4WU8B

Structure of trptnap-ncp145
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
82
structure length
82
Chain Sequence
b'VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (145-MER)
publication title Stereochemical control of nucleosome targeting by platinum-intercalator antitumor agents.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 27
structure length 82
sequence length 82
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4wu8B00
2FJ7C 4NE6A 3W97A 5AVBD 3B0DB 4G91C 5DNND 2F8ND 3REJB 4Z5TA 3LZ0C 4J8XC 3MGPD 4R8PB 2HUEB 1KU5A 3UTBA 1TAFB 5AV6D 2YFWB 3KUYB 5B2JC 3MGQD 1ULYA 3C1BD 3AZEB 3B6FD 4CAYB 1M1AA 3AYWB 2L5AA 3LJAD 1KX3B 3UTAD 4H9SA 1Q9CA 3W96B 3KXBB 5B31C 1KX5A 1P3GD 4JJNC 3AZKD 1KX4D 4KGCC 4CSRA 3W99C 3AZFC 5CHLB 3C1CB 1P3FC 1F66D 5F99C 3X1TD 3MGSA 3X1VB 3REJA 3WAAD 4J8WA 1HQ3D 1BH9B 5AV5C 4R8PA 4J8UC 1P3OD 4KUDB 5B0ZA 5B40B 4J8VD 5CPJC 2YFWA 3KUYA 4ZUXD 5B0YC 5B1MB 1P3PA 1P34C 4AWLC 5CPIB 3AZMA 5BO0A 3LZ1A 1AOIB 3AYWA 5AVBB 3TU4B 5AV8B 3W96A 5DNNB 2IO5B 3KXBA 1U35D 3W97D 4WU9B 3RELB 1TZYB 3AZHC 5GXQB 3AZLC 3AZIC 3X1SA 4Z5TD 4Z66B 3C1CA 3A6NC 4NE3A 5C3IC 5DNMC 3X1VA 1ID3B 3W98C 5AV6B 5AV9C 3REKC 3UTBD 5B33C 1BH9A 3WA9B 2PYOB 5JRGC 3C1BB 4KUDA 5B40A 1N1JA 3B0CT 3LJAB 3AZJA 3AV1A 3VH5T 5BS7C 1M1AD 1P3PC 5E5AA 5CPIA 2FJ7B 2NQBC 1KX4B 1AOIA 2BYKB 5BT1C 4G91B 3B6GB 1M18A 1KX5D 4WU8C 3TU4A 5AV8A 3X1TB 4J8XB 4UUZB 4WU9A 3WAAB 1TZYA 4NFTA 3MGSD 4Z66A 3REJD 5B1LC 4J8WD 1P3LA 4R8PD 1ID3A 5B2JB 3WKJA 3WA9A 2PYOA 3KUYD 3X1UC 3AZMD 3LZ1D 2F8NH 4JJNB 3AYWD 1U35B 4KGCB 3AZFB 3W96D 1P3FB 3KXBD 5F99B 3LZ0A 4J8XA 3X1SD 5AV5B 3C1CD 4J8UB 3X1VD 3REHC 5G49B 5CPJB 4KHAB 5B2IC 1ZLAC 5B0YB 5B2JA 4KUDD 5B40D 4M6BA 5AY8C 3AZJD 3AV1D 5B32C 2RVQD 5E5AD 5B31A 5CPID 3AN2A 1KX5B 1AOID 3MVDC 4JJNA 4CSRB 1M18D 3AZLB 4KGCA 3W99A 3TU4D 3AZFA 5AV8D 1F1EA 3MGSB 1P3FA 5F99A 5AVCC 3A6NB 5C3IB 5DNMB 4WU9D 3RELD 1TZYD 4J8WB 5GXQD 3KWQC 3REKB 5B33B 4Z66D 5AV5A 4J8UA 5B0ZB 1P3LD 5JRGB 1P3AC 1BH8A 1ID3D 4WV4B 5G49A 4YS3C 4X23C 5CPJA 3WKJD 4KHAA 3AZNC 3WA9D 5B0YA 3UT9C 2PYOD 1P3PB 3UTAC 3AZMB 5BO0B 3LZ1B 3REIC 1P34A 4ZBJC 2NQBB 4WU8B 4LD9C 3AN2C 1P3BC 2FJ7D 3B6GD 3AZHA 3AZLA 3X1SB 3AZIA 3LZ0D 5B1LB 4J8XD 4XUJC 5DNMA 3A6NA 4Z2MH 3W98A 5AV9A 3REKA 2HIOC 5B33A 5B24C 4EO5B 5JRGA 4XZQA 1N1JB 5B2JD 3AZJB 3AV1B 5GSUC 4QLCC 3X1UB 3AZGC 5BS7A 5E5AB 2NQBA 4DRBA 1M18B 5B31D 3NQJB 4WU8A 4JJND 4G92C 3O62C 4KGCD 5B31G 3W99D 3AZFD 2CV5C 1P3FD 3MGRC 5F99D 2NZDC 4HGAC 3REHB 5B1LA 1WWSA 1P3LB 5AV5D 5B2IB 4J8UD 1P3MC 3WKJB 4YM6C 5AY8B 5CPJD 4XZQC 4E44A 5B0YD 5B32B 1P34D 3X1UA 1JFIA 1S32C 4H9OB 3MNNC 1P3IC 5AVCB 3NQJA 3LZ0B 3AZHD 3AZLD 3AZID 3NQUB 5CP6C 3A6ND 5DNMD 3REHA 3W98D 5AV9D 4X23B 3REKD 5B33D 5KDMB 3AZNB 5B2IA 1ZLAA 5B0ZD 5JRGD 3REIB 5AY8A 3AZEC 3AV2C 5GT0A 1R4VA 5B32A 2JSSA 1P3PD 1KX3C 3AFAA 5B31B 4LD9B 3AN2B 1P3BB 3LELC 2NQBD 2F8NA 2AROC 4H9RA 5BT1D 3MVDA 3W99B 4WU8D 4H9OA 3VH6A 5AVCA 4XUJB 3WTPC 5BNVB 1P3KC 3KWQA 2HIOB 5GT3C 5B24B 3NQUA 5B1LD 1BH8B 1P3AA 3V9RB 4YS3A 4X23A 5KDMA 3AZNA 4QLCB 3UT9A 5CPKC 1P34B 3B0BA 4AWLB 3UTAA 3REIA 5B1MC 5GT0C 1M19C 1EQZC 1B67A 3X1UD 3AZKA 3AFAC 4G92B 4LD9A 5AVBC 1P3BA 5DNNC 5JA4B 3AZHB 3AZIB 4HGAB 3RELC 2NZDB 5GXQC 3MGPC 4XUJA 3W98B 5AV9B 4H9QA 5BNVA 1P3MB 5AV6C 2HIOA 5B24A 3VH6W 3REHD 4XZQB 3MGQC 5B2ID 3V9RA 3C1BC 1ZLAD 3B6FC 5BNXA 5GSUA 3KSYA 5AY8D 4QLCA 3AZGA 3LJAC 2BYMB 4DRAA 4NE5A 5B32D 1P3IB 1P3GC 3AZKC 1KX4C 1BFMA 5B32G 3B6GC 3MVDD 3O62A 1F66C 2F8NK 3X1TC 2F8NG 5JA4A 2CV5A 5CP6B 3MGRA 5AVCD 3WAAC 2NZDA 1HQ3C 3KWQD 2CWEA 1P3OC 1HTAA 1H3OB 3WTPE 1P3MA 4YM6A 4J8VC 1P3AD 4YS3D 4X23D 3AV2B 4ZUXC 3AZND 3R45B 3UT9D 3REID 4E45A 3LELB 1JFIB 2BYMA 2AROB 1S32A 1U35C 3MNNA 4LD9D 4H9NB 1P3IA 3W97C 3AN2D 1P3BD 3WTPB 3VH5A 1P3KB 4Z5TC 5GT3B 5FUGB 5CP6A 4XUJD 3UTBC 2HIOD 5B24D 1ZLAB 1TAFA 1H3OA 5CPKB 5GT0B 3AZEA 1M19B 3AV2A 5GSUD 1M1AC 4QLCD 1EQZB 3R45A 4CAYA 3AZGD 3AFAB 4H9SC 1KX3A 4WZSB 3LELA 2YFVB 3MVDB 4H9RB 2F8NB 1KX5C 2AROA 4H9NA 3O62D 3MGPB 3B0DC 3MGSC 2CV5D 3WTPA 3KWQB 3MGRD 3REJC 1P3KA 1A7WA 2NZDD 4J8WC 5GT3A 5FUGA 3B0CW 4R8PC 2HUEC 1P3AB 3MGQB 5B0ZC 3VH5W 4YS3B 1P3MD 4YM6D 3B6FB 3UT9B 3KUYC 4Z2MG 4XZQD 5CPKA 3UTAB 4ZBJB 5B1MA 1M19A 3AZMC 3LZ1C 1P3GB 1EQZA 3AZKB 3AYWC 3W96C 1S32D 5AVBA 3KXBC 1F66B 3MNND 5DNNA 2YFVA 1P3ID 4WNNB 3RELA 1HQ3B 5GXQA 3MGPA 3X1SC 3C1CC 1B6WA 3X1VC 1P3OB 4H9QB 5CP6D 4J8VB 5AV6A 4H9PB 4ZUXB 4EO5C 3MGQA 4KUDC 5BNXB 3C1BA 5B40C 3B6FA 5GSUB 3AZGB 3AZED 3AZJC 3AV1C 3AV2D 3LJAA 2RVQC 5E5AC 5CPIC 1KX3D 1AOIC 2FJ7A 1P3GA 3W97B 3LELD 1KX4A 2BYKA 1M18C 3O62B 3B6GA 2AROD 3TU4C 5AV8C 4Z5TB 2IO5C 1F66A 2CV5B 3X1TA 3MGRB 2LY8A 4WNNA 4UUZA 4WU9C 1TZYC 3WAAA 1HQ3A 3WTPD 3UTBB 4Z66C 1P3KD 5GT3D 1P3LC 1P3OA 4YM6B 1ID3C 4J8VA 3WKJC 3WA9C 4H9PA 4ZUXA 2PYOC 1M1AB 1WWIA 5CPKD 3VH6T 5B1MD 5GT0D 1M19D 1EQZD 1S32B 3MNNB 3AFAD 1U35A
chains in the Genus database with same CATH superfamily
2FJ7C 4NE6A 3W97A 5AVBD 3B0DB 4G91C 5DNND 2F8ND 3REJB 4Z5TA 3LZ0C 4J8XC 3MGPD 2Y2JA 4R8PB 2HUEB 1KU5A 2Y2LA 3UTBA 1TAFB 5AV6D 2YFWB 3KUYB 5B2JC 3A1KA 3MGQD 1ULYA 3C1BD 3AZEB 3B6FD 4CAYB 1M1AA 3AYWB 2L5AA 3LJAD 1KX3B 3UTAD 4H9SA 1Q9CA 3W96B 3KXBB 5B31C 1KX5A 1P3GD 4JJNC 3AZKD 1KX4D 4KGCC 4CSRA 3W99C 3AZFC 5CHLB 3C1CB 1P3FC 1F66D 2JCHA 5F99C 3X1TD 3MGSA 3X1VB 3REJA 3WAAD 4J8WA 1HQ3D 1BH9B 5AV5C 4R8PA 4J8UC 1P3OD 4KUDB 5B0ZA 5B40B 4J8VD 5CPJC 2YFWA 3KUYA 4ZUXD 2XD1A 5B0YC 5B1MB 1P3PA 1P34C 4AWLC 5CPIB 2F2AC 5BO0A 3LZ1A 3AZMA 1AOIB 3AYWA 3EPLA 5AVBB 3TU4B 5AV8B 3EPHA 3W96A 5DNNB 2IO5B 3KXBA 1U35D 3W97D 4WU9B 3H0MC 3RELB 1TZYB 3AZHC 5GXQB 3AZLC 3AZIC 3X1SA 4Z5TD 4Z66B 3C1CA 3A6NC 4NE3A 5C3IC 5DNMC 3X1VA 1ID3B 2ZY5A 5AV6B 3W98C 5AV9C 3REKC 3UTBD 5B33C 1BH9A 3WA9B 2PYOB 5JRGC 3C1BB 4KUDA 5B40A 1N1JA 2Y2PA 3B0CT 3EPKA 3LJAB 3AZJA 3AV1A 3VH5T 5BS7C 1M1AD 1P3PC 5E5AA 5CPIA 2FJ7B 2NQBC 1KX4B 1AOIA 2BYKB 5BT1C 4G91B 3B6GB 1M18A 1KX5D 4WU8C 3TU4A 5AV8A 3X1TB 4J8XB 4UUZB 3EPJA 4WU9A 3WAAB 2RIQA 1TZYA 4NFTA 3MGSD 1T3UA 4Z66A 3REJD 5B1LC 4J8WD 1P3LA 4R8PD 1ID3A 5B2JB 3WKJA 3WA9A 2PYOA 3KUYD 3X1UC 3AZMD 3A1IA 3LZ1D 2F8NH 4JJNB 3AYWD 1U35B 4KGCB 3AZFB 3W96D 1P3FB 3KXBD 5F99B 3LZ0A 4J8XA 3X1SD 5AV5B 3C1CD 4J8UB 3X1VD 3REHC 5G49B 5CPJB 4KHAB 5B2IC 1ZLAC 5B0YB 5B2JA 4KUDD 5B40D 2Y2QA 4M6BA 5AY8C 3AL0C 3AZJD 3AV1D 5B32C 2RVQD 5E5AD 5B31A 5CPID 3AN2A 1KX5B 1AOID 2FFFB 3MVDC 4JJNA 4CSRB 1M18D 3AZLB 4KGCA 3W99A 3TU4D 3AZFA 5AV8D 1F1EA 3MGSB 1P3FA 5F99A 5AVCC 3A6NB 5C3IB 5DNMB 4WU9D 3RELD 1TZYD 4J8WB 5GXQD 3KWQC 3REKB 5B33B 4Z66D 5AV5A 4J8UA 5B0ZB 1P3LD 5JRGB 1P3AC 1BH8A 1ID3D 4WV4B 5G49A 4YS3C 4X23C 5CPJA 3WKJD 4KHAA 3AZNC 3WA9D 5B0YA 3UT9C 2PYOD 1P3PB 3UTAC 3AZMB 5BO0B 3LZ1B 3REIC 1P34A 4ZBJC 2NQBB 3EG5B 4WU8B 4LD9C 3AN2C 1P3BC 2UWXA 2FJ7D 3B6GD 3AZHA 3AZLA 3X1SB 3AZIA 3LZ0D 5B1LB 4J8XD 3IP4C 4XUJC 5DNMA 2Y2OA 3A6NA 2ZY3A 4Z2MH 3W98A 5AV9A 3REKA 2HIOC 5B33A 5B24C 4EO5B 5JRGA 4XZQA 1N1JB 5B2JD 3AZJB 3AV1B 5GSUC 4QLCC 3X1UB 3AZGC 5BS7A 5E5AB 2NQBA 4DRBA 1M18B 5B31D 3KFUG 3NQJB 4WU8A 4JJND 4G92C 3O62C 4KGCD 5B31G 3W99D 3AZFD 2CV5C 1P3FD 3MGRC 5F99D 2NZDC 4HGAC 3REHB 5B1LA 1WWSA 1P3LB 5AV5D 5B2IB 4J8UD 1P3MC 3WKJB 4YM6C 5AY8B 5CPJD 4XZQC 4E44A 2ZY4A 5B0YD 5B32B 1P34D 3X1UA 1JFIA 2ZM5A 1S32C 4H9OB 3MNNC 1P3IC 1Z2CB 5AVCB 3NQJA 3LZ0B 3AZHD 3AZLD 3AZID 2Y2MA 3NQUB 5CP6C 1W2EA 5DNMD 3A6ND 3REHA 3W98D 5AV9D 4X23B 3REKD 5B33D 5KDMB 3AZNB 4UPKA 5B2IA 1ZLAA 5B0ZD 5JRGD 3REIB 5AY8A 3AZEC 3AV2C 5GT0A 1R4VA 5B32A 2JSSA 1P3PD 1KX3C 3AFAA 5B31B 4LD9B 3AN2B 1P3BB 3LELC 2NQBD 2DQNC 2F8NA 2AROC 4H9RA 5BT1D 3MVDA 3W99B 4WU8D 4H9OA 3VH6A 5AVCA 4XUJB 3WTPC 5BNVB 1P3KC 3KWQA 2HIOB 5GT3C 5B24B 3NQUA 5B1LD 3P5JB 1BH8B 1P3AA 3V9RB 2W8SA 4YS3A 4X23A 5KDMA 3AZNA 4QLCB 2DF4C 3UT9A 5CPKC 1P34B 3B0BA 4AWLB 3UTAA 3REIA 5B1MC 5GT0C 1M19C 1EQZC 1B67A 3X1UD 2Y2HA 3AZKA 3AFAC 4G92B 4LD9A 5AVBC 1P3BA 5DNNC 5JA4B 2Y2IA 3AZHB 3AZIB 4HGAB 3RELC 2NZDB 5GXQC 3MGPC 4XUJA 4DQYB 3W98B 5AV9B 4H9QA 5BNVA 1P3MB 5AV6C 2HIOA 5B24A 3H0LC 3VH6W 3REHD 4XZQB 3MGQC 5B2ID 3V9RA 3C1BC 1ZLAD 3B6FC 5BNXA 5GSUA 3KSYA 5AY8D 4QLCA 3AZGA 3LJAC 2BYMB 4DRAA 4NE5A 5B32D 1P3IB 1P3GC 3AZKC 1KX4C 1BFMA 5B32G 3B6GC 3MVDD 3O62A 1F66C 2F8NK 3X1TC 2F8NG 5JA4A 2CV5A 5CP6B 3MGRA 5AVCD 3WAAC 2NZDA 4WJ3C 1HQ3C 3KWQD 2CWEA 1P3OC 1HTAA 1H3OB 3WTPE 1P3MA 4YM6A 4J8VC 1P3AD 4YS3D 4X23D 3AV2B 4ZUXC 3AZND 3R45B 2Y2GA 3UT9D 3REID 4E45A 3LELB 1JFIB 2BYMA 2Y2NA 2AROB 1S32A 1U35C 3MNNA 4LD9D 4H9NB 1P3IA 3W97C 3AN2D 1P3BD 3FDDA 3WTPB 3VH5A 1P3KB 4Z5TC 5GT3B 5FUGB 5CP6A 4XUJD 3UTBC 2HIOD 5B24D 1ZLAB 1TAFA 2JE5A 1H3OA 5CPKB 2J8PA 5GT0B 3AZEA 1M19B 3AV2A 5GSUD 1M1AC 4QLCD 1EQZB 2G5IC 3R45A 4CAYA 3AZGD 3AFAB 4H9SC 1KX3A 4WZSB 1PZRA 3LELA 2YFVB 3MVDB 4H9RB 2F8NB 1KX5C 2AROA 4H9NA 3O62D 3MGPB 3F6TA 3B0DC 3MGSC 2CV5D 3WTPA 3KWQB 3MGRD 3REJC 1P3KA 1A7WA 2NZDD 4J8WC 5GT3A 5FUGA 3B0CW 4R8PC 2HUEC 1P3AB 3MGQB 5B0ZC 2G5HC 3VH5W 4YS3B 1P3MD 4YM6D 3B6FB 3UT9B 3KUYC 4Z2MG 4XZQD 5CPKA 3UTAB 4ZBJB 5B1MA 1M19A 3AZMC 3LZ1C 1P3GB 1EQZA 3AZKB 3AYWC 3W96C 1S32D 5AVBA 3KXBC 1F66B 3MNND 5DNNA 2YFVA 1P3ID 4WNNB 3RELA 1HQ3B 2VQRA 5GXQA 3MGPA 3X1SC 3C1CC 1B6WA 3X1VC 1P3OB 4H9QB 5CP6D 4J8VB 5AV6A 4H9PB 4ZUXB 4EO5C 3MGQA 4KUDC 5BNXB 3C1BA 5B40C 2XD5A 3B6FA 5GSUB 3AZGB 3AZED 3AZJC 3AV1C 3AV2D 3LJAA 2RVQC 5E5AC 2BG1A 5CPIC 1KX3D 1AOIC 2FJ7A 1P3GA 3W97B 3LELD 1KX4A 2BYKA 1M18C 3O62B 3B6GA 2AROD 3TU4C 5AV8C 4Z5TB 2IO5C 1F66A 2CV5B 3X1TA 3MGRB 2LY8A 4WNNA 4UUZA 4WU9C 1TZYC 3WAAA 1HQ3A 3WTPD 3UTBB 4Z66C 1P3KD 5GT3D 1P3LC 1P3OA 3H0RC 4YM6B 1ID3C 4J8VA 3WKJC 3WA9C 2ZY2A 4H9PA 4ZUXA 2PYOC 1M1AB 1WWIA 5CPKD 3VH6T 5B1MD 5GT0D 1M19D 1EQZD 1S32B 3MNNB 2Y2KA 3AFAD 1U35A
chains in the Genus database with same CATH topology
2FJ7C 4NE6A 3W97A 5AVBD 3B0DB 4G91C 5DNND 2F8ND 3REJB 4Z5TA 3LZ0C 4J8XC 3MGPD 2Y2JA 4R8PB 2HUEB 1KU5A 2Y2LA 3UTBA 1TAFB 5AV6D 2YFWB 3KUYB 5B2JC 3A1KA 3MGQD 1ULYA 3C1BD 3AZEB 3B6FD 4CAYB 1M1AA 3AYWB 2L5AA 3LJAD 1KX3B 3UTAD 4H9SA 1Q9CA 3W96B 3KXBB 5B31C 1KX5A 1P3GD 4JJNC 3AZKD 1KX4D 4KGCC 4CSRA 3W99C 3AZFC 5CHLB 3C1CB 1P3FC 1F66D 2JCHA 5F99C 3X1TD 3MGSA 3X1VB 3REJA 3WAAD 4J8WA 1HQ3D 1BH9B 5AV5C 4R8PA 4J8UC 1P3OD 4KUDB 5B0ZA 5B40B 4J8VD 5CPJC 2YFWA 3KUYA 4ZUXD 2XD1A 5B0YC 5B1MB 1P3PA 1P34C 4AWLC 5CPIB 2F2AC 5BO0A 3LZ1A 3AZMA 1AOIB 3AYWA 3EPLA 5AVBB 3TU4B 5AV8B 3EPHA 3W96A 5DNNB 2IO5B 3KXBA 1U35D 3W97D 4WU9B 3H0MC 3RELB 1TZYB 3AZHC 5GXQB 3AZLC 3AZIC 3X1SA 4Z5TD 4Z66B 3C1CA 3A6NC 4NE3A 5C3IC 5DNMC 3X1VA 1ID3B 2ZY5A 5AV6B 3W98C 5AV9C 3REKC 3UTBD 5B33C 1BH9A 3WA9B 2PYOB 5JRGC 3C1BB 4KUDA 5B40A 1N1JA 2Y2PA 3B0CT 3EPKA 3LJAB 3AZJA 3AV1A 3VH5T 5BS7C 1M1AD 1P3PC 5E5AA 5CPIA 2FJ7B 2NQBC 1KX4B 1AOIA 2BYKB 5BT1C 4G91B 3B6GB 1M18A 1KX5D 4WU8C 3TU4A 5AV8A 3X1TB 4J8XB 4UUZB 3EPJA 4WU9A 3WAAB 2RIQA 1TZYA 4NFTA 3MGSD 1T3UA 4Z66A 3REJD 5B1LC 4J8WD 1P3LA 4R8PD 1ID3A 5B2JB 3WKJA 3WA9A 2PYOA 3KUYD 3X1UC 3AZMD 3A1IA 3LZ1D 2F8NH 4JJNB 3AYWD 1U35B 4KGCB 3AZFB 3W96D 1P3FB 3KXBD 5F99B 3LZ0A 4J8XA 3X1SD 5AV5B 3C1CD 4J8UB 3X1VD 3REHC 5G49B 5CPJB 4KHAB 5B2IC 1ZLAC 5B0YB 5B2JA 4KUDD 5B40D 2Y2QA 4M6BA 5AY8C 3AL0C 3AZJD 3AV1D 5B32C 2RVQD 5E5AD 5B31A 5CPID 3AN2A 1KX5B 1AOID 2FFFB 3MVDC 4JJNA 4CSRB 1M18D 3AZLB 4KGCA 3W99A 3TU4D 3AZFA 5AV8D 1F1EA 3MGSB 1P3FA 5F99A 5AVCC 3A6NB 5C3IB 5DNMB 4WU9D 3RELD 1TZYD 4J8WB 5GXQD 3KWQC 3REKB 5B33B 4Z66D 5AV5A 4J8UA 5B0ZB 1P3LD 5JRGB 1P3AC 1BH8A 1ID3D 4WV4B 5G49A 4YS3C 4X23C 5CPJA 3WKJD 4KHAA 3AZNC 3WA9D 5B0YA 3UT9C 2PYOD 1P3PB 3UTAC 3AZMB 5BO0B 3LZ1B 3REIC 1P34A 4ZBJC 2NQBB 3EG5B 4WU8B 4LD9C 3AN2C 1P3BC 2UWXA 2FJ7D 3B6GD 3AZHA 3AZLA 3X1SB 3AZIA 3LZ0D 5B1LB 4J8XD 3IP4C 4XUJC 5DNMA 2Y2OA 3A6NA 2ZY3A 4Z2MH 3W98A 5AV9A 3REKA 2HIOC 5B33A 5B24C 4EO5B 5JRGA 4XZQA 1N1JB 5B2JD 3AZJB 3AV1B 5GSUC 4QLCC 3X1UB 3AZGC 5BS7A 5E5AB 2NQBA 4DRBA 1M18B 5B31D 3KFUG 3NQJB 4WU8A 4JJND 4G92C 3O62C 4KGCD 5B31G 3W99D 3AZFD 2CV5C 1P3FD 3MGRC 5F99D 2NZDC 4HGAC 3REHB 5B1LA 1WWSA 1P3LB 5AV5D 5B2IB 4J8UD 1P3MC 3WKJB 4YM6C 5AY8B 5CPJD 4XZQC 4E44A 2ZY4A 5B0YD 5B32B 1P34D 3X1UA 1JFIA 2ZM5A 1S32C 4H9OB 3MNNC 1P3IC 1Z2CB 5AVCB 3NQJA 3LZ0B 3AZHD 3AZLD 3AZID 2Y2MA 3NQUB 5CP6C 1W2EA 5DNMD 3A6ND 3REHA 3W98D 5AV9D 4X23B 3REKD 5B33D 5KDMB 3AZNB 4UPKA 5B2IA 1ZLAA 5B0ZD 5JRGD 3REIB 5AY8A 3AZEC 3AV2C 5GT0A 1R4VA 5B32A 2JSSA 1P3PD 1KX3C 3AFAA 5B31B 4LD9B 3AN2B 1P3BB 3LELC 2NQBD 2DQNC 2F8NA 2AROC 4H9RA 5BT1D 3MVDA 3W99B 4WU8D 4H9OA 3VH6A 5AVCA 4XUJB 3WTPC 5BNVB 1P3KC 3KWQA 2HIOB 5GT3C 5B24B 3NQUA 5B1LD 3P5JB 1BH8B 1P3AA 3V9RB 2W8SA 4YS3A 4X23A 5KDMA 3AZNA 4QLCB 2DF4C 3UT9A 5CPKC 1P34B 3B0BA 4AWLB 3UTAA 3REIA 5B1MC 5GT0C 1M19C 1EQZC 1B67A 3X1UD 2Y2HA 3AZKA 3AFAC 4G92B 4LD9A 5AVBC 1P3BA 5DNNC 5JA4B 2Y2IA 3AZHB 3AZIB 4HGAB 3RELC 2NZDB 5GXQC 3MGPC 4XUJA 4DQYB 3W98B 5AV9B 4H9QA 5BNVA 1P3MB 5AV6C 2HIOA 5B24A 3H0LC 3VH6W 3REHD 4XZQB 3MGQC 5B2ID 3V9RA 3C1BC 1ZLAD 3B6FC 5BNXA 5GSUA 3KSYA 5AY8D 4QLCA 3AZGA 3LJAC 2BYMB 4DRAA 4NE5A 5B32D 1P3IB 1P3GC 3AZKC 1KX4C 1BFMA 5B32G 3B6GC 3MVDD 3O62A 1F66C 2F8NK 3X1TC 2F8NG 5JA4A 2CV5A 5CP6B 3MGRA 5AVCD 3WAAC 2NZDA 4WJ3C 1HQ3C 3KWQD 2CWEA 1P3OC 1HTAA 1H3OB 3WTPE 1P3MA 4YM6A 4J8VC 1P3AD 4YS3D 4X23D 3AV2B 4ZUXC 3AZND 3R45B 2Y2GA 3UT9D 3REID 4E45A 3LELB 1JFIB 2BYMA 2Y2NA 2AROB 1S32A 1U35C 3MNNA 4LD9D 4H9NB 1P3IA 3W97C 3AN2D 1P3BD 3FDDA 3WTPB 3VH5A 1P3KB 4Z5TC 5GT3B 5FUGB 5CP6A 4XUJD 3UTBC 2HIOD 5B24D 1ZLAB 1TAFA 2JE5A 1H3OA 5CPKB 2J8PA 5GT0B 3AZEA 1M19B 3AV2A 5GSUD 1M1AC 4QLCD 1EQZB 2G5IC 3R45A 4CAYA 3AZGD 3AFAB 4H9SC 1KX3A 4WZSB 1PZRA 3LELA 2YFVB 3MVDB 4H9RB 2F8NB 1KX5C 2AROA 4H9NA 3O62D 3MGPB 3F6TA 3B0DC 3MGSC 2CV5D 3WTPA 3KWQB 3MGRD 3REJC 1P3KA 1A7WA 2NZDD 4J8WC 5GT3A 5FUGA 3B0CW 4R8PC 2HUEC 1P3AB 3MGQB 5B0ZC 2G5HC 3VH5W 4YS3B 1P3MD 4YM6D 3B6FB 3UT9B 3KUYC 4Z2MG 4XZQD 5CPKA 3UTAB 4ZBJB 5B1MA 1M19A 3AZMC 3LZ1C 1P3GB 1EQZA 3AZKB 3AYWC 3W96C 1S32D 5AVBA 3KXBC 1F66B 3MNND 5DNNA 2YFVA 1P3ID 4WNNB 3RELA 1HQ3B 2VQRA 5GXQA 3MGPA 3X1SC 3C1CC 1B6WA 3X1VC 1P3OB 4H9QB 5CP6D 4J8VB 5AV6A 4H9PB 4ZUXB 4EO5C 3MGQA 4KUDC 5BNXB 3C1BA 5B40C 2XD5A 3B6FA 5GSUB 3AZGB 3AZED 3AZJC 3AV1C 3AV2D 3LJAA 2RVQC 5E5AC 2BG1A 5CPIC 1KX3D 1AOIC 2FJ7A 1P3GA 3W97B 3LELD 1KX4A 2BYKA 1M18C 3O62B 3B6GA 2AROD 3TU4C 5AV8C 4Z5TB 2IO5C 1F66A 2CV5B 3X1TA 3MGRB 2LY8A 4WNNA 4UUZA 4WU9C 1TZYC 3WAAA 1HQ3A 3WTPD 3UTBB 4Z66C 1P3KD 5GT3D 1P3LC 1P3OA 3H0RC 4YM6B 1ID3C 4J8VA 3WKJC 3WA9C 2ZY2A 4H9PA 4ZUXA 2PYOC 1M1AB 1WWIA 5CPKD 3VH6T 5B1MD 5GT0D 1M19D 1EQZD 1S32B 3MNNB 2Y2KA 3AFAD 1U35A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FJ7 C;  4NE6 A;  3W97 A;  5AVB D;  3B0D B;  4G91 C;  5DNN D;  2F8N D;  3REJ B;  4Z5T A;  3LZ0 C;  4J8X C;  3MGP D;  4R8P B;  2HUE B;  1KU5 A;  3UTB A;  1TAF B;  5AV6 D;  2YFW B;  3KUY B;  5B2J C;  3MGQ D;  1ULY A;  3C1B D;  3AZE B;  3B6F D;  4CAY B;  1M1A A;  3AYW B;  2L5A A;  3LJA D;  1KX3 B;  3UTA D;  4H9S A;  1Q9C A;  3W96 B;  3KXB B;  5B31 C;  1KX5 A;  1P3G D;  4JJN C;  3AZK D;  1KX4 D;  4KGC C;  4CSR A;  3W99 C;  3AZF C;  5CHL B;  3C1C B;  1P3F C;  1F66 D;  5F99 C;  3X1T D;  3MGS A;  3X1V B;  3REJ A;  3WAA D;  4J8W A;  1HQ3 D;  1BH9 B;  5AV5 C;  4R8P A;  4J8U C;  1P3O D;  4KUD B;  5B0Z A;  5B40 B;  4J8V D;  5CPJ C;  2YFW A;  3KUY A;  4ZUX D;  5B0Y C;  5B1M B;  1P3P A;  1P34 C;  4AWL C;  5CPI B;  3AZM A;  5BO0 A;  3LZ1 A;  1AOI B;  3AYW A;  5AVB B;  3TU4 B;  5AV8 B;  3W96 A;  5DNN B;  2IO5 B;  3KXB A;  1U35 D;  3W97 D;  4WU9 B;  3REL B;  1TZY B;  3AZH C;  5GXQ B;  3AZL C;  3AZI C;  3X1S A;  4Z5T D;  4Z66 B;  3C1C A;  3A6N C;  4NE3 A;  5C3I C;  5DNM C;  3X1V A;  1ID3 B;  3W98 C;  5AV6 B;  5AV9 C;  3REK C;  3UTB D;  5B33 C;  1BH9 A;  3WA9 B;  2PYO B;  5JRG C;  3C1B B;  4KUD A;  5B40 A;  1N1J A;  3B0C T;  3LJA B;  3AZJ A;  3AV1 A;  3VH5 T;  5BS7 C;  1M1A D;  1P3P C;  5E5A A;  5CPI A;  2FJ7 B;  2NQB C;  1KX4 B;  1AOI A;  2BYK B;  5BT1 C;  4G91 B;  3B6G B;  1M18 A;  1KX5 D;  4WU8 C;  3TU4 A;  5AV8 A;  3X1T B;  4J8X B;  4UUZ B;  4WU9 A;  3WAA B;  1TZY A;  4NFT A;  3MGS D;  4Z66 A;  3REJ D;  5B1L C;  4J8W D;  1P3L A;  4R8P D;  1ID3 A;  5B2J B;  3WKJ A;  3WA9 A;  2PYO A;  3KUY D;  3X1U C;  3AZM D;  3LZ1 D;  2F8N H;  4JJN B;  3AYW D;  1U35 B;  4KGC B;  3AZF B;  3W96 D;  1P3F B;  3KXB D;  5F99 B;  3LZ0 A;  4J8X A;  3X1S D;  5AV5 B;  3C1C D;  4J8U B;  3X1V D;  3REH C;  5G49 B;  5CPJ B;  4KHA B;  5B2I C;  1ZLA C;  5B0Y B;  5B2J A;  4KUD D;  5B40 D;  4M6B A;  5AY8 C;  3AZJ D;  3AV1 D;  5B32 C;  2RVQ D;  5E5A D;  5B31 A;  5CPI D;  3AN2 A;  1KX5 B;  1AOI D;  3MVD C;  4JJN A;  4CSR B;  1M18 D;  3AZL B;  4KGC A;  3W99 A;  3TU4 D;  3AZF A;  5AV8 D;  1F1E A;  3MGS B;  1P3F A;  5F99 A;  5AVC C;  3A6N B;  5C3I B;  5DNM B;  4WU9 D;  3REL D;  1TZY D;  4J8W B;  5GXQ D;  3KWQ C;  3REK B;  5B33 B;  4Z66 D;  5AV5 A;  4J8U A;  5B0Z B;  1P3L D;  5JRG B;  1P3A C;  1BH8 A;  1ID3 D;  4WV4 B;  5G49 A;  4YS3 C;  4X23 C;  5CPJ A;  3WKJ D;  4KHA A;  3AZN C;  3WA9 D;  5B0Y A;  3UT9 C;  2PYO D;  1P3P B;  3UTA C;  3AZM B;  5BO0 B;  3LZ1 B;  3REI C;  1P34 A;  4ZBJ C;  2NQB B;  4WU8 B;  4LD9 C;  3AN2 C;  1P3B C;  2FJ7 D;  3B6G D;  3AZH A;  3AZL A;  3X1S B;  3AZI A;  3LZ0 D;  5B1L B;  4J8X D;  4XUJ C;  5DNM A;  3A6N A;  4Z2M H;  3W98 A;  5AV9 A;  3REK A;  2HIO C;  5B33 A;  5B24 C;  4EO5 B;  5JRG A;  4XZQ A;  1N1J B;  5B2J D;  3AZJ B;  3AV1 B;  5GSU C;  4QLC C;  3X1U B;  3AZG C;  5BS7 A;  5E5A B;  2NQB A;  4DRB A;  1M18 B;  5B31 D;  3NQJ B;  4WU8 A;  4JJN D;  4G92 C;  3O62 C;  4KGC D;  5B31 G;  3W99 D;  3AZF D;  2CV5 C;  1P3F D;  3MGR C;  5F99 D;  2NZD C;  4HGA C;  3REH B;  5B1L A;  1WWS A;  1P3L B;  5AV5 D;  5B2I B;  4J8U D;  1P3M C;  3WKJ B;  4YM6 C;  5AY8 B;  5CPJ D;  4XZQ C;  4E44 A;  5B0Y D;  5B32 B;  1P34 D;  3X1U A;  1JFI A;  1S32 C;  4H9O B;  3MNN C;  1P3I C;  5AVC B;  3NQJ A;  3LZ0 B;  3AZH D;  3AZL D;  3AZI D;  3NQU B;  5CP6 C;  3A6N D;  5DNM D;  3REH A;  3W98 D;  5AV9 D;  4X23 B;  3REK D;  5B33 D;  5KDM B;  3AZN B;  5B2I A;  1ZLA A;  5B0Z D;  5JRG D;  3REI B;  5AY8 A;  3AZE C;  3AV2 C;  5GT0 A;  1R4V A;  5B32 A;  2JSS A;  1P3P D;  1KX3 C;  3AFA A;  5B31 B;  4LD9 B;  3AN2 B;  1P3B B;  3LEL C;  2NQB D;  2F8N A;  2ARO C;  4H9R A;  5BT1 D;  3MVD A;  3W99 B;  4WU8 D;  4H9O A;  3VH6 A;  5AVC A;  4XUJ B;  3WTP C;  5BNV B;  1P3K C;  3KWQ A;  2HIO B;  5GT3 C;  5B24 B;  3NQU A;  5B1L D;  1BH8 B;  1P3A A;  3V9R B;  4YS3 A;  4X23 A;  5KDM A;  3AZN A;  4QLC B;  3UT9 A;  5CPK C;  1P34 B;  3B0B A;  4AWL B;  3UTA A;  3REI A;  5B1M C;  5GT0 C;  1M19 C;  1EQZ C;  1B67 A;  3X1U D;  3AZK A;  3AFA C;  4G92 B;  4LD9 A;  5AVB C;  1P3B A;  5DNN C;  5JA4 B;  3AZH B;  3AZI B;  4HGA B;  3REL C;  2NZD B;  5GXQ C;  3MGP C;  4XUJ A;  3W98 B;  5AV9 B;  4H9Q A;  5BNV A;  1P3M B;  5AV6 C;  2HIO A;  5B24 A;  3VH6 W;  3REH D;  4XZQ B;  3MGQ C;  5B2I D;  3V9R A;  3C1B C;  1ZLA D;  3B6F C;  5BNX A;  5GSU A;  3KSY A;  5AY8 D;  4QLC A;  3AZG A;  3LJA C;  2BYM B;  4DRA A;  4NE5 A;  5B32 D;  1P3I B;  1P3G C;  3AZK C;  1KX4 C;  1BFM A;  5B32 G;  3B6G C;  3MVD D;  3O62 A;  1F66 C;  2F8N K;  3X1T C;  2F8N G;  5JA4 A;  2CV5 A;  5CP6 B;  3MGR A;  5AVC D;  3WAA C;  2NZD A;  1HQ3 C;  3KWQ D;  2CWE A;  1P3O C;  1HTA A;  1H3O B;  3WTP E;  1P3M A;  4YM6 A;  4J8V C;  1P3A D;  4YS3 D;  4X23 D;  3AV2 B;  4ZUX C;  3AZN D;  3R45 B;  3UT9 D;  3REI D;  4E45 A;  3LEL B;  1JFI B;  2BYM A;  2ARO B;  1S32 A;  1U35 C;  3MNN A;  4LD9 D;  4H9N B;  1P3I A;  3W97 C;  3AN2 D;  1P3B D;  3WTP B;  3VH5 A;  1P3K B;  4Z5T C;  5GT3 B;  5FUG B;  5CP6 A;  4XUJ D;  3UTB C;  2HIO D;  5B24 D;  1ZLA B;  1TAF A;  1H3O A;  5CPK B;  5GT0 B;  3AZE A;  1M19 B;  3AV2 A;  5GSU D;  1M1A C;  4QLC D;  1EQZ B;  3R45 A;  4CAY A;  3AZG D;  3AFA B;  4H9S C;  1KX3 A;  4WZS B;  3LEL A;  2YFV B;  3MVD B;  4H9R B;  2F8N B;  1KX5 C;  2ARO A;  4H9N A;  3O62 D;  3MGP B;  3B0D C;  3MGS C;  2CV5 D;  3WTP A;  3KWQ B;  3MGR D;  3REJ C;  1P3K A;  1A7W A;  2NZD D;  4J8W C;  5GT3 A;  5FUG A;  3B0C W;  4R8P C;  2HUE C;  1P3A B;  3MGQ B;  5B0Z C;  3VH5 W;  4YS3 B;  1P3M D;  4YM6 D;  3B6F B;  3UT9 B;  3KUY C;  4Z2M G;  4XZQ D;  5CPK A;  3UTA B;  4ZBJ B;  5B1M A;  1M19 A;  3AZM C;  3LZ1 C;  1P3G B;  1EQZ A;  3AZK B;  3AYW C;  3W96 C;  1S32 D;  5AVB A;  3KXB C;  1F66 B;  3MNN D;  5DNN A;  2YFV A;  1P3I D;  4WNN B;  3REL A;  1HQ3 B;  5GXQ A;  3MGP A;  3X1S C;  3C1C C;  1B6W A;  3X1V C;  1P3O B;  4H9Q B;  5CP6 D;  4J8V B;  5AV6 A;  4H9P B;  4ZUX B;  4EO5 C;  3MGQ A;  4KUD C;  5BNX B;  3C1B A;  5B40 C;  3B6F A;  5GSU B;  3AZG B;  3AZE D;  3AZJ C;  3AV1 C;  3AV2 D;  3LJA A;  2RVQ C;  5E5A C;  5CPI C;  1KX3 D;  1AOI C;  2FJ7 A;  1P3G A;  3W97 B;  3LEL D;  1KX4 A;  2BYK A;  1M18 C;  3O62 B;  3B6G A;  2ARO D;  3TU4 C;  5AV8 C;  4Z5T B;  2IO5 C;  1F66 A;  2CV5 B;  3X1T A;  3MGR B;  2LY8 A;  4WNN A;  4UUZ A;  4WU9 C;  1TZY C;  3WAA A;  1HQ3 A;  3WTP D;  3UTB B;  4Z66 C;  1P3K D;  5GT3 D;  1P3L C;  1P3O A;  4YM6 B;  1ID3 C;  4J8V A;  3WKJ C;  3WA9 C;  4H9P A;  4ZUX A;  2PYO C;  1M1A B;  1WWI A;  5CPK D;  3VH6 T;  5B1M D;  5GT0 D;  1M19 D;  1EQZ D;  1S32 B;  3MNN B;  3AFA D;  1U35 A; 
#chains in the Genus database with same CATH topology
 2FJ7 C;  4NE6 A;  3W97 A;  5AVB D;  3B0D B;  4G91 C;  5DNN D;  2F8N D;  3REJ B;  4Z5T A;  3LZ0 C;  4J8X C;  3MGP D;  2Y2J A;  4R8P B;  2HUE B;  1KU5 A;  2Y2L A;  3UTB A;  1TAF B;  5AV6 D;  2YFW B;  3KUY B;  5B2J C;  3A1K A;  3MGQ D;  1ULY A;  3C1B D;  3AZE B;  3B6F D;  4CAY B;  1M1A A;  3AYW B;  2L5A A;  3LJA D;  1KX3 B;  3UTA D;  4H9S A;  1Q9C A;  3W96 B;  3KXB B;  5B31 C;  1KX5 A;  1P3G D;  4JJN C;  3AZK D;  1KX4 D;  4KGC C;  4CSR A;  3W99 C;  3AZF C;  5CHL B;  3C1C B;  1P3F C;  1F66 D;  2JCH A;  5F99 C;  3X1T D;  3MGS A;  3X1V B;  3REJ A;  3WAA D;  4J8W A;  1HQ3 D;  1BH9 B;  5AV5 C;  4R8P A;  4J8U C;  1P3O D;  4KUD B;  5B0Z A;  5B40 B;  4J8V D;  5CPJ C;  2YFW A;  3KUY A;  4ZUX D;  2XD1 A;  5B0Y C;  5B1M B;  1P3P A;  1P34 C;  4AWL C;  5CPI B;  2F2A C;  5BO0 A;  3LZ1 A;  3AZM A;  1AOI B;  3AYW A;  3EPL A;  5AVB B;  3TU4 B;  5AV8 B;  3EPH A;  3W96 A;  5DNN B;  2IO5 B;  3KXB A;  1U35 D;  3W97 D;  4WU9 B;  3H0M C;  3REL B;  1TZY B;  3AZH C;  5GXQ B;  3AZL C;  3AZI C;  3X1S A;  4Z5T D;  4Z66 B;  3C1C A;  3A6N C;  4NE3 A;  5C3I C;  5DNM C;  3X1V A;  1ID3 B;  2ZY5 A;  5AV6 B;  3W98 C;  5AV9 C;  3REK C;  3UTB D;  5B33 C;  1BH9 A;  3WA9 B;  2PYO B;  5JRG C;  3C1B B;  4KUD A;  5B40 A;  1N1J A;  2Y2P A;  3B0C T;  3EPK A;  3LJA B;  3AZJ A;  3AV1 A;  3VH5 T;  5BS7 C;  1M1A D;  1P3P C;  5E5A A;  5CPI A;  2FJ7 B;  2NQB C;  1KX4 B;  1AOI A;  2BYK B;  5BT1 C;  4G91 B;  3B6G B;  1M18 A;  1KX5 D;  4WU8 C;  3TU4 A;  5AV8 A;  3X1T B;  4J8X B;  4UUZ B;  3EPJ A;  4WU9 A;  3WAA B;  2RIQ A;  1TZY A;  4NFT A;  3MGS D;  1T3U A;  4Z66 A;  3REJ D;  5B1L C;  4J8W D;  1P3L A;  4R8P D;  1ID3 A;  5B2J B;  3WKJ A;  3WA9 A;  2PYO A;  3KUY D;  3X1U C;  3AZM D;  3A1I A;  3LZ1 D;  2F8N H;  4JJN B;  3AYW D;  1U35 B;  4KGC B;  3AZF B;  3W96 D;  1P3F B;  3KXB D;  5F99 B;  3LZ0 A;  4J8X A;  3X1S D;  5AV5 B;  3C1C D;  4J8U B;  3X1V D;  3REH C;  5G49 B;  5CPJ B;  4KHA B;  5B2I C;  1ZLA C;  5B0Y B;  5B2J A;  4KUD D;  5B40 D;  2Y2Q A;  4M6B A;  5AY8 C;  3AL0 C;  3AZJ D;  3AV1 D;  5B32 C;  2RVQ D;  5E5A D;  5B31 A;  5CPI D;  3AN2 A;  1KX5 B;  1AOI D;  2FFF B;  3MVD C;  4JJN A;  4CSR B;  1M18 D;  3AZL B;  4KGC A;  3W99 A;  3TU4 D;  3AZF A;  5AV8 D;  1F1E A;  3MGS B;  1P3F A;  5F99 A;  5AVC C;  3A6N B;  5C3I B;  5DNM B;  4WU9 D;  3REL D;  1TZY D;  4J8W B;  5GXQ D;  3KWQ C;  3REK B;  5B33 B;  4Z66 D;  5AV5 A;  4J8U A;  5B0Z B;  1P3L D;  5JRG B;  1P3A C;  1BH8 A;  1ID3 D;  4WV4 B;  5G49 A;  4YS3 C;  4X23 C;  5CPJ A;  3WKJ D;  4KHA A;  3AZN C;  3WA9 D;  5B0Y A;  3UT9 C;  2PYO D;  1P3P B;  3UTA C;  3AZM B;  5BO0 B;  3LZ1 B;  3REI C;  1P34 A;  4ZBJ C;  2NQB B;  3EG5 B;  4WU8 B;  4LD9 C;  3AN2 C;  1P3B C;  2UWX A;  2FJ7 D;  3B6G D;  3AZH A;  3AZL A;  3X1S B;  3AZI A;  3LZ0 D;  5B1L B;  4J8X D;  3IP4 C;  4XUJ C;  5DNM A;  2Y2O A;  3A6N A;  2ZY3 A;  4Z2M H;  3W98 A;  5AV9 A;  3REK A;  2HIO C;  5B33 A;  5B24 C;  4EO5 B;  5JRG A;  4XZQ A;  1N1J B;  5B2J D;  3AZJ B;  3AV1 B;  5GSU C;  4QLC C;  3X1U B;  3AZG C;  5BS7 A;  5E5A B;  2NQB A;  4DRB A;  1M18 B;  5B31 D;  3KFU G;  3NQJ B;  4WU8 A;  4JJN D;  4G92 C;  3O62 C;  4KGC D;  5B31 G;  3W99 D;  3AZF D;  2CV5 C;  1P3F D;  3MGR C;  5F99 D;  2NZD C;  4HGA C;  3REH B;  5B1L A;  1WWS A;  1P3L B;  5AV5 D;  5B2I B;  4J8U D;  1P3M C;  3WKJ B;  4YM6 C;  5AY8 B;  5CPJ D;  4XZQ C;  4E44 A;  2ZY4 A;  5B0Y D;  5B32 B;  1P34 D;  3X1U A;  1JFI A;  2ZM5 A;  1S32 C;  4H9O B;  3MNN C;  1P3I C;  1Z2C B;  5AVC B;  3NQJ A;  3LZ0 B;  3AZH D;  3AZL D;  3AZI D;  2Y2M A;  3NQU B;  5CP6 C;  1W2E A;  5DNM D;  3A6N D;  3REH A;  3W98 D;  5AV9 D;  4X23 B;  3REK D;  5B33 D;  5KDM B;  3AZN B;  4UPK A;  5B2I A;  1ZLA A;  5B0Z D;  5JRG D;  3REI B;  5AY8 A;  3AZE C;  3AV2 C;  5GT0 A;  1R4V A;  5B32 A;  2JSS A;  1P3P D;  1KX3 C;  3AFA A;  5B31 B;  4LD9 B;  3AN2 B;  1P3B B;  3LEL C;  2NQB D;  2DQN C;  2F8N A;  2ARO C;  4H9R A;  5BT1 D;  3MVD A;  3W99 B;  4WU8 D;  4H9O A;  3VH6 A;  5AVC A;  4XUJ B;  3WTP C;  5BNV B;  1P3K C;  3KWQ A;  2HIO B;  5GT3 C;  5B24 B;  3NQU A;  5B1L D;  3P5J B;  1BH8 B;  1P3A A;  3V9R B;  2W8S A;  4YS3 A;  4X23 A;  5KDM A;  3AZN A;  4QLC B;  2DF4 C;  3UT9 A;  5CPK C;  1P34 B;  3B0B A;  4AWL B;  3UTA A;  3REI A;  5B1M C;  5GT0 C;  1M19 C;  1EQZ C;  1B67 A;  3X1U D;  2Y2H A;  3AZK A;  3AFA C;  4G92 B;  4LD9 A;  5AVB C;  1P3B A;  5DNN C;  5JA4 B;  2Y2I A;  3AZH B;  3AZI B;  4HGA B;  3REL C;  2NZD B;  5GXQ C;  3MGP C;  4XUJ A;  4DQY B;  3W98 B;  5AV9 B;  4H9Q A;  5BNV A;  1P3M B;  5AV6 C;  2HIO A;  5B24 A;  3H0L C;  3VH6 W;  3REH D;  4XZQ B;  3MGQ C;  5B2I D;  3V9R A;  3C1B C;  1ZLA D;  3B6F C;  5BNX A;  5GSU A;  3KSY A;  5AY8 D;  4QLC A;  3AZG A;  3LJA C;  2BYM B;  4DRA A;  4NE5 A;  5B32 D;  1P3I B;  1P3G C;  3AZK C;  1KX4 C;  1BFM A;  5B32 G;  3B6G C;  3MVD D;  3O62 A;  1F66 C;  2F8N K;  3X1T C;  2F8N G;  5JA4 A;  2CV5 A;  5CP6 B;  3MGR A;  5AVC D;  3WAA C;  2NZD A;  4WJ3 C;  1HQ3 C;  3KWQ D;  2CWE A;  1P3O C;  1HTA A;  1H3O B;  3WTP E;  1P3M A;  4YM6 A;  4J8V C;  1P3A D;  4YS3 D;  4X23 D;  3AV2 B;  4ZUX C;  3AZN D;  3R45 B;  2Y2G A;  3UT9 D;  3REI D;  4E45 A;  3LEL B;  1JFI B;  2BYM A;  2Y2N A;  2ARO B;  1S32 A;  1U35 C;  3MNN A;  4LD9 D;  4H9N B;  1P3I A;  3W97 C;  3AN2 D;  1P3B D;  3FDD A;  3WTP B;  3VH5 A;  1P3K B;  4Z5T C;  5GT3 B;  5FUG B;  5CP6 A;  4XUJ D;  3UTB C;  2HIO D;  5B24 D;  1ZLA B;  1TAF A;  2JE5 A;  1H3O A;  5CPK B;  2J8P A;  5GT0 B;  3AZE A;  1M19 B;  3AV2 A;  5GSU D;  1M1A C;  4QLC D;  1EQZ B;  2G5I C;  3R45 A;  4CAY A;  3AZG D;  3AFA B;  4H9S C;  1KX3 A;  4WZS B;  1PZR A;  3LEL A;  2YFV B;  3MVD B;  4H9R B;  2F8N B;  1KX5 C;  2ARO A;  4H9N A;  3O62 D;  3MGP B;  3F6T A;  3B0D C;  3MGS C;  2CV5 D;  3WTP A;  3KWQ B;  3MGR D;  3REJ C;  1P3K A;  1A7W A;  2NZD D;  4J8W C;  5GT3 A;  5FUG A;  3B0C W;  4R8P C;  2HUE C;  1P3A B;  3MGQ B;  5B0Z C;  2G5H C;  3VH5 W;  4YS3 B;  1P3M D;  4YM6 D;  3B6F B;  3UT9 B;  3KUY C;  4Z2M G;  4XZQ D;  5CPK A;  3UTA B;  4ZBJ B;  5B1M A;  1M19 A;  3AZM C;  3LZ1 C;  1P3G B;  1EQZ A;  3AZK B;  3AYW C;  3W96 C;  1S32 D;  5AVB A;  3KXB C;  1F66 B;  3MNN D;  5DNN A;  2YFV A;  1P3I D;  4WNN B;  3REL A;  1HQ3 B;  2VQR A;  5GXQ A;  3MGP A;  3X1S C;  3C1C C;  1B6W A;  3X1V C;  1P3O B;  4H9Q B;  5CP6 D;  4J8V B;  5AV6 A;  4H9P B;  4ZUX B;  4EO5 C;  3MGQ A;  4KUD C;  5BNX B;  3C1B A;  5B40 C;  2XD5 A;  3B6F A;  5GSU B;  3AZG B;  3AZE D;  3AZJ C;  3AV1 C;  3AV2 D;  3LJA A;  2RVQ C;  5E5A C;  2BG1 A;  5CPI C;  1KX3 D;  1AOI C;  2FJ7 A;  1P3G A;  3W97 B;  3LEL D;  1KX4 A;  2BYK A;  1M18 C;  3O62 B;  3B6G A;  2ARO D;  3TU4 C;  5AV8 C;  4Z5T B;  2IO5 C;  1F66 A;  2CV5 B;  3X1T A;  3MGR B;  2LY8 A;  4WNN A;  4UUZ A;  4WU9 C;  1TZY C;  3WAA A;  1HQ3 A;  3WTP D;  3UTB B;  4Z66 C;  1P3K D;  5GT3 D;  1P3L C;  1P3O A;  3H0R C;  4YM6 B;  1ID3 C;  4J8V A;  3WKJ C;  3WA9 C;  2ZY2 A;  4H9P A;  4ZUX A;  2PYO C;  1M1A B;  1WWI A;  5CPK D;  3VH6 T;  5B1M D;  5GT0 D;  1M19 D;  1EQZ D;  1S32 B;  3MNN B;  2Y2K A;  3AFA D;  1U35 A; 
#chains in the Genus database with same CATH homology
 2FJ7 C;  4NE6 A;  3W97 A;  5AVB D;  3B0D B;  4G91 C;  5DNN D;  2F8N D;  3REJ B;  4Z5T A;  3LZ0 C;  4J8X C;  3MGP D;  2Y2J A;  4R8P B;  2HUE B;  1KU5 A;  2Y2L A;  3UTB A;  1TAF B;  5AV6 D;  2YFW B;  3KUY B;  5B2J C;  3A1K A;  3MGQ D;  1ULY A;  3C1B D;  3AZE B;  3B6F D;  4CAY B;  1M1A A;  3AYW B;  2L5A A;  3LJA D;  1KX3 B;  3UTA D;  4H9S A;  1Q9C A;  3W96 B;  3KXB B;  5B31 C;  1KX5 A;  1P3G D;  4JJN C;  3AZK D;  1KX4 D;  4KGC C;  4CSR A;  3W99 C;  3AZF C;  5CHL B;  3C1C B;  1P3F C;  1F66 D;  2JCH A;  5F99 C;  3X1T D;  3MGS A;  3X1V B;  3REJ A;  3WAA D;  4J8W A;  1HQ3 D;  1BH9 B;  5AV5 C;  4R8P A;  4J8U C;  1P3O D;  4KUD B;  5B0Z A;  5B40 B;  4J8V D;  5CPJ C;  2YFW A;  3KUY A;  4ZUX D;  2XD1 A;  5B0Y C;  5B1M B;  1P3P A;  1P34 C;  4AWL C;  5CPI B;  2F2A C;  5BO0 A;  3LZ1 A;  3AZM A;  1AOI B;  3AYW A;  3EPL A;  5AVB B;  3TU4 B;  5AV8 B;  3EPH A;  3W96 A;  5DNN B;  2IO5 B;  3KXB A;  1U35 D;  3W97 D;  4WU9 B;  3H0M C;  3REL B;  1TZY B;  3AZH C;  5GXQ B;  3AZL C;  3AZI C;  3X1S A;  4Z5T D;  4Z66 B;  3C1C A;  3A6N C;  4NE3 A;  5C3I C;  5DNM C;  3X1V A;  1ID3 B;  2ZY5 A;  5AV6 B;  3W98 C;  5AV9 C;  3REK C;  3UTB D;  5B33 C;  1BH9 A;  3WA9 B;  2PYO B;  5JRG C;  3C1B B;  4KUD A;  5B40 A;  1N1J A;  2Y2P A;  3B0C T;  3EPK A;  3LJA B;  3AZJ A;  3AV1 A;  3VH5 T;  5BS7 C;  1M1A D;  1P3P C;  5E5A A;  5CPI A;  2FJ7 B;  2NQB C;  1KX4 B;  1AOI A;  2BYK B;  5BT1 C;  4G91 B;  3B6G B;  1M18 A;  1KX5 D;  4WU8 C;  3TU4 A;  5AV8 A;  3X1T B;  4J8X B;  4UUZ B;  3EPJ A;  4WU9 A;  3WAA B;  2RIQ A;  1TZY A;  4NFT A;  3MGS D;  1T3U A;  4Z66 A;  3REJ D;  5B1L C;  4J8W D;  1P3L A;  4R8P D;  1ID3 A;  5B2J B;  3WKJ A;  3WA9 A;  2PYO A;  3KUY D;  3X1U C;  3AZM D;  3A1I A;  3LZ1 D;  2F8N H;  4JJN B;  3AYW D;  1U35 B;  4KGC B;  3AZF B;  3W96 D;  1P3F B;  3KXB D;  5F99 B;  3LZ0 A;  4J8X A;  3X1S D;  5AV5 B;  3C1C D;  4J8U B;  3X1V D;  3REH C;  5G49 B;  5CPJ B;  4KHA B;  5B2I C;  1ZLA C;  5B0Y B;  5B2J A;  4KUD D;  5B40 D;  2Y2Q A;  4M6B A;  5AY8 C;  3AL0 C;  3AZJ D;  3AV1 D;  5B32 C;  2RVQ D;  5E5A D;  5B31 A;  5CPI D;  3AN2 A;  1KX5 B;  1AOI D;  2FFF B;  3MVD C;  4JJN A;  4CSR B;  1M18 D;  3AZL B;  4KGC A;  3W99 A;  3TU4 D;  3AZF A;  5AV8 D;  1F1E A;  3MGS B;  1P3F A;  5F99 A;  5AVC C;  3A6N B;  5C3I B;  5DNM B;  4WU9 D;  3REL D;  1TZY D;  4J8W B;  5GXQ D;  3KWQ C;  3REK B;  5B33 B;  4Z66 D;  5AV5 A;  4J8U A;  5B0Z B;  1P3L D;  5JRG B;  1P3A C;  1BH8 A;  1ID3 D;  4WV4 B;  5G49 A;  4YS3 C;  4X23 C;  5CPJ A;  3WKJ D;  4KHA A;  3AZN C;  3WA9 D;  5B0Y A;  3UT9 C;  2PYO D;  1P3P B;  3UTA C;  3AZM B;  5BO0 B;  3LZ1 B;  3REI C;  1P34 A;  4ZBJ C;  2NQB B;  3EG5 B;  4WU8 B;  4LD9 C;  3AN2 C;  1P3B C;  2UWX A;  2FJ7 D;  3B6G D;  3AZH A;  3AZL A;  3X1S B;  3AZI A;  3LZ0 D;  5B1L B;  4J8X D;  3IP4 C;  4XUJ C;  5DNM A;  2Y2O A;  3A6N A;  2ZY3 A;  4Z2M H;  3W98 A;  5AV9 A;  3REK A;  2HIO C;  5B33 A;  5B24 C;  4EO5 B;  5JRG A;  4XZQ A;  1N1J B;  5B2J D;  3AZJ B;  3AV1 B;  5GSU C;  4QLC C;  3X1U B;  3AZG C;  5BS7 A;  5E5A B;  2NQB A;  4DRB A;  1M18 B;  5B31 D;  3KFU G;  3NQJ B;  4WU8 A;  4JJN D;  4G92 C;  3O62 C;  4KGC D;  5B31 G;  3W99 D;  3AZF D;  2CV5 C;  1P3F D;  3MGR C;  5F99 D;  2NZD C;  4HGA C;  3REH B;  5B1L A;  1WWS A;  1P3L B;  5AV5 D;  5B2I B;  4J8U D;  1P3M C;  3WKJ B;  4YM6 C;  5AY8 B;  5CPJ D;  4XZQ C;  4E44 A;  2ZY4 A;  5B0Y D;  5B32 B;  1P34 D;  3X1U A;  1JFI A;  2ZM5 A;  1S32 C;  4H9O B;  3MNN C;  1P3I C;  1Z2C B;  5AVC B;  3NQJ A;  3LZ0 B;  3AZH D;  3AZL D;  3AZI D;  2Y2M A;  3NQU B;  5CP6 C;  1W2E A;  5DNM D;  3A6N D;  3REH A;  3W98 D;  5AV9 D;  4X23 B;  3REK D;  5B33 D;  5KDM B;  3AZN B;  4UPK A;  5B2I A;  1ZLA A;  5B0Z D;  5JRG D;  3REI B;  5AY8 A;  3AZE C;  3AV2 C;  5GT0 A;  1R4V A;  5B32 A;  2JSS A;  1P3P D;  1KX3 C;  3AFA A;  5B31 B;  4LD9 B;  3AN2 B;  1P3B B;  3LEL C;  2NQB D;  2DQN C;  2F8N A;  2ARO C;  4H9R A;  5BT1 D;  3MVD A;  3W99 B;  4WU8 D;  4H9O A;  3VH6 A;  5AVC A;  4XUJ B;  3WTP C;  5BNV B;  1P3K C;  3KWQ A;  2HIO B;  5GT3 C;  5B24 B;  3NQU A;  5B1L D;  3P5J B;  1BH8 B;  1P3A A;  3V9R B;  2W8S A;  4YS3 A;  4X23 A;  5KDM A;  3AZN A;  4QLC B;  2DF4 C;  3UT9 A;  5CPK C;  1P34 B;  3B0B A;  4AWL B;  3UTA A;  3REI A;  5B1M C;  5GT0 C;  1M19 C;  1EQZ C;  1B67 A;  3X1U D;  2Y2H A;  3AZK A;  3AFA C;  4G92 B;  4LD9 A;  5AVB C;  1P3B A;  5DNN C;  5JA4 B;  2Y2I A;  3AZH B;  3AZI B;  4HGA B;  3REL C;  2NZD B;  5GXQ C;  3MGP C;  4XUJ A;  4DQY B;  3W98 B;  5AV9 B;  4H9Q A;  5BNV A;  1P3M B;  5AV6 C;  2HIO A;  5B24 A;  3H0L C;  3VH6 W;  3REH D;  4XZQ B;  3MGQ C;  5B2I D;  3V9R A;  3C1B C;  1ZLA D;  3B6F C;  5BNX A;  5GSU A;  3KSY A;  5AY8 D;  4QLC A;  3AZG A;  3LJA C;  2BYM B;  4DRA A;  4NE5 A;  5B32 D;  1P3I B;  1P3G C;  3AZK C;  1KX4 C;  1BFM A;  5B32 G;  3B6G C;  3MVD D;  3O62 A;  1F66 C;  2F8N K;  3X1T C;  2F8N G;  5JA4 A;  2CV5 A;  5CP6 B;  3MGR A;  5AVC D;  3WAA C;  2NZD A;  4WJ3 C;  1HQ3 C;  3KWQ D;  2CWE A;  1P3O C;  1HTA A;  1H3O B;  3WTP E;  1P3M A;  4YM6 A;  4J8V C;  1P3A D;  4YS3 D;  4X23 D;  3AV2 B;  4ZUX C;  3AZN D;  3R45 B;  2Y2G A;  3UT9 D;  3REI D;  4E45 A;  3LEL B;  1JFI B;  2BYM A;  2Y2N A;  2ARO B;  1S32 A;  1U35 C;  3MNN A;  4LD9 D;  4H9N B;  1P3I A;  3W97 C;  3AN2 D;  1P3B D;  3FDD A;  3WTP B;  3VH5 A;  1P3K B;  4Z5T C;  5GT3 B;  5FUG B;  5CP6 A;  4XUJ D;  3UTB C;  2HIO D;  5B24 D;  1ZLA B;  1TAF A;  2JE5 A;  1H3O A;  5CPK B;  2J8P A;  5GT0 B;  3AZE A;  1M19 B;  3AV2 A;  5GSU D;  1M1A C;  4QLC D;  1EQZ B;  2G5I C;  3R45 A;  4CAY A;  3AZG D;  3AFA B;  4H9S C;  1KX3 A;  4WZS B;  1PZR A;  3LEL A;  2YFV B;  3MVD B;  4H9R B;  2F8N B;  1KX5 C;  2ARO A;  4H9N A;  3O62 D;  3MGP B;  3F6T A;  3B0D C;  3MGS C;  2CV5 D;  3WTP A;  3KWQ B;  3MGR D;  3REJ C;  1P3K A;  1A7W A;  2NZD D;  4J8W C;  5GT3 A;  5FUG A;  3B0C W;  4R8P C;  2HUE C;  1P3A B;  3MGQ B;  5B0Z C;  2G5H C;  3VH5 W;  4YS3 B;  1P3M D;  4YM6 D;  3B6F B;  3UT9 B;  3KUY C;  4Z2M G;  4XZQ D;  5CPK A;  3UTA B;  4ZBJ B;  5B1M A;  1M19 A;  3AZM C;  3LZ1 C;  1P3G B;  1EQZ A;  3AZK B;  3AYW C;  3W96 C;  1S32 D;  5AVB A;  3KXB C;  1F66 B;  3MNN D;  5DNN A;  2YFV A;  1P3I D;  4WNN B;  3REL A;  1HQ3 B;  2VQR A;  5GXQ A;  3MGP A;  3X1S C;  3C1C C;  1B6W A;  3X1V C;  1P3O B;  4H9Q B;  5CP6 D;  4J8V B;  5AV6 A;  4H9P B;  4ZUX B;  4EO5 C;  3MGQ A;  4KUD C;  5BNX B;  3C1B A;  5B40 C;  2XD5 A;  3B6F A;  5GSU B;  3AZG B;  3AZE D;  3AZJ C;  3AV1 C;  3AV2 D;  3LJA A;  2RVQ C;  5E5A C;  2BG1 A;  5CPI C;  1KX3 D;  1AOI C;  2FJ7 A;  1P3G A;  3W97 B;  3LEL D;  1KX4 A;  2BYK A;  1M18 C;  3O62 B;  3B6G A;  2ARO D;  3TU4 C;  5AV8 C;  4Z5T B;  2IO5 C;  1F66 A;  2CV5 B;  3X1T A;  3MGR B;  2LY8 A;  4WNN A;  4UUZ A;  4WU9 C;  1TZY C;  3WAA A;  1HQ3 A;  3WTP D;  3UTB B;  4Z66 C;  1P3K D;  5GT3 D;  1P3L C;  1P3O A;  3H0R C;  4YM6 B;  1ID3 C;  4J8V A;  3WKJ C;  3WA9 C;  2ZY2 A;  4H9P A;  4ZUX A;  2PYO C;  1M1A B;  1WWI A;  5CPK D;  3VH6 T;  5B1M D;  5GT0 D;  1M19 D;  1EQZ D;  1S32 B;  3MNN B;  2Y2K A;  3AFA D;  1U35 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...