4WU8B

Structure of trptnap-ncp145
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
82
structure length
82
Chain Sequence
VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords DNA (145-MER)
publication title Stereochemical control of nucleosome targeting by platinum-intercalator antitumor agents.
pubmed doi rcsb
source organism Xenopus laevis
total genus 27
structure length 82
sequence length 82
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4wu8B00
4J8UB 1S32C 4WU8B 1P3MB 5GXQA 4Z5TC 3W98C 3V9RA 3AZJC 5GXQD 5B24C 1P34C 3NQUA 4DRAA 3WAAA 5CP6B 4Z66C 1P3LB 3WAAD 2AROB 3B0CW 5FUGA 2IO5C 5BNXB 2HIOA 2CV5A 4YS3B 2HIOD 5B2JC 2CV5D 5B1MC 4NE6A 4J8UA 1ZLAC 4KGCC 1KX3C 4CAYB 4QLCB 4J8UD 3AZNC 1P3GB 3UT9C 3MNNA 3MNND 1P3PB 5DNMB 4X23B 3W99C 4CSRA 1P3LA 5E5AA 3UTAC 2AROA 3AFAB 1P3LD 5BNXA 3W97A 2AROD 1ID3C 4HGAC 3AZGC 4H9OB 3W97D 2NQBA 2YFVB 4AWLB 5AV8C 3B0DC 3WTPC 2NQBD 1U35B 1P3OC 3R45B 5KDMA 4QLCA 2PYOB 1P3FA 1P3GA 3MGQB 4QLCD 3KXBB 4J8XC 1P3FD 1P3GD 3REJA 1P3IC 1P3PA 5DNMA 2HUEC 4J8VA 5BS7C 1S32B 3REJD 4Z5TB 3B6FC 1P3PD 3W98B 5DNMD 4WZSB 3AZJB 1A7WA 5B32C 5B24B 5GT0A 1P34B 3AFAD 4Z66B 2YFVA 4KUDC 3RELA 3R45A 2IO5B 3LZ1A 5C3IC 3LZ1D 3MVDA 5B2JB 2YFWB 1KX4C 4WNNB 3MGQD 1EQZC 5B1MB 1ZLAB 3MVDD 1B6WA 1KX3B 4KGCB 1S32A 2BYKB 3W98A 3AZNB 3UT9B 1S32D 3AZJA 4Z5TD 3W98D 2L5AA 2FJ7C 5AVCA 4H9RA 3AZJD 3B6GC 3AZLC 3W99B 5CPIC 3UTAB 5AVCD 1KX5A 4Z66D 4WU9A 4LD9A 3X1TA 1KX5D 1ID3B 4HGAB 4WU9D 3AZGB 5E5AC 3X1TD 3MGSC 1P3BC 2YFWA 5AV8B 4WNNA 1BFMA 3B0DB 1Q9CA 1ZLAA 3W97C 3WTPB 4KGCA 3MGRC 1P3OB 5B1MD 1ZLAD 4DRBA 1H3OB 4KGCD 2NQBC 5BT1D 3VH6T 4J8XB 3AV1C 1P3IB 1P3FC 2HUEB 5AV9A 5B0ZC 3B6FB 3AZFA 5AV9D 3LZ0C 3REJC 5B32B 3UTAD 3MGPA 3AZFD 4J8VC 3AZGA 3AN2A 3MGPD 4KUDB 5AV8A 3A6NA 3AZGD 3KWQC 3AN2D 5GT0C 3AZKA 3AZIC 3NQUB 1P3OA 5AV8D 3WAAB 3A6ND 3AZKD 1P3OD 1AOIA 5C3IB 4XUJA 3KUYA 4J8XA 3RELC 5B31G 1R4VA 1AOID 1EQZB 4XUJD 3KUYD 4J8XD 1P3ID 3MVDC 5B32A 2FJ7B 1B67A 3B6GB 3AV2A 5B32D 4KUDA 3AZLB 5CPIB 1KU5A 3AV2D 3MNNB 4KUDD 2LY8A 5AVCC 5AY8C 4CSRB 3VH6W 5E5AB 1KX5C 3MGSB 1P3BB 4WU9C 5AVBA 1KX4A 1EQZA 1M19C 4LD9C 3X1TC 3W97B 5CPJC 3MGRB 4H9PA 5AVBD 4WV4B 1KX4D 1EQZD 2NQBB 1BH8A 4G92C 4UUZA 2FJ7A 2RVQD 5KDMB 5BT1C 3B6GA 1P3FB 4H9QA 5B0ZB 3AZLA 2FJ7D 2F8NA 5CPIA 3B6GD 4R8PC 3AZLD 5JRGC 2F8ND 3LZ0B 3REJB 5CPID 4J8VB 5AV9C 3MGSA 3AZFC 1M1AA 1P3BA 5E5AD 3KWQB 1P3KA 5GT0B 3MGPC 3MGSD 3MGRA 3AZIB 1P3BD 1M1AD 5AV5A 3AN2C 3MGRD 3X1SA 5AV5D 3B0BA 3A6NC 3RELB 3AV1A 3AZKC 5G49B 3X1SD 3LZ1B 3AV1D 5B0ZA 1AOIC 4XUJC 3KUYC 3MVDB 5B0ZD 1HQ3A 3NQJA 3LZ0A 3C1CC 3LZ0D 4J8VD 1ULYA 5DNNA 3KWQA 3AZIA 5AVCB 4H9RB 3KWQD 3AV2C 5AY8B 5GT0D 3AZID 3LELC 5B40A 1KX5B 5G49A 4WU9B 5B40D 1M19B 4LD9B 3RELD 3X1TB 5CPJB 3REIA 3REID 3REKC 4G92B 5AVBC 2RVQC 3W96C 5F99C 4R8PB 5BNVB 5JRGB 4XZQA 3AZMA 5AY8A 3X1VA 5AV9B 4XZQD 3AZMD 1HTAA 5AY8D 3AZFB 1M19A 5CPJA 3MGPB 3KSYA 4G91C 3LJAA 1M19D 4LD9D 3AN2B 5CPJD 3UTBA 2BYMA 1M1AC 3LJAD 3A6NB 1P3AC 1JFIB 4ZUXC 1P3KC 3AZKB 5AV5C 1M18A 1AOIB 3X1SC 4XUJB 3KUYB 3WTPE 4R8PA 1TAFA 1M18D 5BNVA 5JRGA 3C1CB 4R8PD 3O62C 3AZEA 5JRGD 3X1UC 3AZED 4M6BA 1HQ3C 4NE3A 3AV2B 3LELB 1N1JB 5DNNC 1JFIA 2NZDA 4YS3C 2NZDD 5BO0B 5B40C 3AZHC 3REKB 5AVBB 1KX4B 4EO5C 3C1CA 3AYWA 3REIC 4H9PB 4Z2MG 3AYWD 3C1CD 3W96B 1BH8B 5F99B 4UUZB 5AV6A 1F1EA 3C1BA 4X23C 5AV6D 4H9QB 4NE5A 5GSUA 1N1JA 3LELA 3C1BD 2F8NB 3LELD 4XZQC 1TZYC 3WKJC 3AZMC 5JA4A 5GT3A 4G91B 3X1VC 4YM6A 5BO0A 4J8WC 5GT3D 1M1AB 3REKA 4YM6D 1P3AB 4ZUXB 1P3KB 3REKD 3LJAC 5AV5B 3TU4A 1BH9A 3UTBC 3W96A 3X1SB 5F99A 3TU4D 4H9SA 3AV1B 3W96D 5B32G 5F99D 3O62B 1M18C 3X1UB 5B33C 4H9NB 1HQ3B 3NQJB 4Z2MH 3WA9C 2CWEA 3AZEC 5B1LC 4ZBJC 1P3AA 5DNNB 2JSSA 4ZUXA 4E44A 1P3AD 4ZUXD 1P3KD 4NFTA 5B40B 3VH5A 3AZHB 2NZDC 4WU8A 1P3MA 4EO5B 3O62A 3REIB 5B0YC 5CPKC 4WU8D 3X1UA 5B31C 1P3MD 3O62D 4KHAB 2F8NG 4H9NA 3X1UD 4JJNC 3AYWC 5CP6A 1HQ3D 3VH5T 5CP6D 5AV6C 3C1BC 4XZQB 1TZYB 3WKJB 3AZMB 5DNND 4YS3A 5GSUC 5B2IC 4J8WB 3X1VB 2F8NK 4YS3D 3AZHA 4CAYA 5GT3C 3AZHD 3LJAB 4YM6C 4KHAA 3UTBB 2BYMB 3REHC 1F66C 4X23A 3TU4C 1M18B 4X23D 3AFAA 4H9SC 5B33B 1TAFB 3WKJA 1TZYA 3WA9B 4H9OA 5GXQC 3AZEB 5B1LB 2F8NH 4J8WA 3WKJD 1TZYD 4ZBJB 3X1VD 1U35A 4J8WD 3WAAC 1WWIA 2PYOA 1U35D 3MGQA 2PYOD 3KXBA 3UTBD 3KXBD 3VH5W 2HIOC 2NZDB 2CV5C 4Z5TA 5B0YB 5CPKB 5B31B 5B33A 5B24A 4J8UC 1P34A 4WU8C 1P3MC 4JJNB 5B33D 5B24D 3AYWB 4Z66A 5B1LA 1P34D 3WA9A 3WA9D 3MNNC 5B1LD 5AV6B 3VH6A 5CP6C 3C1BB 1P3LC 2AROC 5GSUB 5B2IB 5B2JA 5B1MA 1KX3A 5B2JD 4E45A 5JA4B 2BYKA 5GT3B 5B0YA 3AZNA 5CPKA 4YM6B 3UT9A 1KX3D 5B31A 5B0YD 3AZND 3B0CT 5CPKD 3UT9D 5B31D 4JJNA 4QLCC 3REHB 1F66B 1WWSA 3TU4B 1P3GC 3W99A 1BH9B 3UTAA 4JJND 5CHLB 3W99D 1P3PC 5DNMC 1ID3A 5GXQB 5B2IA 1ID3D 3V9RB 3AFAC 3WTPA 5GSUD 5B2ID 1H3OA 3WTPD 4AWLC 5FUGB 1U35C 3LZ1C 3REHA 1P3IA 2PYOC 2HIOB 1F66A 5BS7A 2CV5B 3MGQC 3B6FA 3REHD 3KXBC 1F66D 3B6FD
chains in the Genus database with same CATH superfamily
4J8UB 1S32C 4WU8B 1P3MB 5GXQA 4Z5TC 3W98C 3V9RA 3AZJC 5GXQD 5B24C 1P34C 3NQUA 4DRAA 3WAAA 5CP6B 4Z66C 1P3LB 3WAAD 2AROB 3B0CW 5FUGA 2IO5C 5BNXB 2HIOA 2CV5A 4YS3B 2HIOD 5B2JC 2CV5D 5B1MC 4NE6A 4J8UA 1ZLAC 4KGCC 1KX3C 4CAYB 4QLCB 4J8UD 3AZNC 1P3GB 3UT9C 3MNNA 3MNND 1P3PB 5DNMB 4X23B 3W99C 4CSRA 1P3LA 5E5AA 3UTAC 2AROA 3WA9A 3AFAB 1P3LD 5BNXA 3W97A 2AROD 1ID3C 4HGAC 3AZGC 4H9OB 3W97D 2NQBA 2YFVB 4AWLB 5AV8C 3B0DC 2Y2OA 3WTPC 1U35B 1P3OC 2NQBD 3R45B 5KDMA 4QLCA 2PYOB 1P3FA 1P3GA 3MGQB 4QLCD 3KXBB 4J8XC 1P3FD 1P3GD 3AL0C 3REJA 1P3IC 1P3PA 5DNMA 2HUEC 4J8VA 2XD1A 5BS7C 2DQNC 1S32B 3REJD 4Z5TB 3B6FC 1P3PD 3W98B 5DNMD 4WZSB 3AZJB 1A7WA 5B32C 5B24B 5GT0A 1P34B 3AFAD 4Z66B 2YFVA 4KUDC 3RELA 3KFUG 3R45A 2IO5B 3LZ1A 3A1KA 5C3IC 3LZ1D 3MVDA 3EG5B 5B2JB 2YFWB 1KX4C 4WNNB 3MGQD 1EQZC 5B1MB 1ZLAB 3MVDD 1B6WA 1KX3B 4KGCB 1S32A 3P5JB 2BYKB 3W98A 3AZNB 3UT9B 1S32D 3AZJA 4Z5TD 3W98D 2L5AA 2FJ7C 5AVCA 4H9RA 3AZJD 3B6GC 3AZLC 3W99B 5CPIC 3UTAB 5AVCD 1KX5A 4Z66D 4WU9A 4LD9A 3X1TA 1KX5D 1ID3B 4HGAB 4WU9D 3AZGB 5E5AC 3X1TD 3MGSC 1P3BC 2YFWA 5AV8B 4WNNA 1BFMA 3B0DB 1Q9CA 1ZLAA 3W97C 3WTPB 4KGCA 3MGRC 1P3OB 1W2EA 5B1MD 1ZLAD 4DRBA 1H3OB 4KGCD 2NQBC 5BT1D 3VH6T 4J8XB 3AV1C 3F6TA 1P3IB 1P3FC 2HUEB 5AV9A 5B0ZC 3B6FB 2Y2MA 3AZFA 5AV9D 3LZ0C 3REJC 5B32B 3UTAD 2JCHA 3MGPA 3AZFD 4J8VC 3IP4C 3AZGA 3AN2A 3MGPD 4KUDB 5AV8A 3A6NA 3AZGD 3KWQC 3AN2D 5GT0C 3AZKA 3AZIC 3NQUB 1P3OA 5AV8D 3WAAB 3A6ND 3EPLA 3AZKD 1P3OD 1AOIA 5C3IB 4XUJA 3KUYA 4J8XA 3RELC 5B31G 1R4VA 1AOID 1EQZB 4XUJD 3KUYD 4J8XD 1P3ID 3MVDC 5B32A 2FJ7B 2G5IC 1B67A 3B6GB 3AV2A 5B32D 4KUDA 3AZLB 5CPIB 1KU5A 3AV2D 3MNNB 4KUDD 2LY8A 5AVCC 5AY8C 4CSRB 3VH6W 5E5AB 4WJ3C 1KX5C 3MGSB 1P3BB 4WU9C 5AVBA 1KX4A 1EQZA 1M19C 4LD9C 3X1TC 3W97B 5CPJC 3MGRB 4H9PA 5AVBD 4WV4B 1KX4D 1EQZD 2NQBB 1BH8A 4G92C 4UUZA 2FJ7A 2RVQD 5KDMB 5BT1C 3B6GA 1P3FB 4H9QA 5B0ZB 3AZLA 2FJ7D 2F8NA 5CPIA 3B6GD 4R8PC 3AZLD 5JRGC 2F8ND 3LZ0B 3REJB 2FFFB 5CPID 1PZRA 5AV9C 4J8VB 2Y2IA 3MGSA 3AZFC 1M1AA 1P3BA 5E5AD 3KWQB 1P3KA 5GT0B 3MGPC 3MGSD 3MGRA 3AZIB 1P3BD 1M1AD 5AV5A 3AN2C 3MGRD 3X1SA 5AV5D 3B0BA 3A6NC 3RELB 3AV1A 3AZKC 5G49B 3X1SD 3LZ1B 3AV1D 5B0ZA 1AOIC 4XUJC 3KUYC 3MVDB 5B0ZD 1HQ3A 3NQJA 3LZ0A 2Y2NA 3C1CC 2BG1A 3LZ0D 4J8VD 1ULYA 5DNNA 3KWQA 3AZIA 2Y2KA 5AVCB 4H9RB 3KWQD 3AV2C 5AY8B 5GT0D 3AZID 3LELC 5B40A 1KX5B 5G49A 4WU9B 5B40D 1M19B 4LD9B 3RELD 3X1TB 5CPJB 3REIA 3REID 3REKC 4G92B 5AVBC 2RVQC 3W96C 5F99C 4R8PB 5BNVB 5JRGB 4XZQA 3AZMA 5AY8A 3X1VA 5AV9B 4XZQD 3AZMD 1HTAA 5AY8D 3AZFB 1M19A 5CPJA 3MGPB 3KSYA 4G91C 3LJAA 1M19D 4LD9D 3AN2B 5CPJD 3UTBA 2F2AC 2BYMA 1M1AC 3LJAD 3A6NB 1P3AC 1JFIB 4ZUXC 1P3KC 2Y2JA 3AZKB 5AV5C 3EPKA 1M18A 1AOIB 3X1SC 4XUJB 3KUYB 3WTPE 4R8PA 1TAFA 1M18D 5BNVA 5JRGA 3C1CB 4R8PD 3O62C 3AZEA 2Y2GA 5JRGD 3X1UC 3AZED 4M6BA 2W8SA 1HQ3C 4NE3A 3AV2B 3LELB 1N1JB 5DNNC 1JFIA 2NZDA 3H0RC 2Y2LA 4YS3C 2NZDD 5BO0B 5B40C 3AZHC 3REKB 5AVBB 1KX4B 4EO5C 3C1CA 3AYWA 3REIC 4H9PB 4Z2MG 3AYWD 3C1CD 3W96B 1BH8B 5F99B 4UUZB 5AV6A 1F1EA 3C1BA 4X23C 5AV6D 4H9QB 3FDDA 4NE5A 1N1JA 5GSUA 3LELA 3C1BD 2F8NB 3LELD 4XZQC 1TZYC 3WKJC 3AZMC 5JA4A 5GT3A 4G91B 3X1VC 2J8PA 4YM6A 5BO0A 4J8WC 5GT3D 1M1AB 3REKA 1T3UA 4YM6D 1P3AB 4ZUXB 1P3KB 3REKD 3LJAC 5AV5B 3TU4A 1BH9A 3UTBC 3W96A 3X1SB 5F99A 3TU4D 4H9SA 3AV1B 3W96D 5B32G 2JE5A 5F99D 3O62B 1M18C 2ZY5A 3X1UB 5B33C 4H9NB 1HQ3B 3NQJB 4Z2MH 3WA9C 2CWEA 3AZEC 5B1LC 4ZBJC 1P3AA 5DNNB 2JSSA 4ZUXA 4E44A 2Y2PA 1P3AD 4ZUXD 1P3KD 4NFTA 5B40B 3VH5A 3AZHB 2NZDC 4WU8A 1P3MA 4EO5B 3O62A 3REIB 5B0YC 5CPKC 2DF4C 4WU8D 5B31C 3X1UA 1P3MD 3O62D 4KHAB 2F8NG 4H9NA 3X1UD 4JJNC 3AYWC 5CP6A 3H0MC 1HQ3D 3VH5T 5CP6D 5AV6C 3C1BC 4XZQB 1TZYB 3WKJB 3AZMB 5DNND 4YS3A 5GSUC 5B2IC 4J8WB 4UPKA 3X1VB 2F8NK 2ZY4A 4YS3D 3AZHA 4CAYA 5GT3C 3AZHD 3LJAB 4YM6C 4KHAA 3UTBB 2BYMB 3REHC 3EPJA 1F66C 4X23A 3TU4C 1M18B 4X23D 1Z2CB 3AFAA 4H9SC 5B33B 1TAFB 3WKJA 1TZYA 3WA9B 4H9OA 5GXQC 3AZEB 5B1LB 2F8NH 4J8WA 3WKJD 1TZYD 4ZBJB 3X1VD 1U35A 4J8WD 3WAAC 1WWIA 2PYOA 1U35D 3MGQA 2UWXA 2PYOD 3KXBA 4DQYB 3UTBD 3KXBD 3VH5W 2HIOC 2NZDB 2CV5C 4Z5TA 5B0YB 5CPKB 5B31B 5B33A 5B24A 4J8UC 1P34A 2VQRA 4WU8C 1P3MC 4JJNB 5B33D 5B24D 2ZY2A 4Z66A 5B1LA 3AYWB 1P34D 3WA9D 3MNNC 2G5HC 5B1LD 5AV6B 2XD5A 2RIQA 3VH6A 5CP6C 3C1BB 1P3LC 2AROC 5GSUB 5B2IB 5B2JA 5B1MA 1KX3A 5B2JD 4E45A 2Y2HA 2BYKA 5JA4B 5GT3B 2ZM5A 5B0YA 3AZNA 5CPKA 4YM6B 3UT9A 1KX3D 5B31A 5B0YD 3AZND 3B0CT 5CPKD 3UT9D 5B31D 4JJNA 4QLCC 3REHB 1F66B 1WWSA 3TU4B 1P3GC 3W99A 1BH9B 3UTAA 3EPHA 3A1IA 4JJND 5CHLB 3W99D 1P3PC 5DNMC 2Y2QA 1ID3A 3H0LC 5GXQB 5B2IA 1ID3D 3V9RB 3AFAC 3WTPA 5GSUD 5B2ID 1H3OA 3WTPD 4AWLC 5FUGB 1U35C 2ZY3A 3LZ1C 3REHA 1P3IA 2PYOC 2HIOB 1F66A 5BS7A 2CV5B 3MGQC 3B6FA 3REHD 3KXBC 1F66D 3B6FD
chains in the Genus database with same CATH topology
4J8UB 1S32C 4WU8B 1P3MB 5GXQA 4Z5TC 3W98C 3V9RA 3AZJC 5GXQD 5B24C 1P34C 3NQUA 4DRAA 3WAAA 5CP6B 4Z66C 1P3LB 3WAAD 2AROB 3B0CW 5FUGA 2IO5C 5BNXB 2HIOA 2CV5A 4YS3B 2HIOD 5B2JC 2CV5D 5B1MC 4NE6A 4J8UA 1ZLAC 4KGCC 1KX3C 4CAYB 4QLCB 4J8UD 3AZNC 1P3GB 3UT9C 3MNNA 3MNND 1P3PB 5DNMB 4X23B 3W99C 4CSRA 1P3LA 5E5AA 3UTAC 2AROA 3WA9A 3AFAB 1P3LD 5BNXA 3W97A 2AROD 1ID3C 4HGAC 3AZGC 4H9OB 3W97D 2NQBA 2YFVB 4AWLB 5AV8C 3B0DC 2Y2OA 3WTPC 1U35B 1P3OC 2NQBD 3R45B 5KDMA 4QLCA 2PYOB 1P3FA 1P3GA 3MGQB 4QLCD 3KXBB 4J8XC 1P3FD 1P3GD 3AL0C 3REJA 1P3IC 1P3PA 5DNMA 2HUEC 4J8VA 2XD1A 5BS7C 2DQNC 1S32B 3REJD 4Z5TB 3B6FC 1P3PD 3W98B 5DNMD 4WZSB 3AZJB 1A7WA 5B32C 5B24B 5GT0A 1P34B 3AFAD 4Z66B 2YFVA 4KUDC 3RELA 3KFUG 3R45A 2IO5B 3LZ1A 3A1KA 5C3IC 3LZ1D 3MVDA 3EG5B 5B2JB 2YFWB 1KX4C 4WNNB 3MGQD 1EQZC 5B1MB 1ZLAB 3MVDD 1B6WA 1KX3B 4KGCB 1S32A 3P5JB 2BYKB 3W98A 3AZNB 3UT9B 1S32D 3AZJA 4Z5TD 3W98D 2L5AA 2FJ7C 5AVCA 4H9RA 3AZJD 3B6GC 3AZLC 3W99B 5CPIC 3UTAB 5AVCD 1KX5A 4Z66D 4WU9A 4LD9A 3X1TA 1KX5D 1ID3B 4HGAB 4WU9D 3AZGB 5E5AC 3X1TD 3MGSC 1P3BC 2YFWA 5AV8B 4WNNA 1BFMA 3B0DB 1Q9CA 1ZLAA 3W97C 3WTPB 4KGCA 3MGRC 1P3OB 1W2EA 5B1MD 1ZLAD 4DRBA 1H3OB 4KGCD 2NQBC 5BT1D 3VH6T 4J8XB 3AV1C 3F6TA 1P3IB 1P3FC 2HUEB 5AV9A 5B0ZC 3B6FB 2Y2MA 3AZFA 5AV9D 3LZ0C 3REJC 5B32B 3UTAD 2JCHA 3MGPA 3AZFD 4J8VC 3IP4C 3AZGA 3AN2A 3MGPD 4KUDB 5AV8A 3A6NA 3AZGD 3KWQC 3AN2D 5GT0C 3AZKA 3AZIC 3NQUB 1P3OA 5AV8D 3WAAB 3A6ND 3EPLA 3AZKD 1P3OD 1AOIA 5C3IB 4XUJA 3KUYA 4J8XA 3RELC 5B31G 1R4VA 1AOID 1EQZB 4XUJD 3KUYD 4J8XD 1P3ID 3MVDC 5B32A 2FJ7B 2G5IC 1B67A 3B6GB 3AV2A 5B32D 4KUDA 3AZLB 5CPIB 1KU5A 3AV2D 3MNNB 4KUDD 2LY8A 5AVCC 5AY8C 4CSRB 3VH6W 5E5AB 4WJ3C 1KX5C 3MGSB 1P3BB 4WU9C 5AVBA 1KX4A 1EQZA 1M19C 4LD9C 3X1TC 3W97B 5CPJC 3MGRB 4H9PA 5AVBD 4WV4B 1KX4D 1EQZD 2NQBB 1BH8A 4G92C 4UUZA 2FJ7A 2RVQD 5KDMB 5BT1C 3B6GA 1P3FB 4H9QA 5B0ZB 3AZLA 2FJ7D 2F8NA 5CPIA 3B6GD 4R8PC 3AZLD 5JRGC 2F8ND 3LZ0B 3REJB 2FFFB 5CPID 1PZRA 5AV9C 4J8VB 2Y2IA 3MGSA 3AZFC 1M1AA 1P3BA 5E5AD 3KWQB 1P3KA 5GT0B 3MGPC 3MGSD 3MGRA 3AZIB 1P3BD 1M1AD 5AV5A 3AN2C 3MGRD 3X1SA 5AV5D 3B0BA 3A6NC 3RELB 3AV1A 3AZKC 5G49B 3X1SD 3LZ1B 3AV1D 5B0ZA 1AOIC 4XUJC 3KUYC 3MVDB 5B0ZD 1HQ3A 3NQJA 3LZ0A 2Y2NA 3C1CC 2BG1A 3LZ0D 4J8VD 1ULYA 5DNNA 3KWQA 3AZIA 2Y2KA 5AVCB 4H9RB 3KWQD 3AV2C 5AY8B 5GT0D 3AZID 3LELC 5B40A 1KX5B 5G49A 4WU9B 5B40D 1M19B 4LD9B 3RELD 3X1TB 5CPJB 3REIA 3REID 3REKC 4G92B 5AVBC 2RVQC 3W96C 5F99C 4R8PB 5BNVB 5JRGB 4XZQA 3AZMA 5AY8A 3X1VA 5AV9B 4XZQD 3AZMD 1HTAA 5AY8D 3AZFB 1M19A 5CPJA 3MGPB 3KSYA 4G91C 3LJAA 1M19D 4LD9D 3AN2B 5CPJD 3UTBA 2F2AC 2BYMA 1M1AC 3LJAD 3A6NB 1P3AC 1JFIB 4ZUXC 1P3KC 2Y2JA 3AZKB 5AV5C 3EPKA 1M18A 1AOIB 3X1SC 4XUJB 3KUYB 3WTPE 4R8PA 1TAFA 1M18D 5BNVA 5JRGA 3C1CB 4R8PD 3O62C 3AZEA 2Y2GA 5JRGD 3X1UC 3AZED 4M6BA 2W8SA 1HQ3C 4NE3A 3AV2B 3LELB 1N1JB 5DNNC 1JFIA 2NZDA 3H0RC 2Y2LA 4YS3C 2NZDD 5BO0B 5B40C 3AZHC 3REKB 5AVBB 1KX4B 4EO5C 3C1CA 3AYWA 3REIC 4H9PB 4Z2MG 3AYWD 3C1CD 3W96B 1BH8B 5F99B 4UUZB 5AV6A 1F1EA 3C1BA 4X23C 5AV6D 4H9QB 3FDDA 4NE5A 1N1JA 5GSUA 3LELA 3C1BD 2F8NB 3LELD 4XZQC 1TZYC 3WKJC 3AZMC 5JA4A 5GT3A 4G91B 3X1VC 2J8PA 4YM6A 5BO0A 4J8WC 5GT3D 1M1AB 3REKA 1T3UA 4YM6D 1P3AB 4ZUXB 1P3KB 3REKD 3LJAC 5AV5B 3TU4A 1BH9A 3UTBC 3W96A 3X1SB 5F99A 3TU4D 4H9SA 3AV1B 3W96D 5B32G 2JE5A 5F99D 3O62B 1M18C 2ZY5A 3X1UB 5B33C 4H9NB 1HQ3B 3NQJB 4Z2MH 3WA9C 2CWEA 3AZEC 5B1LC 4ZBJC 1P3AA 5DNNB 2JSSA 4ZUXA 4E44A 2Y2PA 1P3AD 4ZUXD 1P3KD 4NFTA 5B40B 3VH5A 3AZHB 2NZDC 4WU8A 1P3MA 4EO5B 3O62A 3REIB 5B0YC 5CPKC 2DF4C 4WU8D 5B31C 3X1UA 1P3MD 3O62D 4KHAB 2F8NG 4H9NA 3X1UD 4JJNC 3AYWC 5CP6A 3H0MC 1HQ3D 3VH5T 5CP6D 5AV6C 3C1BC 4XZQB 1TZYB 3WKJB 3AZMB 5DNND 4YS3A 5GSUC 5B2IC 4J8WB 4UPKA 3X1VB 2F8NK 2ZY4A 4YS3D 3AZHA 4CAYA 5GT3C 3AZHD 3LJAB 4YM6C 4KHAA 3UTBB 2BYMB 3REHC 3EPJA 1F66C 4X23A 3TU4C 1M18B 4X23D 1Z2CB 3AFAA 4H9SC 5B33B 1TAFB 3WKJA 1TZYA 3WA9B 4H9OA 5GXQC 3AZEB 5B1LB 2F8NH 4J8WA 3WKJD 1TZYD 4ZBJB 3X1VD 1U35A 4J8WD 3WAAC 1WWIA 2PYOA 1U35D 3MGQA 2UWXA 2PYOD 3KXBA 4DQYB 3UTBD 3KXBD 3VH5W 2HIOC 2NZDB 2CV5C 4Z5TA 5B0YB 5CPKB 5B31B 5B33A 5B24A 4J8UC 1P34A 2VQRA 4WU8C 1P3MC 4JJNB 5B33D 5B24D 2ZY2A 4Z66A 5B1LA 3AYWB 1P34D 3WA9D 3MNNC 2G5HC 5B1LD 5AV6B 2XD5A 2RIQA 3VH6A 5CP6C 3C1BB 1P3LC 2AROC 5GSUB 5B2IB 5B2JA 5B1MA 1KX3A 5B2JD 4E45A 2Y2HA 2BYKA 5JA4B 5GT3B 2ZM5A 5B0YA 3AZNA 5CPKA 4YM6B 3UT9A 1KX3D 5B31A 5B0YD 3AZND 3B0CT 5CPKD 3UT9D 5B31D 4JJNA 4QLCC 3REHB 1F66B 1WWSA 3TU4B 1P3GC 3W99A 1BH9B 3UTAA 3EPHA 3A1IA 4JJND 5CHLB 3W99D 1P3PC 5DNMC 2Y2QA 1ID3A 3H0LC 5GXQB 5B2IA 1ID3D 3V9RB 3AFAC 3WTPA 5GSUD 5B2ID 1H3OA 3WTPD 4AWLC 5FUGB 1U35C 2ZY3A 3LZ1C 3REHA 1P3IA 2PYOC 2HIOB 1F66A 5BS7A 2CV5B 3MGQC 3B6FA 3REHD 3KXBC 1F66D 3B6FD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J8U B;  1S32 C;  4WU8 B;  1P3M B;  5GXQ A;  4Z5T C;  3W98 C;  3V9R A;  3AZJ C;  5GXQ D;  5B24 C;  1P34 C;  3NQU A;  4DRA A;  3WAA A;  5CP6 B;  4Z66 C;  1P3L B;  3WAA D;  2ARO B;  3B0C W;  5FUG A;  2IO5 C;  5BNX B;  2HIO A;  2CV5 A;  4YS3 B;  2HIO D;  5B2J C;  2CV5 D;  5B1M C;  4NE6 A;  4J8U A;  1ZLA C;  4KGC C;  1KX3 C;  4CAY B;  4QLC B;  4J8U D;  3AZN C;  1P3G B;  3UT9 C;  3MNN A;  3MNN D;  1P3P B;  5DNM B;  4X23 B;  3W99 C;  4CSR A;  1P3L A;  5E5A A;  3UTA C;  2ARO A;  3AFA B;  1P3L D;  5BNX A;  3W97 A;  2ARO D;  1ID3 C;  4HGA C;  3AZG C;  4H9O B;  3W97 D;  2NQB A;  2YFV B;  4AWL B;  5AV8 C;  3B0D C;  3WTP C;  2NQB D;  1U35 B;  1P3O C;  3R45 B;  5KDM A;  4QLC A;  2PYO B;  1P3F A;  1P3G A;  3MGQ B;  4QLC D;  3KXB B;  4J8X C;  1P3F D;  1P3G D;  3REJ A;  1P3I C;  1P3P A;  5DNM A;  2HUE C;  4J8V A;  5BS7 C;  1S32 B;  3REJ D;  4Z5T B;  3B6F C;  1P3P D;  3W98 B;  5DNM D;  4WZS B;  3AZJ B;  1A7W A;  5B32 C;  5B24 B;  5GT0 A;  1P34 B;  3AFA D;  4Z66 B;  2YFV A;  4KUD C;  3REL A;  3R45 A;  2IO5 B;  3LZ1 A;  5C3I C;  3LZ1 D;  3MVD A;  5B2J B;  2YFW B;  1KX4 C;  4WNN B;  3MGQ D;  1EQZ C;  5B1M B;  1ZLA B;  3MVD D;  1B6W A;  1KX3 B;  4KGC B;  1S32 A;  2BYK B;  3W98 A;  3AZN B;  3UT9 B;  1S32 D;  3AZJ A;  4Z5T D;  3W98 D;  2L5A A;  2FJ7 C;  5AVC A;  4H9R A;  3AZJ D;  3B6G C;  3AZL C;  3W99 B;  5CPI C;  3UTA B;  5AVC D;  1KX5 A;  4Z66 D;  4WU9 A;  4LD9 A;  3X1T A;  1KX5 D;  1ID3 B;  4HGA B;  4WU9 D;  3AZG B;  5E5A C;  3X1T D;  3MGS C;  1P3B C;  2YFW A;  5AV8 B;  4WNN A;  1BFM A;  3B0D B;  1Q9C A;  1ZLA A;  3W97 C;  3WTP B;  4KGC A;  3MGR C;  1P3O B;  5B1M D;  1ZLA D;  4DRB A;  1H3O B;  4KGC D;  2NQB C;  5BT1 D;  3VH6 T;  4J8X B;  3AV1 C;  1P3I B;  1P3F C;  2HUE B;  5AV9 A;  5B0Z C;  3B6F B;  3AZF A;  5AV9 D;  3LZ0 C;  3REJ C;  5B32 B;  3UTA D;  3MGP A;  3AZF D;  4J8V C;  3AZG A;  3AN2 A;  3MGP D;  4KUD B;  5AV8 A;  3A6N A;  3AZG D;  3KWQ C;  3AN2 D;  5GT0 C;  3AZK A;  3AZI C;  3NQU B;  1P3O A;  5AV8 D;  3WAA B;  3A6N D;  3AZK D;  1P3O D;  1AOI A;  5C3I B;  4XUJ A;  3KUY A;  4J8X A;  3REL C;  5B31 G;  1R4V A;  1AOI D;  1EQZ B;  4XUJ D;  3KUY D;  4J8X D;  1P3I D;  3MVD C;  5B32 A;  2FJ7 B;  1B67 A;  3B6G B;  3AV2 A;  5B32 D;  4KUD A;  3AZL B;  5CPI B;  1KU5 A;  3AV2 D;  3MNN B;  4KUD D;  2LY8 A;  5AVC C;  5AY8 C;  4CSR B;  3VH6 W;  5E5A B;  1KX5 C;  3MGS B;  1P3B B;  4WU9 C;  5AVB A;  1KX4 A;  1EQZ A;  1M19 C;  4LD9 C;  3X1T C;  3W97 B;  5CPJ C;  3MGR B;  4H9P A;  5AVB D;  4WV4 B;  1KX4 D;  1EQZ D;  2NQB B;  1BH8 A;  4G92 C;  4UUZ A;  2FJ7 A;  2RVQ D;  5KDM B;  5BT1 C;  3B6G A;  1P3F B;  4H9Q A;  5B0Z B;  3AZL A;  2FJ7 D;  2F8N A;  5CPI A;  3B6G D;  4R8P C;  3AZL D;  5JRG C;  2F8N D;  3LZ0 B;  3REJ B;  5CPI D;  4J8V B;  5AV9 C;  3MGS A;  3AZF C;  1M1A A;  1P3B A;  5E5A D;  3KWQ B;  1P3K A;  5GT0 B;  3MGP C;  3MGS D;  3MGR A;  3AZI B;  1P3B D;  1M1A D;  5AV5 A;  3AN2 C;  3MGR D;  3X1S A;  5AV5 D;  3B0B A;  3A6N C;  3REL B;  3AV1 A;  3AZK C;  5G49 B;  3X1S D;  3LZ1 B;  3AV1 D;  5B0Z A;  1AOI C;  4XUJ C;  3KUY C;  3MVD B;  5B0Z D;  1HQ3 A;  3NQJ A;  3LZ0 A;  3C1C C;  3LZ0 D;  4J8V D;  1ULY A;  5DNN A;  3KWQ A;  3AZI A;  5AVC B;  4H9R B;  3KWQ D;  3AV2 C;  5AY8 B;  5GT0 D;  3AZI D;  3LEL C;  5B40 A;  1KX5 B;  5G49 A;  4WU9 B;  5B40 D;  1M19 B;  4LD9 B;  3REL D;  3X1T B;  5CPJ B;  3REI A;  3REI D;  3REK C;  4G92 B;  5AVB C;  2RVQ C;  3W96 C;  5F99 C;  4R8P B;  5BNV B;  5JRG B;  4XZQ A;  3AZM A;  5AY8 A;  3X1V A;  5AV9 B;  4XZQ D;  3AZM D;  1HTA A;  5AY8 D;  3AZF B;  1M19 A;  5CPJ A;  3MGP B;  3KSY A;  4G91 C;  3LJA A;  1M19 D;  4LD9 D;  3AN2 B;  5CPJ D;  3UTB A;  2BYM A;  1M1A C;  3LJA D;  3A6N B;  1P3A C;  1JFI B;  4ZUX C;  1P3K C;  3AZK B;  5AV5 C;  1M18 A;  1AOI B;  3X1S C;  4XUJ B;  3KUY B;  3WTP E;  4R8P A;  1TAF A;  1M18 D;  5BNV A;  5JRG A;  3C1C B;  4R8P D;  3O62 C;  3AZE A;  5JRG D;  3X1U C;  3AZE D;  4M6B A;  1HQ3 C;  4NE3 A;  3AV2 B;  3LEL B;  1N1J B;  5DNN C;  1JFI A;  2NZD A;  4YS3 C;  2NZD D;  5BO0 B;  5B40 C;  3AZH C;  3REK B;  5AVB B;  1KX4 B;  4EO5 C;  3C1C A;  3AYW A;  3REI C;  4H9P B;  4Z2M G;  3AYW D;  3C1C D;  3W96 B;  1BH8 B;  5F99 B;  4UUZ B;  5AV6 A;  1F1E A;  3C1B A;  4X23 C;  5AV6 D;  4H9Q B;  4NE5 A;  5GSU A;  1N1J A;  3LEL A;  3C1B D;  2F8N B;  3LEL D;  4XZQ C;  1TZY C;  3WKJ C;  3AZM C;  5JA4 A;  5GT3 A;  4G91 B;  3X1V C;  4YM6 A;  5BO0 A;  4J8W C;  5GT3 D;  1M1A B;  3REK A;  4YM6 D;  1P3A B;  4ZUX B;  1P3K B;  3REK D;  3LJA C;  5AV5 B;  3TU4 A;  1BH9 A;  3UTB C;  3W96 A;  3X1S B;  5F99 A;  3TU4 D;  4H9S A;  3AV1 B;  3W96 D;  5B32 G;  5F99 D;  3O62 B;  1M18 C;  3X1U B;  5B33 C;  4H9N B;  1HQ3 B;  3NQJ B;  4Z2M H;  3WA9 C;  2CWE A;  3AZE C;  5B1L C;  4ZBJ C;  1P3A A;  5DNN B;  2JSS A;  4ZUX A;  4E44 A;  1P3A D;  4ZUX D;  1P3K D;  4NFT A;  5B40 B;  3VH5 A;  3AZH B;  2NZD C;  4WU8 A;  1P3M A;  4EO5 B;  3O62 A;  3REI B;  5B0Y C;  5CPK C;  4WU8 D;  3X1U A;  5B31 C;  1P3M D;  3O62 D;  4KHA B;  2F8N G;  4H9N A;  3X1U D;  4JJN C;  3AYW C;  5CP6 A;  1HQ3 D;  3VH5 T;  5CP6 D;  5AV6 C;  3C1B C;  4XZQ B;  1TZY B;  3WKJ B;  3AZM B;  5DNN D;  4YS3 A;  5GSU C;  5B2I C;  4J8W B;  3X1V B;  2F8N K;  4YS3 D;  3AZH A;  4CAY A;  5GT3 C;  3AZH D;  3LJA B;  4YM6 C;  4KHA A;  3UTB B;  2BYM B;  3REH C;  1F66 C;  4X23 A;  3TU4 C;  1M18 B;  4X23 D;  3AFA A;  4H9S C;  5B33 B;  1TAF B;  3WKJ A;  1TZY A;  3WA9 B;  4H9O A;  5GXQ C;  3AZE B;  5B1L B;  2F8N H;  4J8W A;  3WKJ D;  1TZY D;  4ZBJ B;  3X1V D;  1U35 A;  4J8W D;  3WAA C;  1WWI A;  2PYO A;  1U35 D;  3MGQ A;  2PYO D;  3KXB A;  3UTB D;  3KXB D;  3VH5 W;  2HIO C;  2NZD B;  2CV5 C;  4Z5T A;  5B0Y B;  5CPK B;  5B31 B;  5B33 A;  5B24 A;  4J8U C;  1P34 A;  4WU8 C;  1P3M C;  4JJN B;  5B33 D;  5B24 D;  3AYW B;  4Z66 A;  5B1L A;  1P34 D;  3WA9 A;  3WA9 D;  3MNN C;  5B1L D;  5AV6 B;  3VH6 A;  5CP6 C;  3C1B B;  1P3L C;  2ARO C;  5GSU B;  5B2I B;  5B2J A;  5B1M A;  1KX3 A;  5B2J D;  4E45 A;  5JA4 B;  2BYK A;  5GT3 B;  5B0Y A;  3AZN A;  5CPK A;  4YM6 B;  3UT9 A;  1KX3 D;  5B31 A;  5B0Y D;  3AZN D;  3B0C T;  5CPK D;  3UT9 D;  5B31 D;  4JJN A;  4QLC C;  3REH B;  1F66 B;  1WWS A;  3TU4 B;  1P3G C;  3W99 A;  1BH9 B;  3UTA A;  4JJN D;  5CHL B;  3W99 D;  1P3P C;  5DNM C;  1ID3 A;  5GXQ B;  5B2I A;  1ID3 D;  3V9R B;  3AFA C;  3WTP A;  5GSU D;  5B2I D;  1H3O A;  3WTP D;  4AWL C;  5FUG B;  1U35 C;  3LZ1 C;  3REH A;  1P3I A;  2PYO C;  2HIO B;  1F66 A;  5BS7 A;  2CV5 B;  3MGQ C;  3B6F A;  3REH D;  3KXB C;  1F66 D;  3B6F D; 
#chains in the Genus database with same CATH topology
 4J8U B;  1S32 C;  4WU8 B;  1P3M B;  5GXQ A;  4Z5T C;  3W98 C;  3V9R A;  3AZJ C;  5GXQ D;  5B24 C;  1P34 C;  3NQU A;  4DRA A;  3WAA A;  5CP6 B;  4Z66 C;  1P3L B;  3WAA D;  2ARO B;  3B0C W;  5FUG A;  2IO5 C;  5BNX B;  2HIO A;  2CV5 A;  4YS3 B;  2HIO D;  5B2J C;  2CV5 D;  5B1M C;  4NE6 A;  4J8U A;  1ZLA C;  4KGC C;  1KX3 C;  4CAY B;  4QLC B;  4J8U D;  3AZN C;  1P3G B;  3UT9 C;  3MNN A;  3MNN D;  1P3P B;  5DNM B;  4X23 B;  3W99 C;  4CSR A;  1P3L A;  5E5A A;  3UTA C;  2ARO A;  3WA9 A;  3AFA B;  1P3L D;  5BNX A;  3W97 A;  2ARO D;  1ID3 C;  4HGA C;  3AZG C;  4H9O B;  3W97 D;  2NQB A;  2YFV B;  4AWL B;  5AV8 C;  3B0D C;  2Y2O A;  3WTP C;  1U35 B;  1P3O C;  2NQB D;  3R45 B;  5KDM A;  4QLC A;  2PYO B;  1P3F A;  1P3G A;  3MGQ B;  4QLC D;  3KXB B;  4J8X C;  1P3F D;  1P3G D;  3AL0 C;  3REJ A;  1P3I C;  1P3P A;  5DNM A;  2HUE C;  4J8V A;  2XD1 A;  5BS7 C;  2DQN C;  1S32 B;  3REJ D;  4Z5T B;  3B6F C;  1P3P D;  3W98 B;  5DNM D;  4WZS B;  3AZJ B;  1A7W A;  5B32 C;  5B24 B;  5GT0 A;  1P34 B;  3AFA D;  4Z66 B;  2YFV A;  4KUD C;  3REL A;  3KFU G;  3R45 A;  2IO5 B;  3LZ1 A;  3A1K A;  5C3I C;  3LZ1 D;  3MVD A;  3EG5 B;  5B2J B;  2YFW B;  1KX4 C;  4WNN B;  3MGQ D;  1EQZ C;  5B1M B;  1ZLA B;  3MVD D;  1B6W A;  1KX3 B;  4KGC B;  1S32 A;  3P5J B;  2BYK B;  3W98 A;  3AZN B;  3UT9 B;  1S32 D;  3AZJ A;  4Z5T D;  3W98 D;  2L5A A;  2FJ7 C;  5AVC A;  4H9R A;  3AZJ D;  3B6G C;  3AZL C;  3W99 B;  5CPI C;  3UTA B;  5AVC D;  1KX5 A;  4Z66 D;  4WU9 A;  4LD9 A;  3X1T A;  1KX5 D;  1ID3 B;  4HGA B;  4WU9 D;  3AZG B;  5E5A C;  3X1T D;  3MGS C;  1P3B C;  2YFW A;  5AV8 B;  4WNN A;  1BFM A;  3B0D B;  1Q9C A;  1ZLA A;  3W97 C;  3WTP B;  4KGC A;  3MGR C;  1P3O B;  1W2E A;  5B1M D;  1ZLA D;  4DRB A;  1H3O B;  4KGC D;  2NQB C;  5BT1 D;  3VH6 T;  4J8X B;  3AV1 C;  3F6T A;  1P3I B;  1P3F C;  2HUE B;  5AV9 A;  5B0Z C;  3B6F B;  2Y2M A;  3AZF A;  5AV9 D;  3LZ0 C;  3REJ C;  5B32 B;  3UTA D;  2JCH A;  3MGP A;  3AZF D;  4J8V C;  3IP4 C;  3AZG A;  3AN2 A;  3MGP D;  4KUD B;  5AV8 A;  3A6N A;  3AZG D;  3KWQ C;  3AN2 D;  5GT0 C;  3AZK A;  3AZI C;  3NQU B;  1P3O A;  5AV8 D;  3WAA B;  3A6N D;  3EPL A;  3AZK D;  1P3O D;  1AOI A;  5C3I B;  4XUJ A;  3KUY A;  4J8X A;  3REL C;  5B31 G;  1R4V A;  1AOI D;  1EQZ B;  4XUJ D;  3KUY D;  4J8X D;  1P3I D;  3MVD C;  5B32 A;  2FJ7 B;  2G5I C;  1B67 A;  3B6G B;  3AV2 A;  5B32 D;  4KUD A;  3AZL B;  5CPI B;  1KU5 A;  3AV2 D;  3MNN B;  4KUD D;  2LY8 A;  5AVC C;  5AY8 C;  4CSR B;  3VH6 W;  5E5A B;  4WJ3 C;  1KX5 C;  3MGS B;  1P3B B;  4WU9 C;  5AVB A;  1KX4 A;  1EQZ A;  1M19 C;  4LD9 C;  3X1T C;  3W97 B;  5CPJ C;  3MGR B;  4H9P A;  5AVB D;  4WV4 B;  1KX4 D;  1EQZ D;  2NQB B;  1BH8 A;  4G92 C;  4UUZ A;  2FJ7 A;  2RVQ D;  5KDM B;  5BT1 C;  3B6G A;  1P3F B;  4H9Q A;  5B0Z B;  3AZL A;  2FJ7 D;  2F8N A;  5CPI A;  3B6G D;  4R8P C;  3AZL D;  5JRG C;  2F8N D;  3LZ0 B;  3REJ B;  2FFF B;  5CPI D;  1PZR A;  5AV9 C;  4J8V B;  2Y2I A;  3MGS A;  3AZF C;  1M1A A;  1P3B A;  5E5A D;  3KWQ B;  1P3K A;  5GT0 B;  3MGP C;  3MGS D;  3MGR A;  3AZI B;  1P3B D;  1M1A D;  5AV5 A;  3AN2 C;  3MGR D;  3X1S A;  5AV5 D;  3B0B A;  3A6N C;  3REL B;  3AV1 A;  3AZK C;  5G49 B;  3X1S D;  3LZ1 B;  3AV1 D;  5B0Z A;  1AOI C;  4XUJ C;  3KUY C;  3MVD B;  5B0Z D;  1HQ3 A;  3NQJ A;  3LZ0 A;  2Y2N A;  3C1C C;  2BG1 A;  3LZ0 D;  4J8V D;  1ULY A;  5DNN A;  3KWQ A;  3AZI A;  2Y2K A;  5AVC B;  4H9R B;  3KWQ D;  3AV2 C;  5AY8 B;  5GT0 D;  3AZI D;  3LEL C;  5B40 A;  1KX5 B;  5G49 A;  4WU9 B;  5B40 D;  1M19 B;  4LD9 B;  3REL D;  3X1T B;  5CPJ B;  3REI A;  3REI D;  3REK C;  4G92 B;  5AVB C;  2RVQ C;  3W96 C;  5F99 C;  4R8P B;  5BNV B;  5JRG B;  4XZQ A;  3AZM A;  5AY8 A;  3X1V A;  5AV9 B;  4XZQ D;  3AZM D;  1HTA A;  5AY8 D;  3AZF B;  1M19 A;  5CPJ A;  3MGP B;  3KSY A;  4G91 C;  3LJA A;  1M19 D;  4LD9 D;  3AN2 B;  5CPJ D;  3UTB A;  2F2A C;  2BYM A;  1M1A C;  3LJA D;  3A6N B;  1P3A C;  1JFI B;  4ZUX C;  1P3K C;  2Y2J A;  3AZK B;  5AV5 C;  3EPK A;  1M18 A;  1AOI B;  3X1S C;  4XUJ B;  3KUY B;  3WTP E;  4R8P A;  1TAF A;  1M18 D;  5BNV A;  5JRG A;  3C1C B;  4R8P D;  3O62 C;  3AZE A;  2Y2G A;  5JRG D;  3X1U C;  3AZE D;  4M6B A;  2W8S A;  1HQ3 C;  4NE3 A;  3AV2 B;  3LEL B;  1N1J B;  5DNN C;  1JFI A;  2NZD A;  3H0R C;  2Y2L A;  4YS3 C;  2NZD D;  5BO0 B;  5B40 C;  3AZH C;  3REK B;  5AVB B;  1KX4 B;  4EO5 C;  3C1C A;  3AYW A;  3REI C;  4H9P B;  4Z2M G;  3AYW D;  3C1C D;  3W96 B;  1BH8 B;  5F99 B;  4UUZ B;  5AV6 A;  1F1E A;  3C1B A;  4X23 C;  5AV6 D;  4H9Q B;  3FDD A;  4NE5 A;  1N1J A;  5GSU A;  3LEL A;  3C1B D;  2F8N B;  3LEL D;  4XZQ C;  1TZY C;  3WKJ C;  3AZM C;  5JA4 A;  5GT3 A;  4G91 B;  3X1V C;  2J8P A;  4YM6 A;  5BO0 A;  4J8W C;  5GT3 D;  1M1A B;  3REK A;  1T3U A;  4YM6 D;  1P3A B;  4ZUX B;  1P3K B;  3REK D;  3LJA C;  5AV5 B;  3TU4 A;  1BH9 A;  3UTB C;  3W96 A;  3X1S B;  5F99 A;  3TU4 D;  4H9S A;  3AV1 B;  3W96 D;  5B32 G;  2JE5 A;  5F99 D;  3O62 B;  1M18 C;  2ZY5 A;  3X1U B;  5B33 C;  4H9N B;  1HQ3 B;  3NQJ B;  4Z2M H;  3WA9 C;  2CWE A;  3AZE C;  5B1L C;  4ZBJ C;  1P3A A;  5DNN B;  2JSS A;  4ZUX A;  4E44 A;  2Y2P A;  1P3A D;  4ZUX D;  1P3K D;  4NFT A;  5B40 B;  3VH5 A;  3AZH B;  2NZD C;  4WU8 A;  1P3M A;  4EO5 B;  3O62 A;  3REI B;  5B0Y C;  5CPK C;  2DF4 C;  4WU8 D;  5B31 C;  3X1U A;  1P3M D;  3O62 D;  4KHA B;  2F8N G;  4H9N A;  3X1U D;  4JJN C;  3AYW C;  5CP6 A;  3H0M C;  1HQ3 D;  3VH5 T;  5CP6 D;  5AV6 C;  3C1B C;  4XZQ B;  1TZY B;  3WKJ B;  3AZM B;  5DNN D;  4YS3 A;  5GSU C;  5B2I C;  4J8W B;  4UPK A;  3X1V B;  2F8N K;  2ZY4 A;  4YS3 D;  3AZH A;  4CAY A;  5GT3 C;  3AZH D;  3LJA B;  4YM6 C;  4KHA A;  3UTB B;  2BYM B;  3REH C;  3EPJ A;  1F66 C;  4X23 A;  3TU4 C;  1M18 B;  4X23 D;  1Z2C B;  3AFA A;  4H9S C;  5B33 B;  1TAF B;  3WKJ A;  1TZY A;  3WA9 B;  4H9O A;  5GXQ C;  3AZE B;  5B1L B;  2F8N H;  4J8W A;  3WKJ D;  1TZY D;  4ZBJ B;  3X1V D;  1U35 A;  4J8W D;  3WAA C;  1WWI A;  2PYO A;  1U35 D;  3MGQ A;  2UWX A;  2PYO D;  3KXB A;  4DQY B;  3UTB D;  3KXB D;  3VH5 W;  2HIO C;  2NZD B;  2CV5 C;  4Z5T A;  5B0Y B;  5CPK B;  5B31 B;  5B33 A;  5B24 A;  4J8U C;  1P34 A;  2VQR A;  4WU8 C;  1P3M C;  4JJN B;  5B33 D;  5B24 D;  2ZY2 A;  4Z66 A;  5B1L A;  3AYW B;  1P34 D;  3WA9 D;  3MNN C;  2G5H C;  5B1L D;  5AV6 B;  2XD5 A;  2RIQ A;  3VH6 A;  5CP6 C;  3C1B B;  1P3L C;  2ARO C;  5GSU B;  5B2I B;  5B2J A;  5B1M A;  1KX3 A;  5B2J D;  4E45 A;  2Y2H A;  2BYK A;  5JA4 B;  5GT3 B;  2ZM5 A;  5B0Y A;  3AZN A;  5CPK A;  4YM6 B;  3UT9 A;  1KX3 D;  5B31 A;  5B0Y D;  3AZN D;  3B0C T;  5CPK D;  3UT9 D;  5B31 D;  4JJN A;  4QLC C;  3REH B;  1F66 B;  1WWS A;  3TU4 B;  1P3G C;  3W99 A;  1BH9 B;  3UTA A;  3EPH A;  3A1I A;  4JJN D;  5CHL B;  3W99 D;  1P3P C;  5DNM C;  2Y2Q A;  1ID3 A;  3H0L C;  5GXQ B;  5B2I A;  1ID3 D;  3V9R B;  3AFA C;  3WTP A;  5GSU D;  5B2I D;  1H3O A;  3WTP D;  4AWL C;  5FUG B;  1U35 C;  2ZY3 A;  3LZ1 C;  3REH A;  1P3I A;  2PYO C;  2HIO B;  1F66 A;  5BS7 A;  2CV5 B;  3MGQ C;  3B6F A;  3REH D;  3KXB C;  1F66 D;  3B6F D; 
#chains in the Genus database with same CATH homology
 4J8U B;  1S32 C;  4WU8 B;  1P3M B;  5GXQ A;  4Z5T C;  3W98 C;  3V9R A;  3AZJ C;  5GXQ D;  5B24 C;  1P34 C;  3NQU A;  4DRA A;  3WAA A;  5CP6 B;  4Z66 C;  1P3L B;  3WAA D;  2ARO B;  3B0C W;  5FUG A;  2IO5 C;  5BNX B;  2HIO A;  2CV5 A;  4YS3 B;  2HIO D;  5B2J C;  2CV5 D;  5B1M C;  4NE6 A;  4J8U A;  1ZLA C;  4KGC C;  1KX3 C;  4CAY B;  4QLC B;  4J8U D;  3AZN C;  1P3G B;  3UT9 C;  3MNN A;  3MNN D;  1P3P B;  5DNM B;  4X23 B;  3W99 C;  4CSR A;  1P3L A;  5E5A A;  3UTA C;  2ARO A;  3WA9 A;  3AFA B;  1P3L D;  5BNX A;  3W97 A;  2ARO D;  1ID3 C;  4HGA C;  3AZG C;  4H9O B;  3W97 D;  2NQB A;  2YFV B;  4AWL B;  5AV8 C;  3B0D C;  2Y2O A;  3WTP C;  1U35 B;  1P3O C;  2NQB D;  3R45 B;  5KDM A;  4QLC A;  2PYO B;  1P3F A;  1P3G A;  3MGQ B;  4QLC D;  3KXB B;  4J8X C;  1P3F D;  1P3G D;  3AL0 C;  3REJ A;  1P3I C;  1P3P A;  5DNM A;  2HUE C;  4J8V A;  2XD1 A;  5BS7 C;  2DQN C;  1S32 B;  3REJ D;  4Z5T B;  3B6F C;  1P3P D;  3W98 B;  5DNM D;  4WZS B;  3AZJ B;  1A7W A;  5B32 C;  5B24 B;  5GT0 A;  1P34 B;  3AFA D;  4Z66 B;  2YFV A;  4KUD C;  3REL A;  3KFU G;  3R45 A;  2IO5 B;  3LZ1 A;  3A1K A;  5C3I C;  3LZ1 D;  3MVD A;  3EG5 B;  5B2J B;  2YFW B;  1KX4 C;  4WNN B;  3MGQ D;  1EQZ C;  5B1M B;  1ZLA B;  3MVD D;  1B6W A;  1KX3 B;  4KGC B;  1S32 A;  3P5J B;  2BYK B;  3W98 A;  3AZN B;  3UT9 B;  1S32 D;  3AZJ A;  4Z5T D;  3W98 D;  2L5A A;  2FJ7 C;  5AVC A;  4H9R A;  3AZJ D;  3B6G C;  3AZL C;  3W99 B;  5CPI C;  3UTA B;  5AVC D;  1KX5 A;  4Z66 D;  4WU9 A;  4LD9 A;  3X1T A;  1KX5 D;  1ID3 B;  4HGA B;  4WU9 D;  3AZG B;  5E5A C;  3X1T D;  3MGS C;  1P3B C;  2YFW A;  5AV8 B;  4WNN A;  1BFM A;  3B0D B;  1Q9C A;  1ZLA A;  3W97 C;  3WTP B;  4KGC A;  3MGR C;  1P3O B;  1W2E A;  5B1M D;  1ZLA D;  4DRB A;  1H3O B;  4KGC D;  2NQB C;  5BT1 D;  3VH6 T;  4J8X B;  3AV1 C;  3F6T A;  1P3I B;  1P3F C;  2HUE B;  5AV9 A;  5B0Z C;  3B6F B;  2Y2M A;  3AZF A;  5AV9 D;  3LZ0 C;  3REJ C;  5B32 B;  3UTA D;  2JCH A;  3MGP A;  3AZF D;  4J8V C;  3IP4 C;  3AZG A;  3AN2 A;  3MGP D;  4KUD B;  5AV8 A;  3A6N A;  3AZG D;  3KWQ C;  3AN2 D;  5GT0 C;  3AZK A;  3AZI C;  3NQU B;  1P3O A;  5AV8 D;  3WAA B;  3A6N D;  3EPL A;  3AZK D;  1P3O D;  1AOI A;  5C3I B;  4XUJ A;  3KUY A;  4J8X A;  3REL C;  5B31 G;  1R4V A;  1AOI D;  1EQZ B;  4XUJ D;  3KUY D;  4J8X D;  1P3I D;  3MVD C;  5B32 A;  2FJ7 B;  2G5I C;  1B67 A;  3B6G B;  3AV2 A;  5B32 D;  4KUD A;  3AZL B;  5CPI B;  1KU5 A;  3AV2 D;  3MNN B;  4KUD D;  2LY8 A;  5AVC C;  5AY8 C;  4CSR B;  3VH6 W;  5E5A B;  4WJ3 C;  1KX5 C;  3MGS B;  1P3B B;  4WU9 C;  5AVB A;  1KX4 A;  1EQZ A;  1M19 C;  4LD9 C;  3X1T C;  3W97 B;  5CPJ C;  3MGR B;  4H9P A;  5AVB D;  4WV4 B;  1KX4 D;  1EQZ D;  2NQB B;  1BH8 A;  4G92 C;  4UUZ A;  2FJ7 A;  2RVQ D;  5KDM B;  5BT1 C;  3B6G A;  1P3F B;  4H9Q A;  5B0Z B;  3AZL A;  2FJ7 D;  2F8N A;  5CPI A;  3B6G D;  4R8P C;  3AZL D;  5JRG C;  2F8N D;  3LZ0 B;  3REJ B;  2FFF B;  5CPI D;  1PZR A;  5AV9 C;  4J8V B;  2Y2I A;  3MGS A;  3AZF C;  1M1A A;  1P3B A;  5E5A D;  3KWQ B;  1P3K A;  5GT0 B;  3MGP C;  3MGS D;  3MGR A;  3AZI B;  1P3B D;  1M1A D;  5AV5 A;  3AN2 C;  3MGR D;  3X1S A;  5AV5 D;  3B0B A;  3A6N C;  3REL B;  3AV1 A;  3AZK C;  5G49 B;  3X1S D;  3LZ1 B;  3AV1 D;  5B0Z A;  1AOI C;  4XUJ C;  3KUY C;  3MVD B;  5B0Z D;  1HQ3 A;  3NQJ A;  3LZ0 A;  2Y2N A;  3C1C C;  2BG1 A;  3LZ0 D;  4J8V D;  1ULY A;  5DNN A;  3KWQ A;  3AZI A;  2Y2K A;  5AVC B;  4H9R B;  3KWQ D;  3AV2 C;  5AY8 B;  5GT0 D;  3AZI D;  3LEL C;  5B40 A;  1KX5 B;  5G49 A;  4WU9 B;  5B40 D;  1M19 B;  4LD9 B;  3REL D;  3X1T B;  5CPJ B;  3REI A;  3REI D;  3REK C;  4G92 B;  5AVB C;  2RVQ C;  3W96 C;  5F99 C;  4R8P B;  5BNV B;  5JRG B;  4XZQ A;  3AZM A;  5AY8 A;  3X1V A;  5AV9 B;  4XZQ D;  3AZM D;  1HTA A;  5AY8 D;  3AZF B;  1M19 A;  5CPJ A;  3MGP B;  3KSY A;  4G91 C;  3LJA A;  1M19 D;  4LD9 D;  3AN2 B;  5CPJ D;  3UTB A;  2F2A C;  2BYM A;  1M1A C;  3LJA D;  3A6N B;  1P3A C;  1JFI B;  4ZUX C;  1P3K C;  2Y2J A;  3AZK B;  5AV5 C;  3EPK A;  1M18 A;  1AOI B;  3X1S C;  4XUJ B;  3KUY B;  3WTP E;  4R8P A;  1TAF A;  1M18 D;  5BNV A;  5JRG A;  3C1C B;  4R8P D;  3O62 C;  3AZE A;  2Y2G A;  5JRG D;  3X1U C;  3AZE D;  4M6B A;  2W8S A;  1HQ3 C;  4NE3 A;  3AV2 B;  3LEL B;  1N1J B;  5DNN C;  1JFI A;  2NZD A;  3H0R C;  2Y2L A;  4YS3 C;  2NZD D;  5BO0 B;  5B40 C;  3AZH C;  3REK B;  5AVB B;  1KX4 B;  4EO5 C;  3C1C A;  3AYW A;  3REI C;  4H9P B;  4Z2M G;  3AYW D;  3C1C D;  3W96 B;  1BH8 B;  5F99 B;  4UUZ B;  5AV6 A;  1F1E A;  3C1B A;  4X23 C;  5AV6 D;  4H9Q B;  3FDD A;  4NE5 A;  1N1J A;  5GSU A;  3LEL A;  3C1B D;  2F8N B;  3LEL D;  4XZQ C;  1TZY C;  3WKJ C;  3AZM C;  5JA4 A;  5GT3 A;  4G91 B;  3X1V C;  2J8P A;  4YM6 A;  5BO0 A;  4J8W C;  5GT3 D;  1M1A B;  3REK A;  1T3U A;  4YM6 D;  1P3A B;  4ZUX B;  1P3K B;  3REK D;  3LJA C;  5AV5 B;  3TU4 A;  1BH9 A;  3UTB C;  3W96 A;  3X1S B;  5F99 A;  3TU4 D;  4H9S A;  3AV1 B;  3W96 D;  5B32 G;  2JE5 A;  5F99 D;  3O62 B;  1M18 C;  2ZY5 A;  3X1U B;  5B33 C;  4H9N B;  1HQ3 B;  3NQJ B;  4Z2M H;  3WA9 C;  2CWE A;  3AZE C;  5B1L C;  4ZBJ C;  1P3A A;  5DNN B;  2JSS A;  4ZUX A;  4E44 A;  2Y2P A;  1P3A D;  4ZUX D;  1P3K D;  4NFT A;  5B40 B;  3VH5 A;  3AZH B;  2NZD C;  4WU8 A;  1P3M A;  4EO5 B;  3O62 A;  3REI B;  5B0Y C;  5CPK C;  2DF4 C;  4WU8 D;  5B31 C;  3X1U A;  1P3M D;  3O62 D;  4KHA B;  2F8N G;  4H9N A;  3X1U D;  4JJN C;  3AYW C;  5CP6 A;  3H0M C;  1HQ3 D;  3VH5 T;  5CP6 D;  5AV6 C;  3C1B C;  4XZQ B;  1TZY B;  3WKJ B;  3AZM B;  5DNN D;  4YS3 A;  5GSU C;  5B2I C;  4J8W B;  4UPK A;  3X1V B;  2F8N K;  2ZY4 A;  4YS3 D;  3AZH A;  4CAY A;  5GT3 C;  3AZH D;  3LJA B;  4YM6 C;  4KHA A;  3UTB B;  2BYM B;  3REH C;  3EPJ A;  1F66 C;  4X23 A;  3TU4 C;  1M18 B;  4X23 D;  1Z2C B;  3AFA A;  4H9S C;  5B33 B;  1TAF B;  3WKJ A;  1TZY A;  3WA9 B;  4H9O A;  5GXQ C;  3AZE B;  5B1L B;  2F8N H;  4J8W A;  3WKJ D;  1TZY D;  4ZBJ B;  3X1V D;  1U35 A;  4J8W D;  3WAA C;  1WWI A;  2PYO A;  1U35 D;  3MGQ A;  2UWX A;  2PYO D;  3KXB A;  4DQY B;  3UTB D;  3KXB D;  3VH5 W;  2HIO C;  2NZD B;  2CV5 C;  4Z5T A;  5B0Y B;  5CPK B;  5B31 B;  5B33 A;  5B24 A;  4J8U C;  1P34 A;  2VQR A;  4WU8 C;  1P3M C;  4JJN B;  5B33 D;  5B24 D;  2ZY2 A;  4Z66 A;  5B1L A;  3AYW B;  1P34 D;  3WA9 D;  3MNN C;  2G5H C;  5B1L D;  5AV6 B;  2XD5 A;  2RIQ A;  3VH6 A;  5CP6 C;  3C1B B;  1P3L C;  2ARO C;  5GSU B;  5B2I B;  5B2J A;  5B1M A;  1KX3 A;  5B2J D;  4E45 A;  2Y2H A;  2BYK A;  5JA4 B;  5GT3 B;  2ZM5 A;  5B0Y A;  3AZN A;  5CPK A;  4YM6 B;  3UT9 A;  1KX3 D;  5B31 A;  5B0Y D;  3AZN D;  3B0C T;  5CPK D;  3UT9 D;  5B31 D;  4JJN A;  4QLC C;  3REH B;  1F66 B;  1WWS A;  3TU4 B;  1P3G C;  3W99 A;  1BH9 B;  3UTA A;  3EPH A;  3A1I A;  4JJN D;  5CHL B;  3W99 D;  1P3P C;  5DNM C;  2Y2Q A;  1ID3 A;  3H0L C;  5GXQ B;  5B2I A;  1ID3 D;  3V9R B;  3AFA C;  3WTP A;  5GSU D;  5B2I D;  1H3O A;  3WTP D;  4AWL C;  5FUG B;  1U35 C;  2ZY3 A;  3LZ1 C;  3REH A;  1P3I A;  2PYO C;  2HIO B;  1F66 A;  5BS7 A;  2CV5 B;  3MGQ C;  3B6F A;  3REH D;  3KXB C;  1F66 D;  3B6F D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...