBB 4WV4B 3AZJD 1JFIB 3UTBB 4XZQC 4Z66D 4X23B 3B6GD 1F1EA 3REKB 3AZHC 1KX4C 3KWQD 1P34B 5B2JB 5B33B 3W98D 4Z2MG 5CPJC 1TZYC 4WNNA 3B6FA 3MNNA 3WA9C 3AZJA 3B0BA 3AZHD 1KX4D 4Z66A 3B6GA 4EO5B 5GT0B 3KWQA 3AN2D 1P3FC 1KX3A 2CV5B 4NFTA 1AOIB 1TZYD 3W98A 3WA9D 3WTPE 3REHD 1P3GC 1P3IC 4XZQA 3WTPB 3X1TD 5B2IC 3AZHA 1KX4A 4ZUXD 3AZLB 1P3FD 4CSRB 4G92C 4KHAB 3AN2A 3AYWD 3X1UC 4AWLC 4XUJB 1TZYA 5CPJA 3UT9B 1P3GD 1P3ID 2PYOD 3WA9A 5B2ID 3REHA 3W97C 2FJ7B 1P3FA 3X1UD 2HIOC 1M18C 4H9OA 3AYWA 4YM6C 1U35B 5B0YC 3AV2C 1P3GA 1P3IA 5B2IA 3C1CB 3RELB 2NQBC 3UTBC 4X23C 3REKC 2HIOD 3X1UA 5GXQB 4YM6D 1P34C 1F66B 5B0YD 5B2JC 5B33C 3MGPB 3UTBD 4X23D 3W97A 1P3LD 2YFWB 4EO5C 4R8PB 3V9RB 1P34D 1ZLAB 5GT0C 2HIOA 1HQ3B 5B2JD 1M18A 4YM6A 2CV5C 1AOIC 5B0YA 3W96B 3AV2A 1BH9B 5KDMB 2NZDD 3MGSB 5B1LB 3AZGB 3UTBA 4X23A 3WTPC 5GSUB 3AZLC 1P34A 2CV5D 1AOID 5B2JA 5BO0B 4XUJC 3UT9C 3WTPD 1KU5A 4WNNB 5GT0A 2FJ7C 3MGQD 4E44A 2CV5A 4XUJD 1AOIA 4Z2MH 3UT9D 3C1BB 1U35C 3WAAD 1BFMA 4DRBA 3WTPA 3C1CC 3RELC 3VH6T 3AZKB 2FJ7D 3WKJB 3KUYB 4CSRA 1WWIA 3MGQA 5DNND 5GXQC 4XUJA 1F66C 1P3PB 5B31D 3UT9A 3MGPC 2AROB 3AN2B 3UTAB 3WAAA 3AZMB 5B31G 2FJ7A 2CWEA 3REHB 4R8PC 1ZLAC 3X1TB 1HQ3C 5E5AB 3W96C 5B31A 4ZUXB 2RVQD 3C1CA 1KX5D 3MGSC 5B1LC 3AZGC 3AYWB 4M6BA 5GSUC 4E45A 3MGRB 1ZLAD 2PYOB 4KGCD 4H9RB 1HQ3D 1P3AD 2IO5B 3W96D 3KSYA 5AVCB 5B1LD 3AZGD 3REIB 5B0ZB 5CP6D 1KX5A 5GSUD 1ZLAA 4KGCA 1HQ3A 3LELB 3W96A 1BH9A 3C1BC 5B1LA 3AZGA 5GSUA 3AZKC 3WKJC 3KUYC 5CHLB 5B1MB 1M1AD 3REJB 2F8NH
chains in the Genus database with same CATH superfamily
4UUZB 5BO0A 3C1BD 1P3LB 2F8NB 1P3PC 2AROC 3AZKD 3UTAC 3AN2C 3WKJD 2G5IC 2Y2LA 3KUYD 3AZMC 2VQRA 4YS3D 5AV9B 2NZDB 3REHC 4WU8D 3X1TC 1P3PD 4WZSB 1Q9CA 3C1BA 5E5AC 1Z2CB 2AROD 4ZUXC 3UTAD 3AZND 3AZMD 3AZKA 5AY8D 1A7WA 3WKJA 3KUYA 3AYWC 3H0MC 3NQJB 3MGRC 2JCHA 3A6NB 2PYOC 4WU8A 5E5AD 2IO5C 1P3PA 3TU4D 2AROA 5AVCC 3UTAA 1PZRA 3MGQB 3REIC 5B0ZC 3AZNA 3AZMA 5AY8A 3MGRD 3WAAB 3X1TA 3VH5W 5E5AA 5JA4B 3LELC 5GT3B 4ZUXA 5AVCD 3REID 5B0ZD 1P3MD 5DNNB 5B31B 3MGRA 2PYOA 4H9RA 5B1MC 3LELD 3REJC 5CPID 1P3LC 3VH5A 5AVCA 1WWSA 1H3OB 3REIA 5B0ZA 1P3MA 2Y2OA 4DRAA 3MVDD 1M19D 5B40D 1B67A 5B1MD 3X1VB 5AV9C 1EQZB 3REJD 1KX5B 2NZDC 2F8ND 3LELA 5AVBB 4J8VB 4KGCB 4QLCD 1P3AB 2F8NG 3LZ0B 3MVDA 1M19A 5AV9D 5B1MA 5CP6B 3A6NC 2BYMB 3REJA 4UUZA 1P3LA 2F8NA 3KXBB 2LY8A 3W99D 4JJND 4QLCA 3MGQC 3F6TA 5AV9A 3A6ND 2NZDA 3A1IA 3WAAC 4ZBJB 2Y2JA 5GT3C 2F2AC 1M1AB 5B24D 5DNNC 5B31C 3NQJA 2HUEB 3A6NA 5F99B 5GT3D 4CAYB 4LD9B 4YS3B 5CPKB 3B0CT 4WU9C 2G5HC 4WU8B 3LJAD 3X1VC 4NE6A 1EQZC 3AZNB 2RVQC 1KX5C 1TAFA 5AY8B 5JA4A 4G91B 5GT3A 2JSSA 4WU9D 5AVBC 4J8VC 2ZY3A 4KGCC 5DNNA 4J8UB 1P3AC 3R45B 3LZ0C 3X1VD 1EQZD 5AV8B 3TU4B 1HTAA 3O62D 5CP6C 4H9SC 5AVBD 3KXBC 4J8VD 5FUGB 1H3OA 4WU9A 3LZ0D 3X1VA 1EQZA 1P3MB 4ZBJC 3KXBD 5AVBA 3NQUB 4J8VA 1S32B 4J8WD 3AZEB 1M1AC 1P3AA 3LZ0A 5B32D 5CPIB 3AL0C 3AZIB 3EPJA 2HUEC 4H9NB 2BYMA 4H9SA 5CP6A 5F99C 3MVDB 5B32G 3KXBA 1M19B 5B40B 4Z5TB 4LD9C 4YS3C 4J8WA 5CPKC 4WU8C 1P3BB 5BS7A 5B32A 4NE3A 3AFAB 4QLCB 5F99D 3VH6W 2DF4C 3EG5B 3B0DB 3AZNC 5AY8C 4LD9D 4G91C 5CPKD 1M1AA 4J8UC 3AZFB 3W99B 3P5JB 5AV8C 4JJNB 3TU4C 5F99A 4DQYB 4CAYA 3VH6A 4LD9A 4YS3A 1N1JB 5CPKA 4J8UD 2DQNC 5AV8D 1KX3D 1P3MC 5AV6B 5B24B 1ULYA 4XZQD 5G49B 3AV1B 1S32C 1TAFB 1R4VA 3AZEC 4J8UA 4UPKA 3R45A 5CPIC 5AV8A 3TU4A 5CPJD 4HGAB 3AZIC 3LJAB 2UWXA 3MVDC 1M19C 5B40C 5FUGA 1S32D 4Z5TC 3AZED 2XD5A 4H9QB 4KUDB 5JRGB 1P3BC 4WU9B 3AZID 3AFAC 1P3OB 1ID3B 4QLCC 4J8XB 1B6WA 5BNVB 3B0DC 4Z5TD 3NQUA 2YFVB 1S32A 5DNMB 3AZEA 3O62B 5BNXB 1P3BD 1BH8A 5CPIA 3AFAD 3AZFC 3W99C 3AZIA 4H9NA 4JJNC 1P3KB 4NE5A 2Y2PA 5B40A 4Z5TA 4H9PA 3W97D 2ZY5A 1P3BA 3AZFD 3AFAA 4J8WB 1M18D 3AV2D 2BYKB 5B32B 5AV6C 5B24C 2NQBD 3REKD 3AV1C 3AZFA 3W99A 2Y2KA 5AV5B 2F8NK 4JJNA 5B33D 5AV6D 4HGAC 3LJAC 2NQBA 3AV1D 1N1JA 3X1SB 1JFIA 3LZ1B 3REKA 4KUDC 5JRGC 5GT0D 1P3OC 1ID3C 2BG1A 5B33A 5AV6A 4J8XC 5B24A 2Y2GA 5G49A 3AV1A 4KUDD 5DNMC 5JRGD 3O62C 3AZLD 2ZY2A 1P3OD 1ID3D 3MNNB 3B6FB 3AZJB 4J8XD 3EPHA 4Z66B 3B6GB 3LJAA 1P3KC 3KWQB 5C3IB 5DNMD 1KX3B 4H9QA 4KUDA 5JRGA 3EPKA 3W98B 3AZLA 2XD1A 3EPLA 4KHAA 4XZQB 1P3OA 1ID3A 4J8WC 4J8XA 3AZHB 1P3KD 1KX4B 1U35D 5BNVA 5BS7C 5B32C 3C1CD 2YFVA 3RELD 5DNMA 3O62A 5CPJB 5BNXA 1TZYB 3WA9B 5GXQD 5AV5C 1F66D 1P3KA 1BH8B 1U35A 3MGPD 3A1KA 1P3FB 3RELA 3X1SC 4H9OB 3LZ1C 4R8PD 4H9PB 5AV5D 1P3GB 2Y2HA 1P3IB 5B2IB 5GXQA 1F66A 3VH5T 2BYKA 4G92B 3MGPA 3MGSD 3X1SD 5BT1C 3X1UB 4AWLB 3LZ1D 2YFWA 4R8PA 3V9RA 5AV5A 3B0CW 3B6FC 3MNNC 3W97B 3AZJC 4Z66C 3B6GC 5BT1D 5KDMA 2ZM5A 3MGSA 3KWQC 2HIOB 3X1SA 5C3IC 1M18B 4YM6B 2L5AA 1KX3C 3LZ1A 5B0YB 3AV2B 3W98C 3B6FD 3MNND 2NQBB 4WV4B 3AZJD 1JFIB 3UTBB 4XZQC 4Z66D 4X23B 3B6GD 1F1EA 3REKB 3AZHC 1KX4C 3KWQD 1P34B 5B2JB 5B33B 3W98D 4Z2MG 5CPJC 1TZYC 4WNNA 3B6FA 3MNNA 3WA9C 3AZJA 3B0BA 2RIQA 3AZHD 1KX4D 4Z66A 3B6GA 4EO5B 5GT0B 3KWQA 3AN2D 1P3FC 1KX3A 2CV5B 4NFTA 1AOIB 1TZYD 2Y2IA 3W98A 3WA9D 3WTPE 3REHD 1P3GC 1P3IC 4XZQA 3WTPB 3X1TD 5B2IC 3AZHA 1KX4A 4ZUXD 3AZLB 1P3FD 4CSRB 4G92C 4KHAB 3IP4C 3AN2A 3AYWD 3X1UC 4AWLC 4XUJB 1TZYA 5CPJA 3UT9B 1P3GD 1P3ID 2PYOD 3WA9A 5B2ID 3REHA 3W97C 2FJ7B 2Y2QA 1P3FA 3KFUG 3X1UD 2HIOC 1M18C 4H9OA 3AYWA 4YM6C 1U35B 5B0YC 3AV2C 1P3GA 1P3IA 5B2IA 3C1CB 3RELB 2NQBC 3UTBC 4X23C 3REKC 2HIOD 3X1UA 3H0RC 5GXQB 4YM6D 1P34C 5B0YD 1F66B 5B2JC 5B33C 3MGPB 3UTBD 4X23D 3W97A 1P3LD 2YFWB 4EO5C 4R8PB 3V9RB 1P34D 1ZLAB 5GT0C 1T3UA 2HIOA 1HQ3B 5B2JD 1M18A 4YM6A 2CV5C 1AOIC 5B0YA 3W96B 3AV2A 1BH9B 5KDMB 2NZDD 3MGSB 5B1LB 3AZGB 3UTBA 4X23A 3WTPC 5GSUB 3AZLC 1P34A 2CV5D 1AOID 5B2JA 5BO0B 4XUJC 3UT9C 3WTPD 1KU5A 4WNNB 5GT0A 2FJ7C 3MGQD 4E44A 2CV5A 4XUJD 1AOIA 4Z2MH 3UT9D 3C1BB 1U35C 4WJ3C 3WAAD 1BFMA 4DRBA 3WTPA 3C1CC 3RELC 3VH6T 3AZKB 2FJ7D 3WKJB 3KUYB 4CSRA 1WWIA 3H0LC 3MGQA 5DNND 5GXQC 4XUJA 1F66C 1P3PB 5B31D 3UT9A 3MGPC 2AROB 3AN2B 3UTAB 3WAAA 3AZMB 5B31G 2FJ7A 2CWEA 3REHB 4R8PC 1ZLAC 3X1TB 1HQ3C 5E5AB 3W96C 5B31A 2W8SA 4ZUXB 2RVQD 3C1CA 1KX5D 3MGSC 5B1LC 3AZGC 3AYWB 2Y2MA 4M6BA 5GSUC 4E45A 3MGRB 1ZLAD 2PYOB 4KGCD 4H9RB 1HQ3D 1P3AD 2IO5B 3W96D 3KSYA 5AVCB 5B1LD 3AZGD 3REIB 5B0ZB 2FFFB 5CP6D 1KX5A 2JE5A 5GSUD 2Y2NA 1ZLAA 4KGCA 1HQ3A 3LELB 3W96A 2ZY4A 1BH9A 3C1BC 5B1LA 3FDDA 3AZGA 5GSUA 3AZKC 2J8PA 3WKJC 3KUYC 5CHLB 5B1MB 1M1AD 3REJB 2F8NH 1W2EA
chains in the Genus database with same CATH topology
4UUZB 5BO0A 3C1BD 1P3LB 2F8NB 1P3PC 2AROC 3AZKD 3UTAC 3AN2C 3WKJD 2G5IC 2Y2LA 3KUYD 3AZMC 2VQRA 4YS3D 5AV9B 2NZDB 3REHC 4WU8D 3X1TC 1P3PD 4WZSB 1Q9CA 3C1BA 5E5AC 1Z2CB 2AROD 4ZUXC 3UTAD 3AZND 3AZMD 3AZKA 5AY8D 1A7WA 3WKJA 3KUYA 3AYWC 3H0MC 3NQJB 3MGRC 2JCHA 3A6NB 2PYOC 4WU8A 5E5AD 2IO5C 1P3PA 3TU4D 2AROA 5AVCC 3UTAA 1PZRA 3MGQB 3REIC 5B0ZC 3AZNA 3AZMA 5AY8A 3MGRD 3WAAB 3X1TA 3VH5W 5E5AA 5JA4B 3LELC 5GT3B 4ZUXA 5AVCD 3REID 5B0ZD 1P3MD 5DNNB 5B31B 3MGRA 2PYOA 4H9RA 5B1MC 3LELD 3REJC 5CPID 1P3LC 3VH5A 5AVCA 1WWSA 1H3OB 3REIA 5B0ZA 1P3MA 2Y2OA 4DRAA 3MVDD 1M19D 5B40D 1B67A 5B1MD 3X1VB 5AV9C 1EQZB 3REJD 1KX5B 2NZDC 2F8ND 3LELA 5AVBB 4J8VB 4KGCB 4QLCD 1P3AB 2F8NG 3LZ0B 3MVDA 1M19A 5AV9D 5B1MA 5CP6B 3A6NC 2BYMB 3REJA 4UUZA 1P3LA 2F8NA 3KXBB 2LY8A 3W99D 4JJND 4QLCA 3MGQC 3F6TA 5AV9A 3A6ND 2NZDA 3A1IA 3WAAC 4ZBJB 2Y2JA 5GT3C 2F2AC 1M1AB 5B24D 5DNNC 5B31C 3NQJA 2HUEB 3A6NA 5F99B 5GT3D 4CAYB 4LD9B 4YS3B 5CPKB 3B0CT 4WU9C 2G5HC 4WU8B 3LJAD 3X1VC 4NE6A 1EQZC 3AZNB 2RVQC 1KX5C 1TAFA 5AY8B 5JA4A 4G91B 5GT3A 2JSSA 4WU9D 5AVBC 4J8VC 2ZY3A 4KGCC 5DNNA 4J8UB 1P3AC 3R45B 3LZ0C 3X1VD 1EQZD 5AV8B 3TU4B 1HTAA 3O62D 5CP6C 4H9SC 5AVBD 3KXBC 4J8VD 5FUGB 1H3OA 4WU9A 3LZ0D 3X1VA 1EQZA 1P3MB 4ZBJC 3KXBD 5AVBA 3NQUB 4J8VA 1S32B 4J8WD 3AZEB 1M1AC 1P3AA 3LZ0A 5B32D 5CPIB 3AL0C 3AZIB 3EPJA 2HUEC 4H9NB 2BYMA 4H9SA 5CP6A 5F99C 3MVDB 5B32G 3KXBA 1M19B 5B40B 4Z5TB 4LD9C 4YS3C 4J8WA 5CPKC 4WU8C 1P3BB 5BS7A 5B32A 4NE3A 3AFAB 4QLCB 5F99D 3VH6W 2DF4C 3EG5B 3B0DB 3AZNC 5AY8C 4LD9D 4G91C 5CPKD 1M1AA 4J8UC 3AZFB 3W99B 3P5JB 5AV8C 4JJNB 3TU4C 5F99A 4DQYB 4CAYA 3VH6A 4LD9A 4YS3A 1N1JB 5CPKA 4J8UD 2DQNC 5AV8D 1KX3D 1P3MC 5AV6B 5B24B 1ULYA 4XZQD 5G49B 3AV1B 1S32C 1TAFB 1R4VA 3AZEC 4J8UA 4UPKA 3R45A 5CPIC 5AV8A 3TU4A 5CPJD 4HGAB 3AZIC 3LJAB 2UWXA 3MVDC 1M19C 5B40C 5FUGA 1S32D 4Z5TC 3AZED 2XD5A 4H9QB 4KUDB 5JRGB 1P3BC 4WU9B 3AZID 3AFAC 1P3OB 1ID3B 4QLCC 4J8XB 1B6WA 5BNVB 3B0DC 4Z5TD 3NQUA 2YFVB 1S32A 5DNMB 3AZEA 3O62B 5BNXB 1P3BD 1BH8A 5CPIA 3AFAD 3AZFC 3W99C 3AZIA 4H9NA 4JJNC 1P3KB 4NE5A 2Y2PA 5B40A 4Z5TA 4H9PA 3W97D 2ZY5A 1P3BA 3AZFD 3AFAA 4J8WB 1M18D 3AV2D 2BYKB 5B32B 5AV6C 5B24C 2NQBD 3REKD 3AV1C 3AZFA 3W99A 2Y2KA 5AV5B 2F8NK 4JJNA 5B33D 5AV6D 4HGAC 3LJAC 2NQBA 3AV1D 1N1JA 3X1SB 1JFIA 3LZ1B 3REKA 4KUDC 5JRGC 5GT0D 1P3OC 1ID3C 2BG1A 5B33A 5AV6A 4J8XC 5B24A 2Y2GA 5G49A 3AV1A 4KUDD 5DNMC 5JRGD 3O62C 3AZLD 2ZY2A 1P3OD 1ID3D 3MNNB 3B6FB 3AZJB 4J8XD 3EPHA 4Z66B 3B6GB 3LJAA 1P3KC 3KWQB 5C3IB 5DNMD 1KX3B 4H9QA 4KUDA 5JRGA 3EPKA 3W98B 3AZLA 2XD1A 3EPLA 4KHAA 4XZQB 1P3OA 1ID3A 4J8WC 4J8XA 3AZHB 1P3KD 1KX4B 1U35D 5BNVA 5BS7C 5B32C 3C1CD 2YFVA 3RELD 5DNMA 3O62A 5CPJB 5BNXA 1TZYB 3WA9B 5GXQD 5AV5C 1F66D 1P3KA 1BH8B 1U35A 3MGPD 3A1KA 1P3FB 3RELA 3X1SC 4H9OB 3LZ1C 4R8PD 4H9PB 5AV5D 1P3GB 2Y2HA 1P3IB 5B2IB 5GXQA 1F66A 3VH5T 2BYKA 4G92B 3MGPA 3MGSD 3X1SD 5BT1C 3X1UB 4AWLB 3LZ1D 2YFWA 4R8PA 3V9RA 5AV5A 3B0CW 3B6FC 3MNNC 3W97B 3AZJC 4Z66C 3B6GC 5BT1D 5KDMA 2ZM5A 3MGSA 3KWQC 2HIOB 3X1SA 5C3IC 1M18B 4YM6B 2L5AA 1KX3C 3LZ1A 5B0YB 3AV2B 3W98C 3B6FD 3MNND 2NQBB 4WV4B 3AZJD 1JFIB 3UTBB 4XZQC 4Z66D 4X23B 3B6GD 1F1EA 3REKB 3AZHC 1KX4C 3KWQD 1P34B 5B2JB 5B33B 3W98D 4Z2MG 5CPJC 1TZYC 4WNNA 3B6FA 3MNNA 3WA9C 3AZJA 3B0BA 2RIQA 3AZHD 1KX4D 4Z66A 3B6GA 4EO5B 5GT0B 3KWQA 3AN2D 1P3FC 1KX3A 2CV5B 4NFTA 1AOIB 1TZYD 2Y2IA 3W98A 3WA9D 3WTPE 3REHD 1P3GC 1P3IC 4XZQA 3WTPB 3X1TD 5B2IC 3AZHA 1KX4A 4ZUXD 3AZLB 1P3FD 4CSRB 4G92C 4KHAB 3IP4C 3AN2A 3AYWD 3X1UC 4AWLC 4XUJB 1TZYA 5CPJA 3UT9B 1P3GD 1P3ID 2PYOD 3WA9A 5B2ID 3REHA 3W97C 2FJ7B 2Y2QA 1P3FA 3KFUG 3X1UD 2HIOC 1M18C 4H9OA 3AYWA 4YM6C 1U35B 5B0YC 3AV2C 1P3GA 1P3IA 5B2IA 3C1CB 3RELB 2NQBC 3UTBC 4X23C 3REKC 2HIOD 3X1UA 3H0RC 5GXQB 4YM6D 1P34C 5B0YD 1F66B 5B2JC 5B33C 3MGPB 3UTBD 4X23D 3W97A 1P3LD 2YFWB 4EO5C 4R8PB 3V9RB 1P34D 1ZLAB 5GT0C 1T3UA 2HIOA 1HQ3B 5B2JD 1M18A 4YM6A 2CV5C 1AOIC 5B0YA 3W96B 3AV2A 1BH9B 5KDMB 2NZDD 3MGSB 5B1LB 3AZGB 3UTBA 4X23A 3WTPC 5GSUB 3AZLC 1P34A 2CV5D 1AOID 5B2JA 5BO0B 4XUJC 3UT9C 3WTPD 1KU5A 4WNNB 5GT0A 2FJ7C 3MGQD 4E44A 2CV5A 4XUJD 1AOIA 4Z2MH 3UT9D 3C1BB 1U35C 4WJ3C 3WAAD 1BFMA 4DRBA 3WTPA 3C1CC 3RELC 3VH6T 3AZKB 2FJ7D 3WKJB 3KUYB 4CSRA 1WWIA 3H0LC 3MGQA 5DNND 5GXQC 4XUJA 1F66C 1P3PB 5B31D 3UT9A 3MGPC 2AROB 3AN2B 3UTAB 3WAAA 3AZMB 5B31G 2FJ7A 2CWEA 3REHB 4R8PC 1ZLAC 3X1TB 1HQ3C 5E5AB 3W96C 5B31A 2W8SA 4ZUXB 2RVQD 3C1CA 1KX5D 3MGSC 5B1LC 3AZGC 3AYWB 2Y2MA 4M6BA 5GSUC 4E45A 3MGRB 1ZLAD 2PYOB 4KGCD 4H9RB 1HQ3D 1P3AD 2IO5B 3W96D 3KSYA 5AVCB 5B1LD 3AZGD 3REIB 5B0ZB 2FFFB 5CP6D 1KX5A 2JE5A 5GSUD 2Y2NA 1ZLAA 4KGCA 1HQ3A 3LELB 3W96A 2ZY4A 1BH9A 3C1BC 5B1LA 3FDDA 3AZGA 5GSUA 3AZKC 2J8PA 3WKJC 3KUYC 5CHLB 5B1MB 1M1AD 3REJB 2F8NH 1W2EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UUZ B;  5BO0 A;  3C1B D;  1P3L B;  2F8N B;  1P3P C;  2ARO C;  3AZK D;  3UTA C;  3AN2 C;  3WKJ D;  3KUY D;  3AZM C;  4YS3 D;  5AV9 B;  2NZD B;  3REH C;  4WU8 D;  3X1T C;  1P3P D;  4WZS B;  1Q9C A;  3C1B A;  5E5A C;  2ARO D;  4ZUX C;  3UTA D;  3AZN D;  3AZM D;  3AZK A;  5AY8 D;  1A7W A;  3WKJ A;  3KUY A;  3AYW C;  3NQJ B;  3MGR C;  2PYO C;  3A6N B;  4WU8 A;  5E5A D;  2IO5 C;  1P3P A;  3TU4 D;  2ARO A;  5AVC C;  3UTA A;  3MGQ B;  3REI C;  5B0Z C;  3AZN A;  3AZM A;  5AY8 A;  3MGR D;  3WAA B;  3X1T A;  3VH5 W;  5E5A A;  5JA4 B;  3LEL C;  5GT3 B;  4ZUX A;  5AVC D;  3REI D;  5B0Z D;  1P3M D;  5DNN B;  5B31 B;  3MGR A;  2PYO A;  4H9R A;  5B1M C;  3LEL D;  3REJ C;  5CPI D;  1P3L C;  3VH5 A;  5AVC A;  1WWS A;  1H3O B;  3REI A;  5B0Z A;  1P3M A;  4DRA A;  3MVD D;  1M19 D;  5B40 D;  1B67 A;  5B1M D;  3X1V B;  5AV9 C;  1EQZ B;  3REJ D;  1KX5 B;  2NZD C;  2F8N D;  3LEL A;  5AVB B;  4J8V B;  4KGC B;  4QLC D;  1P3A B;  2F8N G;  3LZ0 B;  3MVD A;  1M19 A;  5AV9 D;  5B1M A;  5CP6 B;  3A6N C;  2BYM B;  3REJ A;  4UUZ A;  1P3L A;  2F8N A;  3KXB B;  2LY8 A;  3W99 D;  4JJN D;  4QLC A;  3MGQ C;  5AV9 A;  3A6N D;  2NZD A;  3WAA C;  4ZBJ B;  5GT3 C;  1M1A B;  5B24 D;  5DNN C;  5B31 C;  3NQJ A;  2HUE B;  3A6N A;  5F99 B;  5GT3 D;  4CAY B;  4LD9 B;  4YS3 B;  5CPK B;  3B0C T;  4WU9 C;  4WU8 B;  3LJA D;  3X1V C;  4NE6 A;  1EQZ C;  3AZN B;  2RVQ C;  1KX5 C;  1TAF A;  5AY8 B;  5JA4 A;  4G91 B;  5GT3 A;  2JSS A;  4WU9 D;  5AVB C;  4J8V C;  4KGC C;  5DNN A;  4J8U B;  1P3A C;  3R45 B;  3LZ0 C;  3X1V D;  1EQZ D;  5AV8 B;  3TU4 B;  1HTA A;  3O62 D;  5CP6 C;  4H9S C;  5AVB D;  3KXB C;  4J8V D;  5FUG B;  1H3O A;  4WU9 A;  3LZ0 D;  3X1V A;  1EQZ A;  1P3M B;  4ZBJ C;  3KXB D;  5AVB A;  3NQU B;  4J8V A;  1S32 B;  4J8W D;  3AZE B;  1M1A C;  1P3A A;  3LZ0 A;  5B32 D;  5CPI B;  3AZI B;  2HUE C;  4H9N B;  2BYM A;  4H9S A;  5CP6 A;  5F99 C;  3MVD B;  5B32 G;  3KXB A;  1M19 B;  5B40 B;  4Z5T B;  4LD9 C;  4YS3 C;  4J8W A;  5CPK C;  4WU8 C;  1P3B B;  5BS7 A;  5B32 A;  4NE3 A;  3AFA B;  4QLC B;  5F99 D;  3VH6 W;  3AZN C;  3B0D B;  5AY8 C;  4LD9 D;  4G91 C;  5CPK D;  1M1A A;  4J8U C;  3AZF B;  3W99 B;  5AV8 C;  4JJN B;  3TU4 C;  5F99 A;  4CAY A;  3VH6 A;  4LD9 A;  4YS3 A;  1N1J B;  5CPK A;  4J8U D;  5AV8 D;  1KX3 D;  1P3M C;  5AV6 B;  5B24 B;  1ULY A;  4XZQ D;  5G49 B;  3AV1 B;  1S32 C;  1TAF B;  1R4V A;  3AZE C;  4J8U A;  3R45 A;  5CPI C;  5AV8 A;  3TU4 A;  5CPJ D;  4HGA B;  3AZI C;  3LJA B;  3MVD C;  1M19 C;  5B40 C;  5FUG A;  1S32 D;  4Z5T C;  3AZE D;  4H9Q B;  4KUD B;  5JRG B;  1P3B C;  4WU9 B;  3AZI D;  3AFA C;  1P3O B;  1ID3 B;  4QLC C;  4J8X B;  1B6W A;  5BNV B;  3B0D C;  4Z5T D;  3NQU A;  2YFV B;  1S32 A;  5DNM B;  3AZE A;  3O62 B;  5BNX B;  1P3B D;  1BH8 A;  5CPI A;  3AFA D;  3AZF C;  3W99 C;  3AZI A;  4H9N A;  4JJN C;  1P3K B;  4NE5 A;  5B40 A;  4Z5T A;  4H9P A;  3W97 D;  1P3B A;  3AZF D;  3AFA A;  4J8W B;  1M18 D;  3AV2 D;  2BYK B;  5B32 B;  5AV6 C;  5B24 C;  2NQB D;  3REK D;  3AV1 C;  3AZF A;  3W99 A;  5AV5 B;  2F8N K;  4JJN A;  5B33 D;  5AV6 D;  4HGA C;  3LJA C;  2NQB A;  3AV1 D;  1N1J A;  3X1S B;  1JFI A;  3LZ1 B;  3REK A;  4KUD C;  5JRG C;  5GT0 D;  1P3O C;  1ID3 C;  5B33 A;  5AV6 A;  4J8X C;  5B24 A;  5G49 A;  3AV1 A;  4KUD D;  5DNM C;  5JRG D;  3O62 C;  3AZL D;  1P3O D;  1ID3 D;  3MNN B;  3B6F B;  3AZJ B;  4J8X D;  4Z66 B;  3B6G B;  3LJA A;  1P3K C;  3KWQ B;  5C3I B;  5DNM D;  1KX3 B;  4H9Q A;  4KUD A;  5JRG A;  3W98 B;  3AZL A;  4KHA A;  4XZQ B;  1P3O A;  1ID3 A;  4J8W C;  4J8X A;  3AZH B;  1P3K D;  1KX4 B;  1U35 D;  5BNV A;  5BS7 C;  5B32 C;  3C1C D;  2YFV A;  3REL D;  5DNM A;  3O62 A;  5CPJ B;  5BNX A;  1TZY B;  3WA9 B;  5GXQ D;  5AV5 C;  1F66 D;  1P3K A;  1BH8 B;  1U35 A;  3MGP D;  1P3F B;  3REL A;  3X1S C;  4H9O B;  3LZ1 C;  4R8P D;  4H9P B;  5AV5 D;  1P3G B;  1P3I B;  5B2I B;  5GXQ A;  1F66 A;  3VH5 T;  2BYK A;  4G92 B;  3MGP A;  3MGS D;  3X1S D;  5BT1 C;  3X1U B;  4AWL B;  3LZ1 D;  2YFW A;  4R8P A;  3V9R A;  5AV5 A;  3B0C W;  3B6F C;  3MNN C;  3W97 B;  3AZJ C;  4Z66 C;  3B6G C;  5BT1 D;  5KDM A;  3MGS A;  3KWQ C;  2HIO B;  3X1S A;  5C3I C;  1M18 B;  4YM6 B;  2L5A A;  1KX3 C;  3LZ1 A;  5B0Y B;  3AV2 B;  3W98 C;  3B6F D;  3MNN D;  2NQB B;  4WV4 B;  3AZJ D;  1JFI B;  3UTB B;  4XZQ C;  4Z66 D;  4X23 B;  3B6G D;  1F1E A;  3REK B;  3AZH C;  1KX4 C;  3KWQ D;  1P34 B;  5B2J B;  5B33 B;  3W98 D;  4Z2M G;  5CPJ C;  1TZY C;  4WNN A;  3B6F A;  3MNN A;  3WA9 C;  3AZJ A;  3B0B A;  3AZH D;  1KX4 D;  4Z66 A;  3B6G A;  4EO5 B;  5GT0 B;  3KWQ A;  3AN2 D;  1P3F C;  1KX3 A;  2CV5 B;  4NFT A;  1AOI B;  1TZY D;  3W98 A;  3WA9 D;  3WTP E;  3REH D;  1P3G C;  1P3I C;  4XZQ A;  3WTP B;  3X1T D;  5B2I C;  3AZH A;  1KX4 A;  4ZUX D;  3AZL B;  1P3F D;  4CSR B;  4G92 C;  4KHA B;  3AN2 A;  3AYW D;  3X1U C;  4AWL C;  4XUJ B;  1TZY A;  5CPJ A;  3UT9 B;  1P3G D;  1P3I D;  2PYO D;  3WA9 A;  5B2I D;  3REH A;  3W97 C;  2FJ7 B;  1P3F A;  3X1U D;  2HIO C;  1M18 C;  4H9O A;  3AYW A;  4YM6 C;  1U35 B;  5B0Y C;  3AV2 C;  1P3G A;  1P3I A;  5B2I A;  3C1C B;  3REL B;  2NQB C;  3UTB C;  4X23 C;  3REK C;  2HIO D;  3X1U A;  5GXQ B;  4YM6 D;  1P34 C;  1F66 B;  5B0Y D;  5B2J C;  5B33 C;  3MGP B;  3UTB D;  4X23 D;  3W97 A;  1P3L D;  2YFW B;  4EO5 C;  4R8P B;  3V9R B;  1P34 D;  1ZLA B;  5GT0 C;  2HIO A;  1HQ3 B;  5B2J D;  1M18 A;  4YM6 A;  2CV5 C;  1AOI C;  5B0Y A;  3W96 B;  3AV2 A;  1BH9 B;  5KDM B;  2NZD D;  3MGS B;  5B1L B;  3AZG B;  3UTB A;  4X23 A;  3WTP C;  5GSU B;  3AZL C;  1P34 A;  2CV5 D;  1AOI D;  5B2J A;  5BO0 B;  4XUJ C;  3UT9 C;  3WTP D;  1KU5 A;  4WNN B;  5GT0 A;  2FJ7 C;  3MGQ D;  4E44 A;  2CV5 A;  4XUJ D;  1AOI A;  4Z2M H;  3UT9 D;  3C1B B;  1U35 C;  3WAA D;  1BFM A;  4DRB A;  3WTP A;  3C1C C;  3REL C;  3VH6 T;  3AZK B;  2FJ7 D;  3WKJ B;  3KUY B;  4CSR A;  1WWI A;  3MGQ A;  5DNN D;  5GXQ C;  4XUJ A;  1F66 C;  1P3P B;  5B31 D;  3UT9 A;  3MGP C;  2ARO B;  3AN2 B;  3UTA B;  3WAA A;  3AZM B;  5B31 G;  2FJ7 A;  2CWE A;  3REH B;  4R8P C;  1ZLA C;  3X1T B;  1HQ3 C;  5E5A B;  3W96 C;  5B31 A;  4ZUX B;  2RVQ D;  3C1C A;  1KX5 D;  3MGS C;  5B1L C;  3AZG C;  3AYW B;  4M6B A;  5GSU C;  4E45 A;  3MGR B;  1ZLA D;  2PYO B;  4KGC D;  4H9R B;  1HQ3 D;  1P3A D;  2IO5 B;  3W96 D;  3KSY A;  5AVC B;  5B1L D;  3AZG D;  3REI B;  5B0Z B;  5CP6 D;  1KX5 A;  5GSU D;  1ZLA A;  4KGC A;  1HQ3 A;  3LEL B;  3W96 A;  1BH9 A;  3C1B C;  5B1L A;  3AZG A;  5GSU A;  3AZK C;  3WKJ C;  3KUY C;  5CHL B;  5B1M B;  1M1A D;  3REJ B;  2F8N H; 
#chains in the Genus database with same CATH topology
 4UUZ B;  5BO0 A;  3C1B D;  1P3L B;  2F8N B;  1P3P C;  2ARO C;  3AZK D;  3UTA C;  3AN2 C;  3WKJ D;  2G5I C;  2Y2L A;  3KUY D;  3AZM C;  2VQR A;  4YS3 D;  5AV9 B;  2NZD B;  3REH C;  4WU8 D;  3X1T C;  1P3P D;  4WZS B;  1Q9C A;  3C1B A;  5E5A C;  1Z2C B;  2ARO D;  4ZUX C;  3UTA D;  3AZN D;  3AZM D;  3AZK A;  5AY8 D;  1A7W A;  3WKJ A;  3KUY A;  3AYW C;  3H0M C;  3NQJ B;  3MGR C;  2JCH A;  3A6N B;  2PYO C;  4WU8 A;  5E5A D;  2IO5 C;  1P3P A;  3TU4 D;  2ARO A;  5AVC C;  3UTA A;  1PZR A;  3MGQ B;  3REI C;  5B0Z C;  3AZN A;  3AZM A;  5AY8 A;  3MGR D;  3WAA B;  3X1T A;  3VH5 W;  5E5A A;  5JA4 B;  3LEL C;  5GT3 B;  4ZUX A;  5AVC D;  3REI D;  5B0Z D;  1P3M D;  5DNN B;  5B31 B;  3MGR A;  2PYO A;  4H9R A;  5B1M C;  3LEL D;  3REJ C;  5CPI D;  1P3L C;  3VH5 A;  5AVC A;  1WWS A;  1H3O B;  3REI A;  5B0Z A;  1P3M A;  2Y2O A;  4DRA A;  3MVD D;  1M19 D;  5B40 D;  1B67 A;  5B1M D;  3X1V B;  5AV9 C;  1EQZ B;  3REJ D;  1KX5 B;  2NZD C;  2F8N D;  3LEL A;  5AVB B;  4J8V B;  4KGC B;  4QLC D;  1P3A B;  2F8N G;  3LZ0 B;  3MVD A;  1M19 A;  5AV9 D;  5B1M A;  5CP6 B;  3A6N C;  2BYM B;  3REJ A;  4UUZ A;  1P3L A;  2F8N A;  3KXB B;  2LY8 A;  3W99 D;  4JJN D;  4QLC A;  3MGQ C;  3F6T A;  5AV9 A;  3A6N D;  2NZD A;  3A1I A;  3WAA C;  4ZBJ B;  2Y2J A;  5GT3 C;  2F2A C;  1M1A B;  5B24 D;  5DNN C;  5B31 C;  3NQJ A;  2HUE B;  3A6N A;  5F99 B;  5GT3 D;  4CAY B;  4LD9 B;  4YS3 B;  5CPK B;  3B0C T;  4WU9 C;  2G5H C;  4WU8 B;  3LJA D;  3X1V C;  4NE6 A;  1EQZ C;  3AZN B;  2RVQ C;  1KX5 C;  1TAF A;  5AY8 B;  5JA4 A;  4G91 B;  5GT3 A;  2JSS A;  4WU9 D;  5AVB C;  4J8V C;  2ZY3 A;  4KGC C;  5DNN A;  4J8U B;  1P3A C;  3R45 B;  3LZ0 C;  3X1V D;  1EQZ D;  5AV8 B;  3TU4 B;  1HTA A;  3O62 D;  5CP6 C;  4H9S C;  5AVB D;  3KXB C;  4J8V D;  5FUG B;  1H3O A;  4WU9 A;  3LZ0 D;  3X1V A;  1EQZ A;  1P3M B;  4ZBJ C;  3KXB D;  5AVB A;  3NQU B;  4J8V A;  1S32 B;  4J8W D;  3AZE B;  1M1A C;  1P3A A;  3LZ0 A;  5B32 D;  5CPI B;  3AL0 C;  3AZI B;  3EPJ A;  2HUE C;  4H9N B;  2BYM A;  4H9S A;  5CP6 A;  5F99 C;  3MVD B;  5B32 G;  3KXB A;  1M19 B;  5B40 B;  4Z5T B;  4LD9 C;  4YS3 C;  4J8W A;  5CPK C;  4WU8 C;  1P3B B;  5BS7 A;  5B32 A;  4NE3 A;  3AFA B;  4QLC B;  5F99 D;  3VH6 W;  2DF4 C;  3EG5 B;  3B0D B;  3AZN C;  5AY8 C;  4LD9 D;  4G91 C;  5CPK D;  1M1A A;  4J8U C;  3AZF B;  3W99 B;  3P5J B;  5AV8 C;  4JJN B;  3TU4 C;  5F99 A;  4DQY B;  4CAY A;  3VH6 A;  4LD9 A;  4YS3 A;  1N1J B;  5CPK A;  4J8U D;  2DQN C;  5AV8 D;  1KX3 D;  1P3M C;  5AV6 B;  5B24 B;  1ULY A;  4XZQ D;  5G49 B;  3AV1 B;  1S32 C;  1TAF B;  1R4V A;  3AZE C;  4J8U A;  4UPK A;  3R45 A;  5CPI C;  5AV8 A;  3TU4 A;  5CPJ D;  4HGA B;  3AZI C;  3LJA B;  2UWX A;  3MVD C;  1M19 C;  5B40 C;  5FUG A;  1S32 D;  4Z5T C;  3AZE D;  2XD5 A;  4H9Q B;  4KUD B;  5JRG B;  1P3B C;  4WU9 B;  3AZI D;  3AFA C;  1P3O B;  1ID3 B;  4QLC C;  4J8X B;  1B6W A;  5BNV B;  3B0D C;  4Z5T D;  3NQU A;  2YFV B;  1S32 A;  5DNM B;  3AZE A;  3O62 B;  5BNX B;  1P3B D;  1BH8 A;  5CPI A;  3AFA D;  3AZF C;  3W99 C;  3AZI A;  4H9N A;  4JJN C;  1P3K B;  4NE5 A;  2Y2P A;  5B40 A;  4Z5T A;  4H9P A;  3W97 D;  2ZY5 A;  1P3B A;  3AZF D;  3AFA A;  4J8W B;  1M18 D;  3AV2 D;  2BYK B;  5B32 B;  5AV6 C;  5B24 C;  2NQB D;  3REK D;  3AV1 C;  3AZF A;  3W99 A;  2Y2K A;  5AV5 B;  2F8N K;  4JJN A;  5B33 D;  5AV6 D;  4HGA C;  3LJA C;  2NQB A;  3AV1 D;  1N1J A;  3X1S B;  1JFI A;  3LZ1 B;  3REK A;  4KUD C;  5JRG C;  5GT0 D;  1P3O C;  1ID3 C;  2BG1 A;  5B33 A;  5AV6 A;  4J8X C;  5B24 A;  2Y2G A;  5G49 A;  3AV1 A;  4KUD D;  5DNM C;  5JRG D;  3O62 C;  3AZL D;  2ZY2 A;  1P3O D;  1ID3 D;  3MNN B;  3B6F B;  3AZJ B;  4J8X D;  3EPH A;  4Z66 B;  3B6G B;  3LJA A;  1P3K C;  3KWQ B;  5C3I B;  5DNM D;  1KX3 B;  4H9Q A;  4KUD A;  5JRG A;  3EPK A;  3W98 B;  3AZL A;  2XD1 A;  3EPL A;  4KHA A;  4XZQ B;  1P3O A;  1ID3 A;  4J8W C;  4J8X A;  3AZH B;  1P3K D;  1KX4 B;  1U35 D;  5BNV A;  5BS7 C;  5B32 C;  3C1C D;  2YFV A;  3REL D;  5DNM A;  3O62 A;  5CPJ B;  5BNX A;  1TZY B;  3WA9 B;  5GXQ D;  5AV5 C;  1F66 D;  1P3K A;  1BH8 B;  1U35 A;  3MGP D;  3A1K A;  1P3F B;  3REL A;  3X1S C;  4H9O B;  3LZ1 C;  4R8P D;  4H9P B;  5AV5 D;  1P3G B;  2Y2H A;  1P3I B;  5B2I B;  5GXQ A;  1F66 A;  3VH5 T;  2BYK A;  4G92 B;  3MGP A;  3MGS D;  3X1S D;  5BT1 C;  3X1U B;  4AWL B;  3LZ1 D;  2YFW A;  4R8P A;  3V9R A;  5AV5 A;  3B0C W;  3B6F C;  3MNN C;  3W97 B;  3AZJ C;  4Z66 C;  3B6G C;  5BT1 D;  5KDM A;  2ZM5 A;  3MGS A;  3KWQ C;  2HIO B;  3X1S A;  5C3I C;  1M18 B;  4YM6 B;  2L5A A;  1KX3 C;  3LZ1 A;  5B0Y B;  3AV2 B;  3W98 C;  3B6F D;  3MNN D;  2NQB B;  4WV4 B;  3AZJ D;  1JFI B;  3UTB B;  4XZQ C;  4Z66 D;  4X23 B;  3B6G D;  1F1E A;  3REK B;  3AZH C;  1KX4 C;  3KWQ D;  1P34 B;  5B2J B;  5B33 B;  3W98 D;  4Z2M G;  5CPJ C;  1TZY C;  4WNN A;  3B6F A;  3MNN A;  3WA9 C;  3AZJ A;  3B0B A;  2RIQ A;  3AZH D;  1KX4 D;  4Z66 A;  3B6G A;  4EO5 B;  5GT0 B;  3KWQ A;  3AN2 D;  1P3F C;  1KX3 A;  2CV5 B;  4NFT A;  1AOI B;  1TZY D;  2Y2I A;  3W98 A;  3WA9 D;  3WTP E;  3REH D;  1P3G C;  1P3I C;  4XZQ A;  3WTP B;  3X1T D;  5B2I C;  3AZH A;  1KX4 A;  4ZUX D;  3AZL B;  1P3F D;  4CSR B;  4G92 C;  4KHA B;  3IP4 C;  3AN2 A;  3AYW D;  3X1U C;  4AWL C;  4XUJ B;  1TZY A;  5CPJ A;  3UT9 B;  1P3G D;  1P3I D;  2PYO D;  3WA9 A;  5B2I D;  3REH A;  3W97 C;  2FJ7 B;  2Y2Q A;  1P3F A;  3KFU G;  3X1U D;  2HIO C;  1M18 C;  4H9O A;  3AYW A;  4YM6 C;  1U35 B;  5B0Y C;  3AV2 C;  1P3G A;  1P3I A;  5B2I A;  3C1C B;  3REL B;  2NQB C;  3UTB C;  4X23 C;  3REK C;  2HIO D;  3X1U A;  3H0R C;  5GXQ B;  4YM6 D;  1P34 C;  5B0Y D;  1F66 B;  5B2J C;  5B33 C;  3MGP B;  3UTB D;  4X23 D;  3W97 A;  1P3L D;  2YFW B;  4EO5 C;  4R8P B;  3V9R B;  1P34 D;  1ZLA B;  5GT0 C;  1T3U A;  2HIO A;  1HQ3 B;  5B2J D;  1M18 A;  4YM6 A;  2CV5 C;  1AOI C;  5B0Y A;  3W96 B;  3AV2 A;  1BH9 B;  5KDM B;  2NZD D;  3MGS B;  5B1L B;  3AZG B;  3UTB A;  4X23 A;  3WTP C;  5GSU B;  3AZL C;  1P34 A;  2CV5 D;  1AOI D;  5B2J A;  5BO0 B;  4XUJ C;  3UT9 C;  3WTP D;  1KU5 A;  4WNN B;  5GT0 A;  2FJ7 C;  3MGQ D;  4E44 A;  2CV5 A;  4XUJ D;  1AOI A;  4Z2M H;  3UT9 D;  3C1B B;  1U35 C;  4WJ3 C;  3WAA D;  1BFM A;  4DRB A;  3WTP A;  3C1C C;  3REL C;  3VH6 T;  3AZK B;  2FJ7 D;  3WKJ B;  3KUY B;  4CSR A;  1WWI A;  3H0L C;  3MGQ A;  5DNN D;  5GXQ C;  4XUJ A;  1F66 C;  1P3P B;  5B31 D;  3UT9 A;  3MGP C;  2ARO B;  3AN2 B;  3UTA B;  3WAA A;  3AZM B;  5B31 G;  2FJ7 A;  2CWE A;  3REH B;  4R8P C;  1ZLA C;  3X1T B;  1HQ3 C;  5E5A B;  3W96 C;  5B31 A;  2W8S A;  4ZUX B;  2RVQ D;  3C1C A;  1KX5 D;  3MGS C;  5B1L C;  3AZG C;  3AYW B;  2Y2M A;  4M6B A;  5GSU C;  4E45 A;  3MGR B;  1ZLA D;  2PYO B;  4KGC D;  4H9R B;  1HQ3 D;  1P3A D;  2IO5 B;  3W96 D;  3KSY A;  5AVC B;  5B1L D;  3AZG D;  3REI B;  5B0Z B;  2FFF B;  5CP6 D;  1KX5 A;  2JE5 A;  5GSU D;  2Y2N A;  1ZLA A;  4KGC A;  1HQ3 A;  3LEL B;  3W96 A;  2ZY4 A;  1BH9 A;  3C1B C;  5B1L A;  3FDD A;  3AZG A;  5GSU A;  3AZK C;  2J8P A;  3WKJ C;  3KUY C;  5CHL B;  5B1M B;  1M1A D;  3REJ B;  2F8N H;  1W2E A; 
#chains in the Genus database with same CATH homology
 4UUZ B;  5BO0 A;  3C1B D;  1P3L B;  2F8N B;  1P3P C;  2ARO C;  3AZK D;  3UTA C;  3AN2 C;  3WKJ D;  2G5I C;  2Y2L A;  3KUY D;  3AZM C;  2VQR A;  4YS3 D;  5AV9 B;  2NZD B;  3REH C;  4WU8 D;  3X1T C;  1P3P D;  4WZS B;  1Q9C A;  3C1B A;  5E5A C;  1Z2C B;  2ARO D;  4ZUX C;  3UTA D;  3AZN D;  3AZM D;  3AZK A;  5AY8 D;  1A7W A;  3WKJ A;  3KUY A;  3AYW C;  3H0M C;  3NQJ B;  3MGR C;  2JCH A;  3A6N B;  2PYO C;  4WU8 A;  5E5A D;  2IO5 C;  1P3P A;  3TU4 D;  2ARO A;  5AVC C;  3UTA A;  1PZR A;  3MGQ B;  3REI C;  5B0Z C;  3AZN A;  3AZM A;  5AY8 A;  3MGR D;  3WAA B;  3X1T A;  3VH5 W;  5E5A A;  5JA4 B;  3LEL C;  5GT3 B;  4ZUX A;  5AVC D;  3REI D;  5B0Z D;  1P3M D;  5DNN B;  5B31 B;  3MGR A;  2PYO A;  4H9R A;  5B1M C;  3LEL D;  3REJ C;  5CPI D;  1P3L C;  3VH5 A;  5AVC A;  1WWS A;  1H3O B;  3REI A;  5B0Z A;  1P3M A;  2Y2O A;  4DRA A;  3MVD D;  1M19 D;  5B40 D;  1B67 A;  5B1M D;  3X1V B;  5AV9 C;  1EQZ B;  3REJ D;  1KX5 B;  2NZD C;  2F8N D;  3LEL A;  5AVB B;  4J8V B;  4KGC B;  4QLC D;  1P3A B;  2F8N G;  3LZ0 B;  3MVD A;  1M19 A;  5AV9 D;  5B1M A;  5CP6 B;  3A6N C;  2BYM B;  3REJ A;  4UUZ A;  1P3L A;  2F8N A;  3KXB B;  2LY8 A;  3W99 D;  4JJN D;  4QLC A;  3MGQ C;  3F6T A;  5AV9 A;  3A6N D;  2NZD A;  3A1I A;  3WAA C;  4ZBJ B;  2Y2J A;  5GT3 C;  2F2A C;  1M1A B;  5B24 D;  5DNN C;  5B31 C;  3NQJ A;  2HUE B;  3A6N A;  5F99 B;  5GT3 D;  4CAY B;  4LD9 B;  4YS3 B;  5CPK B;  3B0C T;  4WU9 C;  2G5H C;  4WU8 B;  3LJA D;  3X1V C;  4NE6 A;  1EQZ C;  3AZN B;  2RVQ C;  1KX5 C;  1TAF A;  5AY8 B;  5JA4 A;  4G91 B;  5GT3 A;  2JSS A;  4WU9 D;  5AVB C;  4J8V C;  2ZY3 A;  4KGC C;  5DNN A;  4J8U B;  1P3A C;  3R45 B;  3LZ0 C;  3X1V D;  1EQZ D;  5AV8 B;  3TU4 B;  1HTA A;  3O62 D;  5CP6 C;  4H9S C;  5AVB D;  3KXB C;  4J8V D;  5FUG B;  1H3O A;  4WU9 A;  3LZ0 D;  3X1V A;  1EQZ A;  1P3M B;  4ZBJ C;  3KXB D;  5AVB A;  3NQU B;  4J8V A;  1S32 B;  4J8W D;  3AZE B;  1M1A C;  1P3A A;  3LZ0 A;  5B32 D;  5CPI B;  3AL0 C;  3AZI B;  3EPJ A;  2HUE C;  4H9N B;  2BYM A;  4H9S A;  5CP6 A;  5F99 C;  3MVD B;  5B32 G;  3KXB A;  1M19 B;  5B40 B;  4Z5T B;  4LD9 C;  4YS3 C;  4J8W A;  5CPK C;  4WU8 C;  1P3B B;  5BS7 A;  5B32 A;  4NE3 A;  3AFA B;  4QLC B;  5F99 D;  3VH6 W;  2DF4 C;  3EG5 B;  3B0D B;  3AZN C;  5AY8 C;  4LD9 D;  4G91 C;  5CPK D;  1M1A A;  4J8U C;  3AZF B;  3W99 B;  3P5J B;  5AV8 C;  4JJN B;  3TU4 C;  5F99 A;  4DQY B;  4CAY A;  3VH6 A;  4LD9 A;  4YS3 A;  1N1J B;  5CPK A;  4J8U D;  2DQN C;  5AV8 D;  1KX3 D;  1P3M C;  5AV6 B;  5B24 B;  1ULY A;  4XZQ D;  5G49 B;  3AV1 B;  1S32 C;  1TAF B;  1R4V A;  3AZE C;  4J8U A;  4UPK A;  3R45 A;  5CPI C;  5AV8 A;  3TU4 A;  5CPJ D;  4HGA B;  3AZI C;  3LJA B;  2UWX A;  3MVD C;  1M19 C;  5B40 C;  5FUG A;  1S32 D;  4Z5T C;  3AZE D;  2XD5 A;  4H9Q B;  4KUD B;  5JRG B;  1P3B C;  4WU9 B;  3AZI D;  3AFA C;  1P3O B;  1ID3 B;  4QLC C;  4J8X B;  1B6W A;  5BNV B;  3B0D C;  4Z5T D;  3NQU A;  2YFV B;  1S32 A;  5DNM B;  3AZE A;  3O62 B;  5BNX B;  1P3B D;  1BH8 A;  5CPI A;  3AFA D;  3AZF C;  3W99 C;  3AZI A;  4H9N A;  4JJN C;  1P3K B;  4NE5 A;  2Y2P A;  5B40 A;  4Z5T A;  4H9P A;  3W97 D;  2ZY5 A;  1P3B A;  3AZF D;  3AFA A;  4J8W B;  1M18 D;  3AV2 D;  2BYK B;  5B32 B;  5AV6 C;  5B24 C;  2NQB D;  3REK D;  3AV1 C;  3AZF A;  3W99 A;  2Y2K A;  5AV5 B;  2F8N K;  4JJN A;  5B33 D;  5AV6 D;  4HGA C;  3LJA C;  2NQB A;  3AV1 D;  1N1J A;  3X1S B;  1JFI A;  3LZ1 B;  3REK A;  4KUD C;  5JRG C;  5GT0 D;  1P3O C;  1ID3 C;  2BG1 A;  5B33 A;  5AV6 A;  4J8X C;  5B24 A;  2Y2G A;  5G49 A;  3AV1 A;  4KUD D;  5DNM C;  5JRG D;  3O62 C;  3AZL D;  2ZY2 A;  1P3O D;  1ID3 D;  3MNN B;  3B6F B;  3AZJ B;  4J8X D;  3EPH A;  4Z66 B;  3B6G B;  3LJA A;  1P3K C;  3KWQ B;  5C3I B;  5DNM D;  1KX3 B;  4H9Q A;  4KUD A;  5JRG A;  3EPK A;  3W98 B;  3AZL A;  2XD1 A;  3EPL A;  4KHA A;  4XZQ B;  1P3O A;  1ID3 A;  4J8W C;  4J8X A;  3AZH B;  1P3K D;  1KX4 B;  1U35 D;  5BNV A;  5BS7 C;  5B32 C;  3C1C D;  2YFV A;  3REL D;  5DNM A;  3O62 A;  5CPJ B;  5BNX A;  1TZY B;  3WA9 B;  5GXQ D;  5AV5 C;  1F66 D;  1P3K A;  1BH8 B;  1U35 A;  3MGP D;  3A1K A;  1P3F B;  3REL A;  3X1S C;  4H9O B;  3LZ1 C;  4R8P D;  4H9P B;  5AV5 D;  1P3G B;  2Y2H A;  1P3I B;  5B2I B;  5GXQ A;  1F66 A;  3VH5 T;  2BYK A;  4G92 B;  3MGP A;  3MGS D;  3X1S D;  5BT1 C;  3X1U B;  4AWL B;  3LZ1 D;  2YFW A;  4R8P A;  3V9R A;  5AV5 A;  3B0C W;  3B6F C;  3MNN C;  3W97 B;  3AZJ C;  4Z66 C;  3B6G C;  5BT1 D;  5KDM A;  2ZM5 A;  3MGS A;  3KWQ C;  2HIO B;  3X1S A;  5C3I C;  1M18 B;  4YM6 B;  2L5A A;  1KX3 C;  3LZ1 A;  5B0Y B;  3AV2 B;  3W98 C;  3B6F D;  3MNN D;  2NQB B;  4WV4 B;  3AZJ D;  1JFI B;  3UTB B;  4XZQ C;  4Z66 D;  4X23 B;  3B6G D;  1F1E A;  3REK B;  3AZH C;  1KX4 C;  3KWQ D;  1P34 B;  5B2J B;  5B33 B;  3W98 D;  4Z2M G;  5CPJ C;  1TZY C;  4WNN A;  3B6F A;  3MNN A;  3WA9 C;  3AZJ A;  3B0B A;  2RIQ A;  3AZH D;  1KX4 D;  4Z66 A;  3B6G A;  4EO5 B;  5GT0 B;  3KWQ A;  3AN2 D;  1P3F C;  1KX3 A;  2CV5 B;  4NFT A;  1AOI B;  1TZY D;  2Y2I A;  3W98 A;  3WA9 D;  3WTP E;  3REH D;  1P3G C;  1P3I C;  4XZQ A;  3WTP B;  3X1T D;  5B2I C;  3AZH A;  1KX4 A;  4ZUX D;  3AZL B;  1P3F D;  4CSR B;  4G92 C;  4KHA B;  3IP4 C;  3AN2 A;  3AYW D;  3X1U C;  4AWL C;  4XUJ B;  1TZY A;  5CPJ A;  3UT9 B;  1P3G D;  1P3I D;  2PYO D;  3WA9 A;  5B2I D;  3REH A;  3W97 C;  2FJ7 B;  2Y2Q A;  1P3F A;  3KFU G;  3X1U D;  2HIO C;  1M18 C;  4H9O A;  3AYW A;  4YM6 C;  1U35 B;  5B0Y C;  3AV2 C;  1P3G A;  1P3I A;  5B2I A;  3C1C B;  3REL B;  2NQB C;  3UTB C;  4X23 C;  3REK C;  2HIO D;  3X1U A;  3H0R C;  5GXQ B;  4YM6 D;  1P34 C;  5B0Y D;  1F66 B;  5B2J C;  5B33 C;  3MGP B;  3UTB D;  4X23 D;  3W97 A;  1P3L D;  2YFW B;  4EO5 C;  4R8P B;  3V9R B;  1P34 D;  1ZLA B;  5GT0 C;  1T3U A;  2HIO A;  1HQ3 B;  5B2J D;  1M18 A;  4YM6 A;  2CV5 C;  1AOI C;  5B0Y A;  3W96 B;  3AV2 A;  1BH9 B;  5KDM B;  2NZD D;  3MGS B;  5B1L B;  3AZG B;  3UTB A;  4X23 A;  3WTP C;  5GSU B;  3AZL C;  1P34 A;  2CV5 D;  1AOI D;  5B2J A;  5BO0 B;  4XUJ C;  3UT9 C;  3WTP D;  1KU5 A;  4WNN B;  5GT0 A;  2FJ7 C;  3MGQ D;  4E44 A;  2CV5 A;  4XUJ D;  1AOI A;  4Z2M H;  3UT9 D;  3C1B B;  1U35 C;  4WJ3 C;  3WAA D;  1BFM A;  4DRB A;  3WTP A;  3C1C C;  3REL C;  3VH6 T;  3AZK B;  2FJ7 D;  3WKJ B;  3KUY B;  4CSR A;  1WWI A;  3H0L C;  3MGQ A;  5DNN D;  5GXQ C;  4XUJ A;  1F66 C;  1P3P B;  5B31 D;  3UT9 A;  3MGP C;  2ARO B;  3AN2 B;  3UTA B;  3WAA A;  3AZM B;  5B31 G;  2FJ7 A;  2CWE A;  3REH B;  4R8P C;  1ZLA C;  3X1T B;  1HQ3 C;  5E5A B;  3W96 C;  5B31 A;  2W8S A;  4ZUX B;  2RVQ D;  3C1C A;  1KX5 D;  3MGS C;  5B1L C;  3AZG C;  3AYW B;  2Y2M A;  4M6B A;  5GSU C;  4E45 A;  3MGR B;  1ZLA D;  2PYO B;  4KGC D;  4H9R B;  1HQ3 D;  1P3A D;  2IO5 B;  3W96 D;  3KSY A;  5AVC B;  5B1L D;  3AZG D;  3REI B;  5B0Z B;  2FFF B;  5CP6 D;  1KX5 A;  2JE5 A;  5GSU D;  2Y2N A;  1ZLA A;  4KGC A;  1HQ3 A;  3LEL B;  3W96 A;  2ZY4 A;  1BH9 A;  3C1B C;  5B1L A;  3FDD A;  3AZG A;  5GSU A;  3AZK C;  2J8P A;  3WKJ C;  3KUY C;  5CHL B;  5B1M B;  1M1A D;  3REJ B;  2F8N H;  1W2E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...