4WU8B

Structure of trptnap-ncp145
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
82
structure length
82
Chain Sequence
VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (145-MER)
publication title Stereochemical control of nucleosome targeting by platinum-intercalator antitumor agents.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 27
structure length 82
sequence length 82
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4wu8B00
3W96C 5GXQA 3MGSB 3A6NC 3LJAB 3WKJC 3W98A 2NQBD 5KDMB 3R45A 3MGPB 4H9QA 3AZGB 5CPJD 3LZ0D 1BFMA 3WTPC 1P3LC 3UTAA 4ZUXA 3V9RB 3AZED 3X1SC 1P34D 3W97A 4J8VD 3AZNB 2PYOC 3W96A 4YM6B 5G49B 3AZIB 1M1AA 3X1VD 5F99A 1KX5B 3AZJB 4J8WB 4HGAC 3MGSD 3LJAD 1H3OB 5B31B 3AV1C 3MGPD 4Z2MG 3X1VC 4KUDC 3AN2B 1TZYB 3AZGD 2NQBA 3MGSC 3LJAC 3MGPC 3AFAB 3AZND 5CPJA 3LZ0A 4YM6D 3AZID 4WNNA 3AZLC 1P34A 1KX5D 4J8VA 1P3FB 3AZJD 4J8WD 3REHC 1M18B 5B1MC 5B31D 3X1VA 4YM6C 5AV6C 1AOIB 3MGSA 3AN2D 3LJAA 1TZYD 1HQ3B 5KDMA 3UTBB 3MGPA 5AY8C 3AFAD 3AZGA 3VH6A 1TZYC 5E5AB 3KXBC 3V9RA 3AV2B 1P3FD 3AZNA 5B2IC 4YM6A 5G49A 3AZIA 1M18D 4DRAA 1KX5A 3AZJA 5GT3B 4J8WA 1AOID 3MGRB 1P3FC 1H3OA 1HQ3D 4CSRB 5B31A 4XUJB 3UTBD 1M18C 2YFVB 3AN2A 4KGCB 1TZYA 2CWEA 3RELB 5B0YC 5E5AD 5CPID 3AV2D 3AFAA 2YFWB 2F8NG 5JRGB 3LZ1B 4JJNB 1P3FA 5GT3D 3MGRD 5AV9B 3AV2C 5B1LC 1M18A 4XUJD 5JA4B 1AOIA 4KGCD 3KUYB 3RELD 1HQ3A 3UTBA 2FJ7C 3REKB 4XUJC 5JRGD 1F66C 3LZ1D 4KGCC 5E5AA 4JJND 5BO0B 3VH5A 3AV2A 4DRBA 3MNNB 5CP6C 5BS7C 4LD9B 3C1BC 5AV9D 3B6GC 1EQZB 3B0CT 5GT3A 3MGRA 3KUYD 4CSRA 4XUJA 5AV9C 4X23C 2YFVA 3REKD 2CV5B 3AZFB 4KGCA 3RELA 1P3MB 2AROB 3MNND 3REKC 2YFWA 3TU4C 4H9SA 5JRGA 1KX3B 3LZ1A 4LD9D 4JJNA 4E44A 1EQZD 5DNNB 4H9PB 5AV9A 5JA4A 1P3BB 2CV5D 3AZFD 4UUZB 1EQZC 3KUYA 2F8NB 5GXQC 3REKA 1P3MD 2AROD 5BNVB 1KX3D 5BO0A 3WTPE 5B32G 5DNMB 3MNNA 5DNND 3AZEB 4LD9A 4ZUXC 1P3BD 1EQZA 3W97C 2NZDB 1M1AC 2F8ND 5DNNC 1N1JB 1P3AB 5F99C 4WZSB 3AZKB 2CV5A 3AZFA 5AVBB 5B0ZB 4WU8B 5FUGB 1P3MA 2AROA 3B0CW 5DNMD 4R8PB 4J8UB 2NQBC 1KX3A 1ID3B 3WA9B 1TAFB 2NZDD 2IO5B 5DNNA 3LZ0C 4G92C 4H9PA 5CPJC 5GT0B 3AZEC 1P3AD 4Z2MH 1P3BA 1P34C 4J8VC 5B40B 3AZKD 4G91B 4UUZA 5AVBD 5B0ZD 2LY8A 4WU8D 4YS3B 2F8NA 1P3AC 4R8PD 5BNVA 4J8UD 5AVBC 2HIOB 1HTAA 3AZMB 1ID3D 3WA9D 5DNMA 3AZGC 3AZEA 5GT0D 2NZDA 3WA9C 5B40D 3AZNC 3AZIC 2IO5C 4NE3A 1N1JA 4XZQB 4YS3D 1P3AA 1KX5C 5GT0C 3AZJC 5B24B 1KU5A 5B32B 4J8WC 3AZKA 5AVBA 5B0ZA 4WU8A 5FUGA 3REIB 3UT9B 5B40C 5B31C 3AYWB 2HIOD 5BNXB 3AZMD 1BH8B 1WWIA 4R8PA 4J8UA 3AN2C 5CPIB 1S32B 1ID3A 3WA9A 1TAFA 3AFAC 1ULYA 1KX4B 5GT0A 4XZQD 4ZBJB 5AVCB 5B40A 5B24D 5B32D 3REID 3UT9D 3AYWD 4YS3A 3NQUB 4XZQC 1AOIC 2F8NH 2BYKB 1HQ3C 5B32C 3UTBC 2HIOA 3AZMA 3AYWC 1S32D 1M19B 1KX4D 5E5AC 5CPIC 4WV4B 1S32C 5AVCD 3X1UB 1P3KB 4J8XB 4XZQA 5C3IB 2L5AA 5GT3C 5B24A 5B32A 3MGRC 3REIA 3UT9A 3AYWA 1P3ID 5BNXA 1BH8A 3RELC 1M19D 5CPIA 1S32A 4KHAB 4AWLB 3X1UD 4H9SC 5JRGC 3LZ1C 1P3GB 1KX4A 4JJNC 1P3KD 4J8XD 1F1EA 3KSYA 3W99B 3REJB 3AZHB 5AVCA 3NQUA 3KUYC 2BYKA 5B2JB 4H9RB 5AV8B 1M19A 1P3GD 3W99D 5B33B 4CAYB 3B0BA 5GSUB 3X1UA 3MNNC 3REJD 3AZHD 4LD9C 4WU9B 1P3KA 4J8XA 1P3GC 1P3PB 5CPKB 5AV5B 3REJC 4E45A 5B2JD 3KWQB 3AZFC 4H9OB 5AV8D 2CV5C 4EO5B 4KHAA 1P3MC 2AROC 5B33D 5GSUD 1KX3C 1P3GA 1U35B 4WU9D 1P3PD 1ZLAB 3W99A 3REJA 3AZHA 5CPKD 3A6NB 5AV5D 5B33C 3WKJB 1P3BC 3C1CB 1P3PC 4NFTA 1A7WA 3KWQD 2JSSA 3WTPB 5B2JA 1P3LB 4H9RA 3X1SB 4Z66B 5BT1D 5AV8A 2PYOB 3KWQC 3VH6T 1U35D 5DNMC 5B33A 4CAYA 5GSUA 1ZLAD 3A6ND 3WKJD 4WU9A 3MGQB 1P3PA 1B6WA 3AV1B 3C1CD 2NZDC 5CPKA 4KUDB 3X1TB 5AV5A 1ZLAC 3WTPD 1P3LD 3X1SD 4Z66D 3AZKC 3MVDB 3KWQA 3C1CC 4H9OA 5B0ZC 4WU8C 2PYOD 3B6FB 1JFIB 3AZLB 4R8PC 4J8UC 4Z66C 3REHB 1U35A 3MGQD 1ID3C 5B1MB 3AV1D 1ZLAA 5AV6B 4KUDD 3X1TD 3A6NA 3WKJA 3MGQC 3C1CA 5AY8B 3MVDD 4G91C 4YS3C 3X1TC 3WTPA 3KXBB 1P3LA 3B6FD 3X1SA 3AZLD 4Z66A 2PYOA 3MVDC 3REHD 5B2IB 2RVQD 2HIOC 3AZMC 5B1MD 3VH5T 3B6FC 5AV6D 3MGQA 3AV1A 2RVQC 5CHLB 5AY8D 4KUDA 3X1TA 3VH6W 5B0YB 4Z5TB 3KXBD 5B24C 3MVDA 3LELB 1P3IB 3REIC 3UT9C 5B2ID 3B6FA 1JFIA 3AZLA 3REHA 5B1LB 5B1MA 5AV6A 4M6BA 1KX4C 4H9NB 5B0YD 4Z5TD 2FJ7B 4ZBJC 5AY8A 5AVCC 4QLCB 3LELD 1F66B 3KXBA 3B0DB 3WAAB 4Z5TC 5CP6B 3LELC 3C1BB 5B2IA 1P3IC 5B1LD 3B6GB 1M19C 1WWSA 2FJ7D 4X23B 3NQJB 4QLCD 3X1UC 5B0YA 1P3KC 2BYMB 4Z5TA 4J8XC 5C3IC 4NE5A 1F66D 3VH5W 3WAAD 3O62B 3LELA 3TU4B 1P3IA 1P3OB 4QLCC 5CP6D 3C1BD 2HUEB 3B6GD 3B0DC 3WAAC 4NE6A 2F8NK 5B1LA 1B67A 4AWLC 1BH9B 4X23D 4H9NA 5GXQB 2FJ7A 3W99C 3AZHC 4QLCA 3O62D 3TU4D 3W98B 1P3OD 1F66A 3R45B 4H9QB 3WAAA 5CP6A 5BS7A 3O62C 3C1BA 5B31G 5B2JC 1P3OC 3UTAB 4ZUXB 3B6GA 2HUEC 5AV8C 3W97B 3W96B 1M1AB 5F99B 5GXQD 4X23A 5GSUC 3NQJA 3W98D 4WU9C 1R4VA 2BYMA 5CPKC 1Q9CA 3O62A 5AV5C 3TU4A 1P3OA 2NQBB 3W98C 3UTAD 4ZUXD 3W97D 4EO5C 5CPJB 3LZ0B 4G92B 3W96D 1M1AD 4WNNB 1BH9A 5F99D 5BT1C 4HGAB 1P34B 3UTAC 4J8VB 1U35C 3X1VB
chains in the Genus database with same CATH superfamily
3W96C 5GXQA 2Y2IA 3MGSB 3A6NC 3LJAB 3WKJC 3W98A 2NQBD 5KDMB 3R45A 3MGPB 4H9QA 3AZGB 5CPJD 3LZ0D 1BFMA 3WTPC 1P3LC 3UTAA 4ZUXA 3V9RB 3AZED 3X1SC 1P34D 3W97A 4J8VD 2Y2HA 3AZNB 2PYOC 3W96A 4YM6B 5G49B 3H0MC 3AZIB 1M1AA 3X1VD 5F99A 1KX5B 3AZJB 4J8WB 4HGAC 3MGSD 3LJAD 1H3OB 3EPJA 5B31B 3AV1C 3MGPD 4Z2MG 3X1VC 4KUDC 3AN2B 1TZYB 3AZGD 2NQBA 3MGSC 3LJAC 3MGPC 3AFAB 3AZND 5CPJA 3LZ0A 4YM6D 3AZID 4WNNA 3AZLC 1P34A 1KX5D 4J8VA 1P3FB 3AZJD 4J8WD 3REHC 1M18B 5B1MC 5B31D 3X1VA 2ZY3A 4YM6C 5AV6C 1AOIB 3MGSA 3AN2D 3LJAA 1TZYD 1HQ3B 5KDMA 3UTBB 3MGPA 5AY8C 3AFAD 3AZGA 3VH6A 2RIQA 1TZYC 5E5AB 3KXBC 3V9RA 3AV2B 3EPLA 1P3FD 3AZNA 5B2IC 4YM6A 5G49A 3AZIA 1M18D 4DRAA 1KX5A 3AZJA 5GT3B 4J8WA 1AOID 3MGRB 1P3FC 1H3OA 1HQ3D 4CSRB 5B31A 4XUJB 3UTBD 1M18C 2YFVB 3AN2A 4KGCB 1TZYA 2CWEA 3A1KA 3RELB 5B0YC 5E5AD 5CPID 3AV2D 3AFAA 2YFWB 2F8NG 5JRGB 3LZ1B 4JJNB 2ZM5A 1P3FA 5GT3D 3MGRD 5AV9B 3AV2C 5B1LC 1M18A 4XUJD 5JA4B 1AOIA 4KGCD 1W2EA 3IP4C 3KUYB 3RELD 1HQ3A 2J8PA 3UTBA 2FJ7C 2W8SA 3REKB 4XUJC 4UPKA 5JRGD 1F66C 3LZ1D 4KGCC 5E5AA 4JJND 5BO0B 3VH5A 3AV2A 4DRBA 3MNNB 5CP6C 5BS7C 4LD9B 3C1BC 5AV9D 3B6GC 1EQZB 3B0CT 5GT3A 3MGRA 3KUYD 4CSRA 4XUJA 5AV9C 4X23C 2YFVA 3REKD 2CV5B 3AZFB 4KGCA 3RELA 2Y2NA 1P3MB 2AROB 3MNND 3REKC 2YFWA 3TU4C 4H9SA 5JRGA 1KX3B 3LZ1A 4LD9D 4JJNA 2G5IC 4E44A 3EPKA 1EQZD 5DNNB 4H9PB 5AV9A 5JA4A 1P3BB 2CV5D 3AZFD 4UUZB 1EQZC 3KUYA 2F8NB 5GXQC 3REKA 1P3MD 2AROD 5BNVB 1KX3D 2ZY2A 5BO0A 4DQYB 3WTPE 5B32G 5DNMB 3MNNA 2BG1A 5DNND 3AZEB 4LD9A 4ZUXC 1P3BD 1EQZA 3W97C 2NZDB 1M1AC 2F8ND 4WJ3C 5DNNC 1N1JB 1P3AB 5F99C 4WZSB 3AZKB 2Y2QA 2CV5A 3AZFA 5AVBB 5B0ZB 4WU8B 5FUGB 1P3MA 2AROA 3B0CW 3H0LC 5DNMD 4R8PB 4J8UB 2NQBC 1KX3A 1ID3B 3WA9B 1T3UA 1TAFB 2Y2GA 2NZDD 2IO5B 5DNNA 3LZ0C 4G92C 4H9PA 5CPJC 5GT0B 3AZEC 1P3AD 4Z2MH 1P3BA 1P34C 4J8VC 5B40B 3AZKD 4G91B 4UUZA 5AVBD 5B0ZD 2LY8A 4WU8D 4YS3B 2F8NA 1P3AC 4R8PD 5BNVA 4J8UD 5AVBC 2HIOB 1HTAA 3AZMB 1ID3D 3WA9D 5DNMA 3AZGC 3AZEA 3F6TA 5GT0D 2NZDA 3WA9C 5B40D 3AZNC 3AZIC 2IO5C 4NE3A 1N1JA 4XZQB 4YS3D 1P3AA 1KX5C 5GT0C 3AZJC 5B24B 1KU5A 5B32B 4J8WC 3AZKA 5AVBA 5B0ZA 4WU8A 5FUGA 3REIB 3UT9B 5B40C 5B31C 3AYWB 2HIOD 5BNXB 3AZMD 1BH8B 1WWIA 4R8PA 4J8UA 3AN2C 5CPIB 1S32B 1ID3A 3WA9A 1TAFA 3AFAC 1ULYA 1KX4B 2UWXA 5GT0A 4XZQD 4ZBJB 5AVCB 5B40A 5B24D 5B32D 3REID 3UT9D 3AYWD 4YS3A 3NQUB 4XZQC 1Z2CB 1AOIC 2F8NH 2BYKB 1HQ3C 5B32C 3UTBC 2HIOA 3AZMA 3AYWC 1S32D 1M19B 1KX4D 5E5AC 5CPIC 4WV4B 1S32C 5AVCD 3X1UB 1P3KB 4J8XB 4XZQA 2G5HC 5C3IB 2L5AA 5GT3C 5B24A 5B32A 3MGRC 2ZY4A 3REIA 3UT9A 3AYWA 1P3ID 5BNXA 1BH8A 3RELC 1M19D 5CPIA 1S32A 4KHAB 4AWLB 3X1UD 4H9SC 5JRGC 3LZ1C 3P5JB 1P3GB 1KX4A 4JJNC 2Y2KA 2XD1A 1P3KD 4J8XD 1F1EA 3KSYA 3W99B 1PZRA 3REJB 5AVCA 3AZHB 3NQUA 2Y2OA 3KUYC 2BYKA 5B2JB 4H9RB 2Y2JA 5AV8B 1M19A 1P3GD 3W99D 5B33B 4CAYB 3B0BA 5GSUB 3X1UA 3MNNC 3REJD 3AZHD 4LD9C 4WU9B 1P3KA 4J8XA 1P3GC 1P3PB 5CPKB 5AV5B 3REJC 4E45A 5B2JD 2Y2MA 3KWQB 3AZFC 4H9OB 5AV8D 2CV5C 4EO5B 2F2AC 4KHAA 1P3MC 2AROC 5B33D 5GSUD 1KX3C 1P3GA 1U35B 4WU9D 2VQRA 1P3PD 3H0RC 1ZLAB 3W99A 3REJA 3AZHA 5CPKD 3A6NB 5AV5D 5B33C 3WKJB 1P3BC 3A1IA 3C1CB 2Y2PA 2Y2LA 1P3PC 4NFTA 1A7WA 3KWQD 2JSSA 3WTPB 5B2JA 1P3LB 4H9RA 3X1SB 4Z66B 5BT1D 5AV8A 2PYOB 3KWQC 3VH6T 1U35D 5DNMC 2FFFB 5B33A 4CAYA 5GSUA 1ZLAD 3A6ND 3WKJD 4WU9A 3MGQB 1P3PA 1B6WA 3AV1B 3C1CD 2NZDC 5CPKA 4KUDB 3X1TB 5AV5A 1ZLAC 3WTPD 1P3LD 3X1SD 4Z66D 3AZKC 3MVDB 3KWQA 3C1CC 4H9OA 5B0ZC 4WU8C 2PYOD 3B6FB 1JFIB 3AZLB 4R8PC 4J8UC 4Z66C 3REHB 1U35A 3MGQD 1ID3C 5B1MB 3AV1D 1ZLAA 5AV6B 4KUDD 3X1TD 3A6NA 3WKJA 3MGQC 3C1CA 5AY8B 3MVDD 4G91C 4YS3C 3X1TC 3EG5B 3WTPA 3KXBB 1P3LA 3B6FD 3X1SA 3AZLD 4Z66A 2JCHA 2PYOA 3MVDC 3REHD 5B2IB 2RVQD 2DQNC 2HIOC 3AZMC 5B1MD 3VH5T 3B6FC 5AV6D 3KFUG 2XD5A 3MGQA 3AV1A 2RVQC 5CHLB 5AY8D 4KUDA 3X1TA 3VH6W 5B0YB 4Z5TB 3KXBD 5B24C 3MVDA 3LELB 1P3IB 3REIC 3UT9C 5B2ID 3B6FA 1JFIA 3AZLA 3REHA 5B1LB 5B1MA 5AV6A 4M6BA 1KX4C 4H9NB 5B0YD 4Z5TD 2FJ7B 4ZBJC 5AY8A 5AVCC 4QLCB 2JE5A 3LELD 3EPHA 1F66B 3KXBA 3B0DB 3WAAB 4Z5TC 5CP6B 3LELC 3C1BB 5B2IA 1P3IC 5B1LD 3B6GB 1M19C 1WWSA 2FJ7D 4X23B 3FDDA 3NQJB 4QLCD 3X1UC 5B0YA 1P3KC 2BYMB 4Z5TA 4J8XC 5C3IC 4NE5A 1F66D 3VH5W 3WAAD 3O62B 3LELA 3TU4B 1P3IA 1P3OB 4QLCC 5CP6D 3C1BD 2HUEB 3B6GD 3B0DC 3WAAC 4NE6A 2F8NK 5B1LA 1B67A 4AWLC 1BH9B 4X23D 4H9NA 2DF4C 5GXQB 2FJ7A 3W99C 3AZHC 4QLCA 3O62D 3TU4D 3W98B 1P3OD 1F66A 3R45B 4H9QB 3WAAA 5CP6A 5BS7A 3O62C 3C1BA 5B31G 5B2JC 1P3OC 3UTAB 4ZUXB 3B6GA 2HUEC 5AV8C 3W97B 3W96B 1M1AB 5F99B 5GXQD 4X23A 5GSUC 3NQJA 3W98D 4WU9C 1R4VA 2BYMA 3AL0C 5CPKC 1Q9CA 3O62A 2ZY5A 5AV5C 3TU4A 1P3OA 2NQBB 3W98C 3UTAD 4ZUXD 3W97D 4EO5C 5CPJB 3LZ0B 4G92B 3W96D 1M1AD 4WNNB 1BH9A 5F99D 5BT1C 4HGAB 1P34B 3UTAC 4J8VB 1U35C 3X1VB
chains in the Genus database with same CATH topology
3W96C 5GXQA 2Y2IA 3MGSB 3A6NC 3LJAB 3WKJC 3W98A 2NQBD 5KDMB 3R45A 3MGPB 4H9QA 3AZGB 5CPJD 3LZ0D 1BFMA 3WTPC 1P3LC 3UTAA 4ZUXA 3V9RB 3AZED 3X1SC 1P34D 3W97A 4J8VD 2Y2HA 3AZNB 2PYOC 3W96A 4YM6B 5G49B 3H0MC 3AZIB 1M1AA 3X1VD 5F99A 1KX5B 3AZJB 4J8WB 4HGAC 3MGSD 3LJAD 1H3OB 3EPJA 5B31B 3AV1C 3MGPD 4Z2MG 3X1VC 4KUDC 3AN2B 1TZYB 3AZGD 2NQBA 3MGSC 3LJAC 3MGPC 3AFAB 3AZND 5CPJA 3LZ0A 4YM6D 3AZID 4WNNA 3AZLC 1P34A 1KX5D 4J8VA 1P3FB 3AZJD 4J8WD 3REHC 1M18B 5B1MC 5B31D 3X1VA 2ZY3A 4YM6C 5AV6C 1AOIB 3MGSA 3AN2D 3LJAA 1TZYD 1HQ3B 5KDMA 3UTBB 3MGPA 5AY8C 3AFAD 3AZGA 3VH6A 2RIQA 1TZYC 5E5AB 3KXBC 3V9RA 3AV2B 3EPLA 1P3FD 3AZNA 5B2IC 4YM6A 5G49A 3AZIA 1M18D 4DRAA 1KX5A 3AZJA 5GT3B 4J8WA 1AOID 3MGRB 1P3FC 1H3OA 1HQ3D 4CSRB 5B31A 4XUJB 3UTBD 1M18C 2YFVB 3AN2A 4KGCB 1TZYA 2CWEA 3A1KA 3RELB 5B0YC 5E5AD 5CPID 3AV2D 3AFAA 2YFWB 2F8NG 5JRGB 3LZ1B 4JJNB 2ZM5A 1P3FA 5GT3D 3MGRD 5AV9B 3AV2C 5B1LC 1M18A 4XUJD 5JA4B 1AOIA 4KGCD 1W2EA 3IP4C 3KUYB 3RELD 1HQ3A 2J8PA 3UTBA 2FJ7C 2W8SA 3REKB 4XUJC 4UPKA 5JRGD 1F66C 3LZ1D 4KGCC 5E5AA 4JJND 5BO0B 3VH5A 3AV2A 4DRBA 3MNNB 5CP6C 5BS7C 4LD9B 3C1BC 5AV9D 3B6GC 1EQZB 3B0CT 5GT3A 3MGRA 3KUYD 4CSRA 4XUJA 5AV9C 4X23C 2YFVA 3REKD 2CV5B 3AZFB 4KGCA 3RELA 2Y2NA 1P3MB 2AROB 3MNND 3REKC 2YFWA 3TU4C 4H9SA 5JRGA 1KX3B 3LZ1A 4LD9D 4JJNA 2G5IC 4E44A 3EPKA 1EQZD 5DNNB 4H9PB 5AV9A 5JA4A 1P3BB 2CV5D 3AZFD 4UUZB 1EQZC 3KUYA 2F8NB 5GXQC 3REKA 1P3MD 2AROD 5BNVB 1KX3D 2ZY2A 5BO0A 4DQYB 3WTPE 5B32G 5DNMB 3MNNA 2BG1A 5DNND 3AZEB 4LD9A 4ZUXC 1P3BD 1EQZA 3W97C 2NZDB 1M1AC 2F8ND 4WJ3C 5DNNC 1N1JB 1P3AB 5F99C 4WZSB 3AZKB 2Y2QA 2CV5A 3AZFA 5AVBB 5B0ZB 4WU8B 5FUGB 1P3MA 2AROA 3B0CW 3H0LC 5DNMD 4R8PB 4J8UB 2NQBC 1KX3A 1ID3B 3WA9B 1T3UA 1TAFB 2Y2GA 2NZDD 2IO5B 5DNNA 3LZ0C 4G92C 4H9PA 5CPJC 5GT0B 3AZEC 1P3AD 4Z2MH 1P3BA 1P34C 4J8VC 5B40B 3AZKD 4G91B 4UUZA 5AVBD 5B0ZD 2LY8A 4WU8D 4YS3B 2F8NA 1P3AC 4R8PD 5BNVA 4J8UD 5AVBC 2HIOB 1HTAA 3AZMB 1ID3D 3WA9D 5DNMA 3AZGC 3AZEA 3F6TA 5GT0D 2NZDA 3WA9C 5B40D 3AZNC 3AZIC 2IO5C 4NE3A 1N1JA 4XZQB 4YS3D 1P3AA 1KX5C 5GT0C 3AZJC 5B24B 1KU5A 5B32B 4J8WC 3AZKA 5AVBA 5B0ZA 4WU8A 5FUGA 3REIB 3UT9B 5B40C 5B31C 3AYWB 2HIOD 5BNXB 3AZMD 1BH8B 1WWIA 4R8PA 4J8UA 3AN2C 5CPIB 1S32B 1ID3A 3WA9A 1TAFA 3AFAC 1ULYA 1KX4B 2UWXA 5GT0A 4XZQD 4ZBJB 5AVCB 5B40A 5B24D 5B32D 3REID 3UT9D 3AYWD 4YS3A 3NQUB 4XZQC 1Z2CB 1AOIC 2F8NH 2BYKB 1HQ3C 5B32C 3UTBC 2HIOA 3AZMA 3AYWC 1S32D 1M19B 1KX4D 5E5AC 5CPIC 4WV4B 1S32C 5AVCD 3X1UB 1P3KB 4J8XB 4XZQA 2G5HC 5C3IB 2L5AA 5GT3C 5B24A 5B32A 3MGRC 2ZY4A 3REIA 3UT9A 3AYWA 1P3ID 5BNXA 1BH8A 3RELC 1M19D 5CPIA 1S32A 4KHAB 4AWLB 3X1UD 4H9SC 5JRGC 3LZ1C 3P5JB 1P3GB 1KX4A 4JJNC 2Y2KA 2XD1A 1P3KD 4J8XD 1F1EA 3KSYA 3W99B 1PZRA 3REJB 5AVCA 3AZHB 3NQUA 2Y2OA 3KUYC 2BYKA 5B2JB 4H9RB 2Y2JA 5AV8B 1M19A 1P3GD 3W99D 5B33B 4CAYB 3B0BA 5GSUB 3X1UA 3MNNC 3REJD 3AZHD 4LD9C 4WU9B 1P3KA 4J8XA 1P3GC 1P3PB 5CPKB 5AV5B 3REJC 4E45A 5B2JD 2Y2MA 3KWQB 3AZFC 4H9OB 5AV8D 2CV5C 4EO5B 2F2AC 4KHAA 1P3MC 2AROC 5B33D 5GSUD 1KX3C 1P3GA 1U35B 4WU9D 2VQRA 1P3PD 3H0RC 1ZLAB 3W99A 3REJA 3AZHA 5CPKD 3A6NB 5AV5D 5B33C 3WKJB 1P3BC 3A1IA 3C1CB 2Y2PA 2Y2LA 1P3PC 4NFTA 1A7WA 3KWQD 2JSSA 3WTPB 5B2JA 1P3LB 4H9RA 3X1SB 4Z66B 5BT1D 5AV8A 2PYOB 3KWQC 3VH6T 1U35D 5DNMC 2FFFB 5B33A 4CAYA 5GSUA 1ZLAD 3A6ND 3WKJD 4WU9A 3MGQB 1P3PA 1B6WA 3AV1B 3C1CD 2NZDC 5CPKA 4KUDB 3X1TB 5AV5A 1ZLAC 3WTPD 1P3LD 3X1SD 4Z66D 3AZKC 3MVDB 3KWQA 3C1CC 4H9OA 5B0ZC 4WU8C 2PYOD 3B6FB 1JFIB 3AZLB 4R8PC 4J8UC 4Z66C 3REHB 1U35A 3MGQD 1ID3C 5B1MB 3AV1D 1ZLAA 5AV6B 4KUDD 3X1TD 3A6NA 3WKJA 3MGQC 3C1CA 5AY8B 3MVDD 4G91C 4YS3C 3X1TC 3EG5B 3WTPA 3KXBB 1P3LA 3B6FD 3X1SA 3AZLD 4Z66A 2JCHA 2PYOA 3MVDC 3REHD 5B2IB 2RVQD 2DQNC 2HIOC 3AZMC 5B1MD 3VH5T 3B6FC 5AV6D 3KFUG 2XD5A 3MGQA 3AV1A 2RVQC 5CHLB 5AY8D 4KUDA 3X1TA 3VH6W 5B0YB 4Z5TB 3KXBD 5B24C 3MVDA 3LELB 1P3IB 3REIC 3UT9C 5B2ID 3B6FA 1JFIA 3AZLA 3REHA 5B1LB 5B1MA 5AV6A 4M6BA 1KX4C 4H9NB 5B0YD 4Z5TD 2FJ7B 4ZBJC 5AY8A 5AVCC 4QLCB 2JE5A 3LELD 3EPHA 1F66B 3KXBA 3B0DB 3WAAB 4Z5TC 5CP6B 3LELC 3C1BB 5B2IA 1P3IC 5B1LD 3B6GB 1M19C 1WWSA 2FJ7D 4X23B 3FDDA 3NQJB 4QLCD 3X1UC 5B0YA 1P3KC 2BYMB 4Z5TA 4J8XC 5C3IC 4NE5A 1F66D 3VH5W 3WAAD 3O62B 3LELA 3TU4B 1P3IA 1P3OB 4QLCC 5CP6D 3C1BD 2HUEB 3B6GD 3B0DC 3WAAC 4NE6A 2F8NK 5B1LA 1B67A 4AWLC 1BH9B 4X23D 4H9NA 2DF4C 5GXQB 2FJ7A 3W99C 3AZHC 4QLCA 3O62D 3TU4D 3W98B 1P3OD 1F66A 3R45B 4H9QB 3WAAA 5CP6A 5BS7A 3O62C 3C1BA 5B31G 5B2JC 1P3OC 3UTAB 4ZUXB 3B6GA 2HUEC 5AV8C 3W97B 3W96B 1M1AB 5F99B 5GXQD 4X23A 5GSUC 3NQJA 3W98D 4WU9C 1R4VA 2BYMA 3AL0C 5CPKC 1Q9CA 3O62A 2ZY5A 5AV5C 3TU4A 1P3OA 2NQBB 3W98C 3UTAD 4ZUXD 3W97D 4EO5C 5CPJB 3LZ0B 4G92B 3W96D 1M1AD 4WNNB 1BH9A 5F99D 5BT1C 4HGAB 1P34B 3UTAC 4J8VB 1U35C 3X1VB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W96 C;  5GXQ A;  3MGS B;  3A6N C;  3LJA B;  3WKJ C;  3W98 A;  2NQB D;  5KDM B;  3R45 A;  3MGP B;  4H9Q A;  3AZG B;  5CPJ D;  3LZ0 D;  1BFM A;  3WTP C;  1P3L C;  3UTA A;  4ZUX A;  3V9R B;  3AZE D;  3X1S C;  1P34 D;  3W97 A;  4J8V D;  3AZN B;  2PYO C;  3W96 A;  4YM6 B;  5G49 B;  3AZI B;  1M1A A;  3X1V D;  5F99 A;  1KX5 B;  3AZJ B;  4J8W B;  4HGA C;  3MGS D;  3LJA D;  1H3O B;  5B31 B;  3AV1 C;  3MGP D;  4Z2M G;  3X1V C;  4KUD C;  3AN2 B;  1TZY B;  3AZG D;  2NQB A;  3MGS C;  3LJA C;  3MGP C;  3AFA B;  3AZN D;  5CPJ A;  3LZ0 A;  4YM6 D;  3AZI D;  4WNN A;  3AZL C;  1P34 A;  1KX5 D;  4J8V A;  1P3F B;  3AZJ D;  4J8W D;  3REH C;  1M18 B;  5B1M C;  5B31 D;  3X1V A;  4YM6 C;  5AV6 C;  1AOI B;  3MGS A;  3AN2 D;  3LJA A;  1TZY D;  1HQ3 B;  5KDM A;  3UTB B;  3MGP A;  5AY8 C;  3AFA D;  3AZG A;  3VH6 A;  1TZY C;  5E5A B;  3KXB C;  3V9R A;  3AV2 B;  1P3F D;  3AZN A;  5B2I C;  4YM6 A;  5G49 A;  3AZI A;  1M18 D;  4DRA A;  1KX5 A;  3AZJ A;  5GT3 B;  4J8W A;  1AOI D;  3MGR B;  1P3F C;  1H3O A;  1HQ3 D;  4CSR B;  5B31 A;  4XUJ B;  3UTB D;  1M18 C;  2YFV B;  3AN2 A;  4KGC B;  1TZY A;  2CWE A;  3REL B;  5B0Y C;  5E5A D;  5CPI D;  3AV2 D;  3AFA A;  2YFW B;  2F8N G;  5JRG B;  3LZ1 B;  4JJN B;  1P3F A;  5GT3 D;  3MGR D;  5AV9 B;  3AV2 C;  5B1L C;  1M18 A;  4XUJ D;  5JA4 B;  1AOI A;  4KGC D;  3KUY B;  3REL D;  1HQ3 A;  3UTB A;  2FJ7 C;  3REK B;  4XUJ C;  5JRG D;  1F66 C;  3LZ1 D;  4KGC C;  5E5A A;  4JJN D;  5BO0 B;  3VH5 A;  3AV2 A;  4DRB A;  3MNN B;  5CP6 C;  5BS7 C;  4LD9 B;  3C1B C;  5AV9 D;  3B6G C;  1EQZ B;  3B0C T;  5GT3 A;  3MGR A;  3KUY D;  4CSR A;  4XUJ A;  5AV9 C;  4X23 C;  2YFV A;  3REK D;  2CV5 B;  3AZF B;  4KGC A;  3REL A;  1P3M B;  2ARO B;  3MNN D;  3REK C;  2YFW A;  3TU4 C;  4H9S A;  5JRG A;  1KX3 B;  3LZ1 A;  4LD9 D;  4JJN A;  4E44 A;  1EQZ D;  5DNN B;  4H9P B;  5AV9 A;  5JA4 A;  1P3B B;  2CV5 D;  3AZF D;  4UUZ B;  1EQZ C;  3KUY A;  2F8N B;  5GXQ C;  3REK A;  1P3M D;  2ARO D;  5BNV B;  1KX3 D;  5BO0 A;  3WTP E;  5B32 G;  5DNM B;  3MNN A;  5DNN D;  3AZE B;  4LD9 A;  4ZUX C;  1P3B D;  1EQZ A;  3W97 C;  2NZD B;  1M1A C;  2F8N D;  5DNN C;  1N1J B;  1P3A B;  5F99 C;  4WZS B;  3AZK B;  2CV5 A;  3AZF A;  5AVB B;  5B0Z B;  4WU8 B;  5FUG B;  1P3M A;  2ARO A;  3B0C W;  5DNM D;  4R8P B;  4J8U B;  2NQB C;  1KX3 A;  1ID3 B;  3WA9 B;  1TAF B;  2NZD D;  2IO5 B;  5DNN A;  3LZ0 C;  4G92 C;  4H9P A;  5CPJ C;  5GT0 B;  3AZE C;  1P3A D;  4Z2M H;  1P3B A;  1P34 C;  4J8V C;  5B40 B;  3AZK D;  4G91 B;  4UUZ A;  5AVB D;  5B0Z D;  2LY8 A;  4WU8 D;  4YS3 B;  2F8N A;  1P3A C;  4R8P D;  5BNV A;  4J8U D;  5AVB C;  2HIO B;  1HTA A;  3AZM B;  1ID3 D;  3WA9 D;  5DNM A;  3AZG C;  3AZE A;  5GT0 D;  2NZD A;  3WA9 C;  5B40 D;  3AZN C;  3AZI C;  2IO5 C;  4NE3 A;  1N1J A;  4XZQ B;  4YS3 D;  1P3A A;  1KX5 C;  5GT0 C;  3AZJ C;  5B24 B;  1KU5 A;  5B32 B;  4J8W C;  3AZK A;  5AVB A;  5B0Z A;  4WU8 A;  5FUG A;  3REI B;  3UT9 B;  5B40 C;  5B31 C;  3AYW B;  2HIO D;  5BNX B;  3AZM D;  1BH8 B;  1WWI A;  4R8P A;  4J8U A;  3AN2 C;  5CPI B;  1S32 B;  1ID3 A;  3WA9 A;  1TAF A;  3AFA C;  1ULY A;  1KX4 B;  5GT0 A;  4XZQ D;  4ZBJ B;  5AVC B;  5B40 A;  5B24 D;  5B32 D;  3REI D;  3UT9 D;  3AYW D;  4YS3 A;  3NQU B;  4XZQ C;  1AOI C;  2F8N H;  2BYK B;  1HQ3 C;  5B32 C;  3UTB C;  2HIO A;  3AZM A;  3AYW C;  1S32 D;  1M19 B;  1KX4 D;  5E5A C;  5CPI C;  4WV4 B;  1S32 C;  5AVC D;  3X1U B;  1P3K B;  4J8X B;  4XZQ A;  5C3I B;  2L5A A;  5GT3 C;  5B24 A;  5B32 A;  3MGR C;  3REI A;  3UT9 A;  3AYW A;  1P3I D;  5BNX A;  1BH8 A;  3REL C;  1M19 D;  5CPI A;  1S32 A;  4KHA B;  4AWL B;  3X1U D;  4H9S C;  5JRG C;  3LZ1 C;  1P3G B;  1KX4 A;  4JJN C;  1P3K D;  4J8X D;  1F1E A;  3KSY A;  3W99 B;  3REJ B;  3AZH B;  5AVC A;  3NQU A;  3KUY C;  2BYK A;  5B2J B;  4H9R B;  5AV8 B;  1M19 A;  1P3G D;  3W99 D;  5B33 B;  4CAY B;  3B0B A;  5GSU B;  3X1U A;  3MNN C;  3REJ D;  3AZH D;  4LD9 C;  4WU9 B;  1P3K A;  4J8X A;  1P3G C;  1P3P B;  5CPK B;  5AV5 B;  3REJ C;  4E45 A;  5B2J D;  3KWQ B;  3AZF C;  4H9O B;  5AV8 D;  2CV5 C;  4EO5 B;  4KHA A;  1P3M C;  2ARO C;  5B33 D;  5GSU D;  1KX3 C;  1P3G A;  1U35 B;  4WU9 D;  1P3P D;  1ZLA B;  3W99 A;  3REJ A;  3AZH A;  5CPK D;  3A6N B;  5AV5 D;  5B33 C;  3WKJ B;  1P3B C;  3C1C B;  1P3P C;  4NFT A;  1A7W A;  3KWQ D;  2JSS A;  3WTP B;  5B2J A;  1P3L B;  4H9R A;  3X1S B;  4Z66 B;  5BT1 D;  5AV8 A;  2PYO B;  3KWQ C;  3VH6 T;  1U35 D;  5DNM C;  5B33 A;  4CAY A;  5GSU A;  1ZLA D;  3A6N D;  3WKJ D;  4WU9 A;  3MGQ B;  1P3P A;  1B6W A;  3AV1 B;  3C1C D;  2NZD C;  5CPK A;  4KUD B;  3X1T B;  5AV5 A;  1ZLA C;  3WTP D;  1P3L D;  3X1S D;  4Z66 D;  3AZK C;  3MVD B;  3KWQ A;  3C1C C;  4H9O A;  5B0Z C;  4WU8 C;  2PYO D;  3B6F B;  1JFI B;  3AZL B;  4R8P C;  4J8U C;  4Z66 C;  3REH B;  1U35 A;  3MGQ D;  1ID3 C;  5B1M B;  3AV1 D;  1ZLA A;  5AV6 B;  4KUD D;  3X1T D;  3A6N A;  3WKJ A;  3MGQ C;  3C1C A;  5AY8 B;  3MVD D;  4G91 C;  4YS3 C;  3X1T C;  3WTP A;  3KXB B;  1P3L A;  3B6F D;  3X1S A;  3AZL D;  4Z66 A;  2PYO A;  3MVD C;  3REH D;  5B2I B;  2RVQ D;  2HIO C;  3AZM C;  5B1M D;  3VH5 T;  3B6F C;  5AV6 D;  3MGQ A;  3AV1 A;  2RVQ C;  5CHL B;  5AY8 D;  4KUD A;  3X1T A;  3VH6 W;  5B0Y B;  4Z5T B;  3KXB D;  5B24 C;  3MVD A;  3LEL B;  1P3I B;  3REI C;  3UT9 C;  5B2I D;  3B6F A;  1JFI A;  3AZL A;  3REH A;  5B1L B;  5B1M A;  5AV6 A;  4M6B A;  1KX4 C;  4H9N B;  5B0Y D;  4Z5T D;  2FJ7 B;  4ZBJ C;  5AY8 A;  5AVC C;  4QLC B;  3LEL D;  1F66 B;  3KXB A;  3B0D B;  3WAA B;  4Z5T C;  5CP6 B;  3LEL C;  3C1B B;  5B2I A;  1P3I C;  5B1L D;  3B6G B;  1M19 C;  1WWS A;  2FJ7 D;  4X23 B;  3NQJ B;  4QLC D;  3X1U C;  5B0Y A;  1P3K C;  2BYM B;  4Z5T A;  4J8X C;  5C3I C;  4NE5 A;  1F66 D;  3VH5 W;  3WAA D;  3O62 B;  3LEL A;  3TU4 B;  1P3I A;  1P3O B;  4QLC C;  5CP6 D;  3C1B D;  2HUE B;  3B6G D;  3B0D C;  3WAA C;  4NE6 A;  2F8N K;  5B1L A;  1B67 A;  4AWL C;  1BH9 B;  4X23 D;  4H9N A;  5GXQ B;  2FJ7 A;  3W99 C;  3AZH C;  4QLC A;  3O62 D;  3TU4 D;  3W98 B;  1P3O D;  1F66 A;  3R45 B;  4H9Q B;  3WAA A;  5CP6 A;  5BS7 A;  3O62 C;  3C1B A;  5B31 G;  5B2J C;  1P3O C;  3UTA B;  4ZUX B;  3B6G A;  2HUE C;  5AV8 C;  3W97 B;  3W96 B;  1M1A B;  5F99 B;  5GXQ D;  4X23 A;  5GSU C;  3NQJ A;  3W98 D;  4WU9 C;  1R4V A;  2BYM A;  5CPK C;  1Q9C A;  3O62 A;  5AV5 C;  3TU4 A;  1P3O A;  2NQB B;  3W98 C;  3UTA D;  4ZUX D;  3W97 D;  4EO5 C;  5CPJ B;  3LZ0 B;  4G92 B;  3W96 D;  1M1A D;  4WNN B;  1BH9 A;  5F99 D;  5BT1 C;  4HGA B;  1P34 B;  3UTA C;  4J8V B;  1U35 C;  3X1V B; 
#chains in the Genus database with same CATH topology
 3W96 C;  5GXQ A;  2Y2I A;  3MGS B;  3A6N C;  3LJA B;  3WKJ C;  3W98 A;  2NQB D;  5KDM B;  3R45 A;  3MGP B;  4H9Q A;  3AZG B;  5CPJ D;  3LZ0 D;  1BFM A;  3WTP C;  1P3L C;  3UTA A;  4ZUX A;  3V9R B;  3AZE D;  3X1S C;  1P34 D;  3W97 A;  4J8V D;  2Y2H A;  3AZN B;  2PYO C;  3W96 A;  4YM6 B;  5G49 B;  3H0M C;  3AZI B;  1M1A A;  3X1V D;  5F99 A;  1KX5 B;  3AZJ B;  4J8W B;  4HGA C;  3MGS D;  3LJA D;  1H3O B;  3EPJ A;  5B31 B;  3AV1 C;  3MGP D;  4Z2M G;  3X1V C;  4KUD C;  3AN2 B;  1TZY B;  3AZG D;  2NQB A;  3MGS C;  3LJA C;  3MGP C;  3AFA B;  3AZN D;  5CPJ A;  3LZ0 A;  4YM6 D;  3AZI D;  4WNN A;  3AZL C;  1P34 A;  1KX5 D;  4J8V A;  1P3F B;  3AZJ D;  4J8W D;  3REH C;  1M18 B;  5B1M C;  5B31 D;  3X1V A;  2ZY3 A;  4YM6 C;  5AV6 C;  1AOI B;  3MGS A;  3AN2 D;  3LJA A;  1TZY D;  1HQ3 B;  5KDM A;  3UTB B;  3MGP A;  5AY8 C;  3AFA D;  3AZG A;  3VH6 A;  2RIQ A;  1TZY C;  5E5A B;  3KXB C;  3V9R A;  3AV2 B;  3EPL A;  1P3F D;  3AZN A;  5B2I C;  4YM6 A;  5G49 A;  3AZI A;  1M18 D;  4DRA A;  1KX5 A;  3AZJ A;  5GT3 B;  4J8W A;  1AOI D;  3MGR B;  1P3F C;  1H3O A;  1HQ3 D;  4CSR B;  5B31 A;  4XUJ B;  3UTB D;  1M18 C;  2YFV B;  3AN2 A;  4KGC B;  1TZY A;  2CWE A;  3A1K A;  3REL B;  5B0Y C;  5E5A D;  5CPI D;  3AV2 D;  3AFA A;  2YFW B;  2F8N G;  5JRG B;  3LZ1 B;  4JJN B;  2ZM5 A;  1P3F A;  5GT3 D;  3MGR D;  5AV9 B;  3AV2 C;  5B1L C;  1M18 A;  4XUJ D;  5JA4 B;  1AOI A;  4KGC D;  1W2E A;  3IP4 C;  3KUY B;  3REL D;  1HQ3 A;  2J8P A;  3UTB A;  2FJ7 C;  2W8S A;  3REK B;  4XUJ C;  4UPK A;  5JRG D;  1F66 C;  3LZ1 D;  4KGC C;  5E5A A;  4JJN D;  5BO0 B;  3VH5 A;  3AV2 A;  4DRB A;  3MNN B;  5CP6 C;  5BS7 C;  4LD9 B;  3C1B C;  5AV9 D;  3B6G C;  1EQZ B;  3B0C T;  5GT3 A;  3MGR A;  3KUY D;  4CSR A;  4XUJ A;  5AV9 C;  4X23 C;  2YFV A;  3REK D;  2CV5 B;  3AZF B;  4KGC A;  3REL A;  2Y2N A;  1P3M B;  2ARO B;  3MNN D;  3REK C;  2YFW A;  3TU4 C;  4H9S A;  5JRG A;  1KX3 B;  3LZ1 A;  4LD9 D;  4JJN A;  2G5I C;  4E44 A;  3EPK A;  1EQZ D;  5DNN B;  4H9P B;  5AV9 A;  5JA4 A;  1P3B B;  2CV5 D;  3AZF D;  4UUZ B;  1EQZ C;  3KUY A;  2F8N B;  5GXQ C;  3REK A;  1P3M D;  2ARO D;  5BNV B;  1KX3 D;  2ZY2 A;  5BO0 A;  4DQY B;  3WTP E;  5B32 G;  5DNM B;  3MNN A;  2BG1 A;  5DNN D;  3AZE B;  4LD9 A;  4ZUX C;  1P3B D;  1EQZ A;  3W97 C;  2NZD B;  1M1A C;  2F8N D;  4WJ3 C;  5DNN C;  1N1J B;  1P3A B;  5F99 C;  4WZS B;  3AZK B;  2Y2Q A;  2CV5 A;  3AZF A;  5AVB B;  5B0Z B;  4WU8 B;  5FUG B;  1P3M A;  2ARO A;  3B0C W;  3H0L C;  5DNM D;  4R8P B;  4J8U B;  2NQB C;  1KX3 A;  1ID3 B;  3WA9 B;  1T3U A;  1TAF B;  2Y2G A;  2NZD D;  2IO5 B;  5DNN A;  3LZ0 C;  4G92 C;  4H9P A;  5CPJ C;  5GT0 B;  3AZE C;  1P3A D;  4Z2M H;  1P3B A;  1P34 C;  4J8V C;  5B40 B;  3AZK D;  4G91 B;  4UUZ A;  5AVB D;  5B0Z D;  2LY8 A;  4WU8 D;  4YS3 B;  2F8N A;  1P3A C;  4R8P D;  5BNV A;  4J8U D;  5AVB C;  2HIO B;  1HTA A;  3AZM B;  1ID3 D;  3WA9 D;  5DNM A;  3AZG C;  3AZE A;  3F6T A;  5GT0 D;  2NZD A;  3WA9 C;  5B40 D;  3AZN C;  3AZI C;  2IO5 C;  4NE3 A;  1N1J A;  4XZQ B;  4YS3 D;  1P3A A;  1KX5 C;  5GT0 C;  3AZJ C;  5B24 B;  1KU5 A;  5B32 B;  4J8W C;  3AZK A;  5AVB A;  5B0Z A;  4WU8 A;  5FUG A;  3REI B;  3UT9 B;  5B40 C;  5B31 C;  3AYW B;  2HIO D;  5BNX B;  3AZM D;  1BH8 B;  1WWI A;  4R8P A;  4J8U A;  3AN2 C;  5CPI B;  1S32 B;  1ID3 A;  3WA9 A;  1TAF A;  3AFA C;  1ULY A;  1KX4 B;  2UWX A;  5GT0 A;  4XZQ D;  4ZBJ B;  5AVC B;  5B40 A;  5B24 D;  5B32 D;  3REI D;  3UT9 D;  3AYW D;  4YS3 A;  3NQU B;  4XZQ C;  1Z2C B;  1AOI C;  2F8N H;  2BYK B;  1HQ3 C;  5B32 C;  3UTB C;  2HIO A;  3AZM A;  3AYW C;  1S32 D;  1M19 B;  1KX4 D;  5E5A C;  5CPI C;  4WV4 B;  1S32 C;  5AVC D;  3X1U B;  1P3K B;  4J8X B;  4XZQ A;  2G5H C;  5C3I B;  2L5A A;  5GT3 C;  5B24 A;  5B32 A;  3MGR C;  2ZY4 A;  3REI A;  3UT9 A;  3AYW A;  1P3I D;  5BNX A;  1BH8 A;  3REL C;  1M19 D;  5CPI A;  1S32 A;  4KHA B;  4AWL B;  3X1U D;  4H9S C;  5JRG C;  3LZ1 C;  3P5J B;  1P3G B;  1KX4 A;  4JJN C;  2Y2K A;  2XD1 A;  1P3K D;  4J8X D;  1F1E A;  3KSY A;  3W99 B;  1PZR A;  3REJ B;  5AVC A;  3AZH B;  3NQU A;  2Y2O A;  3KUY C;  2BYK A;  5B2J B;  4H9R B;  2Y2J A;  5AV8 B;  1M19 A;  1P3G D;  3W99 D;  5B33 B;  4CAY B;  3B0B A;  5GSU B;  3X1U A;  3MNN C;  3REJ D;  3AZH D;  4LD9 C;  4WU9 B;  1P3K A;  4J8X A;  1P3G C;  1P3P B;  5CPK B;  5AV5 B;  3REJ C;  4E45 A;  5B2J D;  2Y2M A;  3KWQ B;  3AZF C;  4H9O B;  5AV8 D;  2CV5 C;  4EO5 B;  2F2A C;  4KHA A;  1P3M C;  2ARO C;  5B33 D;  5GSU D;  1KX3 C;  1P3G A;  1U35 B;  4WU9 D;  2VQR A;  1P3P D;  3H0R C;  1ZLA B;  3W99 A;  3REJ A;  3AZH A;  5CPK D;  3A6N B;  5AV5 D;  5B33 C;  3WKJ B;  1P3B C;  3A1I A;  3C1C B;  2Y2P A;  2Y2L A;  1P3P C;  4NFT A;  1A7W A;  3KWQ D;  2JSS A;  3WTP B;  5B2J A;  1P3L B;  4H9R A;  3X1S B;  4Z66 B;  5BT1 D;  5AV8 A;  2PYO B;  3KWQ C;  3VH6 T;  1U35 D;  5DNM C;  2FFF B;  5B33 A;  4CAY A;  5GSU A;  1ZLA D;  3A6N D;  3WKJ D;  4WU9 A;  3MGQ B;  1P3P A;  1B6W A;  3AV1 B;  3C1C D;  2NZD C;  5CPK A;  4KUD B;  3X1T B;  5AV5 A;  1ZLA C;  3WTP D;  1P3L D;  3X1S D;  4Z66 D;  3AZK C;  3MVD B;  3KWQ A;  3C1C C;  4H9O A;  5B0Z C;  4WU8 C;  2PYO D;  3B6F B;  1JFI B;  3AZL B;  4R8P C;  4J8U C;  4Z66 C;  3REH B;  1U35 A;  3MGQ D;  1ID3 C;  5B1M B;  3AV1 D;  1ZLA A;  5AV6 B;  4KUD D;  3X1T D;  3A6N A;  3WKJ A;  3MGQ C;  3C1C A;  5AY8 B;  3MVD D;  4G91 C;  4YS3 C;  3X1T C;  3EG5 B;  3WTP A;  3KXB B;  1P3L A;  3B6F D;  3X1S A;  3AZL D;  4Z66 A;  2JCH A;  2PYO A;  3MVD C;  3REH D;  5B2I B;  2RVQ D;  2DQN C;  2HIO C;  3AZM C;  5B1M D;  3VH5 T;  3B6F C;  5AV6 D;  3KFU G;  2XD5 A;  3MGQ A;  3AV1 A;  2RVQ C;  5CHL B;  5AY8 D;  4KUD A;  3X1T A;  3VH6 W;  5B0Y B;  4Z5T B;  3KXB D;  5B24 C;  3MVD A;  3LEL B;  1P3I B;  3REI C;  3UT9 C;  5B2I D;  3B6F A;  1JFI A;  3AZL A;  3REH A;  5B1L B;  5B1M A;  5AV6 A;  4M6B A;  1KX4 C;  4H9N B;  5B0Y D;  4Z5T D;  2FJ7 B;  4ZBJ C;  5AY8 A;  5AVC C;  4QLC B;  2JE5 A;  3LEL D;  3EPH A;  1F66 B;  3KXB A;  3B0D B;  3WAA B;  4Z5T C;  5CP6 B;  3LEL C;  3C1B B;  5B2I A;  1P3I C;  5B1L D;  3B6G B;  1M19 C;  1WWS A;  2FJ7 D;  4X23 B;  3FDD A;  3NQJ B;  4QLC D;  3X1U C;  5B0Y A;  1P3K C;  2BYM B;  4Z5T A;  4J8X C;  5C3I C;  4NE5 A;  1F66 D;  3VH5 W;  3WAA D;  3O62 B;  3LEL A;  3TU4 B;  1P3I A;  1P3O B;  4QLC C;  5CP6 D;  3C1B D;  2HUE B;  3B6G D;  3B0D C;  3WAA C;  4NE6 A;  2F8N K;  5B1L A;  1B67 A;  4AWL C;  1BH9 B;  4X23 D;  4H9N A;  2DF4 C;  5GXQ B;  2FJ7 A;  3W99 C;  3AZH C;  4QLC A;  3O62 D;  3TU4 D;  3W98 B;  1P3O D;  1F66 A;  3R45 B;  4H9Q B;  3WAA A;  5CP6 A;  5BS7 A;  3O62 C;  3C1B A;  5B31 G;  5B2J C;  1P3O C;  3UTA B;  4ZUX B;  3B6G A;  2HUE C;  5AV8 C;  3W97 B;  3W96 B;  1M1A B;  5F99 B;  5GXQ D;  4X23 A;  5GSU C;  3NQJ A;  3W98 D;  4WU9 C;  1R4V A;  2BYM A;  3AL0 C;  5CPK C;  1Q9C A;  3O62 A;  2ZY5 A;  5AV5 C;  3TU4 A;  1P3O A;  2NQB B;  3W98 C;  3UTA D;  4ZUX D;  3W97 D;  4EO5 C;  5CPJ B;  3LZ0 B;  4G92 B;  3W96 D;  1M1A D;  4WNN B;  1BH9 A;  5F99 D;  5BT1 C;  4HGA B;  1P34 B;  3UTA C;  4J8V B;  1U35 C;  3X1V B; 
#chains in the Genus database with same CATH homology
 3W96 C;  5GXQ A;  2Y2I A;  3MGS B;  3A6N C;  3LJA B;  3WKJ C;  3W98 A;  2NQB D;  5KDM B;  3R45 A;  3MGP B;  4H9Q A;  3AZG B;  5CPJ D;  3LZ0 D;  1BFM A;  3WTP C;  1P3L C;  3UTA A;  4ZUX A;  3V9R B;  3AZE D;  3X1S C;  1P34 D;  3W97 A;  4J8V D;  2Y2H A;  3AZN B;  2PYO C;  3W96 A;  4YM6 B;  5G49 B;  3H0M C;  3AZI B;  1M1A A;  3X1V D;  5F99 A;  1KX5 B;  3AZJ B;  4J8W B;  4HGA C;  3MGS D;  3LJA D;  1H3O B;  3EPJ A;  5B31 B;  3AV1 C;  3MGP D;  4Z2M G;  3X1V C;  4KUD C;  3AN2 B;  1TZY B;  3AZG D;  2NQB A;  3MGS C;  3LJA C;  3MGP C;  3AFA B;  3AZN D;  5CPJ A;  3LZ0 A;  4YM6 D;  3AZI D;  4WNN A;  3AZL C;  1P34 A;  1KX5 D;  4J8V A;  1P3F B;  3AZJ D;  4J8W D;  3REH C;  1M18 B;  5B1M C;  5B31 D;  3X1V A;  2ZY3 A;  4YM6 C;  5AV6 C;  1AOI B;  3MGS A;  3AN2 D;  3LJA A;  1TZY D;  1HQ3 B;  5KDM A;  3UTB B;  3MGP A;  5AY8 C;  3AFA D;  3AZG A;  3VH6 A;  2RIQ A;  1TZY C;  5E5A B;  3KXB C;  3V9R A;  3AV2 B;  3EPL A;  1P3F D;  3AZN A;  5B2I C;  4YM6 A;  5G49 A;  3AZI A;  1M18 D;  4DRA A;  1KX5 A;  3AZJ A;  5GT3 B;  4J8W A;  1AOI D;  3MGR B;  1P3F C;  1H3O A;  1HQ3 D;  4CSR B;  5B31 A;  4XUJ B;  3UTB D;  1M18 C;  2YFV B;  3AN2 A;  4KGC B;  1TZY A;  2CWE A;  3A1K A;  3REL B;  5B0Y C;  5E5A D;  5CPI D;  3AV2 D;  3AFA A;  2YFW B;  2F8N G;  5JRG B;  3LZ1 B;  4JJN B;  2ZM5 A;  1P3F A;  5GT3 D;  3MGR D;  5AV9 B;  3AV2 C;  5B1L C;  1M18 A;  4XUJ D;  5JA4 B;  1AOI A;  4KGC D;  1W2E A;  3IP4 C;  3KUY B;  3REL D;  1HQ3 A;  2J8P A;  3UTB A;  2FJ7 C;  2W8S A;  3REK B;  4XUJ C;  4UPK A;  5JRG D;  1F66 C;  3LZ1 D;  4KGC C;  5E5A A;  4JJN D;  5BO0 B;  3VH5 A;  3AV2 A;  4DRB A;  3MNN B;  5CP6 C;  5BS7 C;  4LD9 B;  3C1B C;  5AV9 D;  3B6G C;  1EQZ B;  3B0C T;  5GT3 A;  3MGR A;  3KUY D;  4CSR A;  4XUJ A;  5AV9 C;  4X23 C;  2YFV A;  3REK D;  2CV5 B;  3AZF B;  4KGC A;  3REL A;  2Y2N A;  1P3M B;  2ARO B;  3MNN D;  3REK C;  2YFW A;  3TU4 C;  4H9S A;  5JRG A;  1KX3 B;  3LZ1 A;  4LD9 D;  4JJN A;  2G5I C;  4E44 A;  3EPK A;  1EQZ D;  5DNN B;  4H9P B;  5AV9 A;  5JA4 A;  1P3B B;  2CV5 D;  3AZF D;  4UUZ B;  1EQZ C;  3KUY A;  2F8N B;  5GXQ C;  3REK A;  1P3M D;  2ARO D;  5BNV B;  1KX3 D;  2ZY2 A;  5BO0 A;  4DQY B;  3WTP E;  5B32 G;  5DNM B;  3MNN A;  2BG1 A;  5DNN D;  3AZE B;  4LD9 A;  4ZUX C;  1P3B D;  1EQZ A;  3W97 C;  2NZD B;  1M1A C;  2F8N D;  4WJ3 C;  5DNN C;  1N1J B;  1P3A B;  5F99 C;  4WZS B;  3AZK B;  2Y2Q A;  2CV5 A;  3AZF A;  5AVB B;  5B0Z B;  4WU8 B;  5FUG B;  1P3M A;  2ARO A;  3B0C W;  3H0L C;  5DNM D;  4R8P B;  4J8U B;  2NQB C;  1KX3 A;  1ID3 B;  3WA9 B;  1T3U A;  1TAF B;  2Y2G A;  2NZD D;  2IO5 B;  5DNN A;  3LZ0 C;  4G92 C;  4H9P A;  5CPJ C;  5GT0 B;  3AZE C;  1P3A D;  4Z2M H;  1P3B A;  1P34 C;  4J8V C;  5B40 B;  3AZK D;  4G91 B;  4UUZ A;  5AVB D;  5B0Z D;  2LY8 A;  4WU8 D;  4YS3 B;  2F8N A;  1P3A C;  4R8P D;  5BNV A;  4J8U D;  5AVB C;  2HIO B;  1HTA A;  3AZM B;  1ID3 D;  3WA9 D;  5DNM A;  3AZG C;  3AZE A;  3F6T A;  5GT0 D;  2NZD A;  3WA9 C;  5B40 D;  3AZN C;  3AZI C;  2IO5 C;  4NE3 A;  1N1J A;  4XZQ B;  4YS3 D;  1P3A A;  1KX5 C;  5GT0 C;  3AZJ C;  5B24 B;  1KU5 A;  5B32 B;  4J8W C;  3AZK A;  5AVB A;  5B0Z A;  4WU8 A;  5FUG A;  3REI B;  3UT9 B;  5B40 C;  5B31 C;  3AYW B;  2HIO D;  5BNX B;  3AZM D;  1BH8 B;  1WWI A;  4R8P A;  4J8U A;  3AN2 C;  5CPI B;  1S32 B;  1ID3 A;  3WA9 A;  1TAF A;  3AFA C;  1ULY A;  1KX4 B;  2UWX A;  5GT0 A;  4XZQ D;  4ZBJ B;  5AVC B;  5B40 A;  5B24 D;  5B32 D;  3REI D;  3UT9 D;  3AYW D;  4YS3 A;  3NQU B;  4XZQ C;  1Z2C B;  1AOI C;  2F8N H;  2BYK B;  1HQ3 C;  5B32 C;  3UTB C;  2HIO A;  3AZM A;  3AYW C;  1S32 D;  1M19 B;  1KX4 D;  5E5A C;  5CPI C;  4WV4 B;  1S32 C;  5AVC D;  3X1U B;  1P3K B;  4J8X B;  4XZQ A;  2G5H C;  5C3I B;  2L5A A;  5GT3 C;  5B24 A;  5B32 A;  3MGR C;  2ZY4 A;  3REI A;  3UT9 A;  3AYW A;  1P3I D;  5BNX A;  1BH8 A;  3REL C;  1M19 D;  5CPI A;  1S32 A;  4KHA B;  4AWL B;  3X1U D;  4H9S C;  5JRG C;  3LZ1 C;  3P5J B;  1P3G B;  1KX4 A;  4JJN C;  2Y2K A;  2XD1 A;  1P3K D;  4J8X D;  1F1E A;  3KSY A;  3W99 B;  1PZR A;  3REJ B;  5AVC A;  3AZH B;  3NQU A;  2Y2O A;  3KUY C;  2BYK A;  5B2J B;  4H9R B;  2Y2J A;  5AV8 B;  1M19 A;  1P3G D;  3W99 D;  5B33 B;  4CAY B;  3B0B A;  5GSU B;  3X1U A;  3MNN C;  3REJ D;  3AZH D;  4LD9 C;  4WU9 B;  1P3K A;  4J8X A;  1P3G C;  1P3P B;  5CPK B;  5AV5 B;  3REJ C;  4E45 A;  5B2J D;  2Y2M A;  3KWQ B;  3AZF C;  4H9O B;  5AV8 D;  2CV5 C;  4EO5 B;  2F2A C;  4KHA A;  1P3M C;  2ARO C;  5B33 D;  5GSU D;  1KX3 C;  1P3G A;  1U35 B;  4WU9 D;  2VQR A;  1P3P D;  3H0R C;  1ZLA B;  3W99 A;  3REJ A;  3AZH A;  5CPK D;  3A6N B;  5AV5 D;  5B33 C;  3WKJ B;  1P3B C;  3A1I A;  3C1C B;  2Y2P A;  2Y2L A;  1P3P C;  4NFT A;  1A7W A;  3KWQ D;  2JSS A;  3WTP B;  5B2J A;  1P3L B;  4H9R A;  3X1S B;  4Z66 B;  5BT1 D;  5AV8 A;  2PYO B;  3KWQ C;  3VH6 T;  1U35 D;  5DNM C;  2FFF B;  5B33 A;  4CAY A;  5GSU A;  1ZLA D;  3A6N D;  3WKJ D;  4WU9 A;  3MGQ B;  1P3P A;  1B6W A;  3AV1 B;  3C1C D;  2NZD C;  5CPK A;  4KUD B;  3X1T B;  5AV5 A;  1ZLA C;  3WTP D;  1P3L D;  3X1S D;  4Z66 D;  3AZK C;  3MVD B;  3KWQ A;  3C1C C;  4H9O A;  5B0Z C;  4WU8 C;  2PYO D;  3B6F B;  1JFI B;  3AZL B;  4R8P C;  4J8U C;  4Z66 C;  3REH B;  1U35 A;  3MGQ D;  1ID3 C;  5B1M B;  3AV1 D;  1ZLA A;  5AV6 B;  4KUD D;  3X1T D;  3A6N A;  3WKJ A;  3MGQ C;  3C1C A;  5AY8 B;  3MVD D;  4G91 C;  4YS3 C;  3X1T C;  3EG5 B;  3WTP A;  3KXB B;  1P3L A;  3B6F D;  3X1S A;  3AZL D;  4Z66 A;  2JCH A;  2PYO A;  3MVD C;  3REH D;  5B2I B;  2RVQ D;  2DQN C;  2HIO C;  3AZM C;  5B1M D;  3VH5 T;  3B6F C;  5AV6 D;  3KFU G;  2XD5 A;  3MGQ A;  3AV1 A;  2RVQ C;  5CHL B;  5AY8 D;  4KUD A;  3X1T A;  3VH6 W;  5B0Y B;  4Z5T B;  3KXB D;  5B24 C;  3MVD A;  3LEL B;  1P3I B;  3REI C;  3UT9 C;  5B2I D;  3B6F A;  1JFI A;  3AZL A;  3REH A;  5B1L B;  5B1M A;  5AV6 A;  4M6B A;  1KX4 C;  4H9N B;  5B0Y D;  4Z5T D;  2FJ7 B;  4ZBJ C;  5AY8 A;  5AVC C;  4QLC B;  2JE5 A;  3LEL D;  3EPH A;  1F66 B;  3KXB A;  3B0D B;  3WAA B;  4Z5T C;  5CP6 B;  3LEL C;  3C1B B;  5B2I A;  1P3I C;  5B1L D;  3B6G B;  1M19 C;  1WWS A;  2FJ7 D;  4X23 B;  3FDD A;  3NQJ B;  4QLC D;  3X1U C;  5B0Y A;  1P3K C;  2BYM B;  4Z5T A;  4J8X C;  5C3I C;  4NE5 A;  1F66 D;  3VH5 W;  3WAA D;  3O62 B;  3LEL A;  3TU4 B;  1P3I A;  1P3O B;  4QLC C;  5CP6 D;  3C1B D;  2HUE B;  3B6G D;  3B0D C;  3WAA C;  4NE6 A;  2F8N K;  5B1L A;  1B67 A;  4AWL C;  1BH9 B;  4X23 D;  4H9N A;  2DF4 C;  5GXQ B;  2FJ7 A;  3W99 C;  3AZH C;  4QLC A;  3O62 D;  3TU4 D;  3W98 B;  1P3O D;  1F66 A;  3R45 B;  4H9Q B;  3WAA A;  5CP6 A;  5BS7 A;  3O62 C;  3C1B A;  5B31 G;  5B2J C;  1P3O C;  3UTA B;  4ZUX B;  3B6G A;  2HUE C;  5AV8 C;  3W97 B;  3W96 B;  1M1A B;  5F99 B;  5GXQ D;  4X23 A;  5GSU C;  3NQJ A;  3W98 D;  4WU9 C;  1R4V A;  2BYM A;  3AL0 C;  5CPK C;  1Q9C A;  3O62 A;  2ZY5 A;  5AV5 C;  3TU4 A;  1P3O A;  2NQB B;  3W98 C;  3UTA D;  4ZUX D;  3W97 D;  4EO5 C;  5CPJ B;  3LZ0 B;  4G92 B;  3W96 D;  1M1A D;  4WNN B;  1BH9 A;  5F99 D;  5BT1 C;  4HGA B;  1P34 B;  3UTA C;  4J8V B;  1U35 C;  3X1V B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...